Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.18031174115759150.0
KLLA0C05764g1173115652870.0
YBR218C (PYC2)1180115552820.0
YGL062W (PYC1)1178115552490.0
CAGL0F06941g1180115551950.0
Sklu_1458.11132111751900.0
AAR162C1171115651300.0
Scas_686.171176115551270.0
CAGL0K06787g1175115450750.0
Scas_563.121216115950560.0
CAGL0M05533g18344517672e-83
YBR208C (DUR1,2)18354487512e-81
Scas_721.4018344497342e-79
Sklu_2124.118304467201e-77
KLLA0E08107g18294467121e-76
ADR051C18194617004e-75
Kwal_27.1195118694596747e-72
KLLA0F06072g22315344963e-50
Scas_720.7422315184874e-49
CAGL0L10780g22335344857e-49
AAR071W22315324848e-49
YNR016C (ACC1)22335184767e-48
Kwal_23.615722305384741e-47
YMR207C (HFA1)21234494686e-47
Scas_582.4*21932971162e-05
CAGL0L05676g22111741000.002
YJL130C (URA2)22141741000.002
ACR263C2240232960.004
Sklu_2331.12220225930.012
Kwal_33.140612221232920.013
CAGL0C04917g1113230890.028
Kwal_27.12090394225870.034
ABR157W1113225880.043
Kwal_47.19231795122870.051
KLLA0E23782g393218840.086
Scas_712.17793164840.12
KLLA0F03190g1117176830.14
ADR107W442251810.20
KLLA0E15444g2228165810.27
Scas_701.3543074790.32
Kwal_55.197831121260800.37
Sklu_2431.2394120770.51
CAGL0H07887g791157780.57
Kwal_56.2440144174770.58
KLLA0A00957g792120780.61
KLLA0F05489g44174770.68
AGR127C56262760.93
YDL131W (LYS21)44074741.4
CAGL0J09240g43774741.5
YJR109C (CPA2)1118173741.6
Scas_704.343874731.6
CAGL0J06402g43174731.8
YDL182W (LYS20)42874731.9
Sklu_2433.7796122731.9
Scas_698.1771162732.2
Sklu_2413.41122176722.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1803
         (1157 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1803                                                         2283   0.0  
KLLA0C05764g complement(512470..515991) highly similar to sp|P32...  2041   0.0  
YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate ca...  2039   0.0  
YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase...  2026   0.0  
CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharo...  2005   0.0  
Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement        2003   0.0  
AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (P...  1980   0.0  
Scas_686.17                                                          1979   0.0  
CAGL0K06787g complement(659290..662817) highly similar to sp|P32...  1959   0.0  
Scas_563.12                                                          1952   0.0  
CAGL0M05533g complement(588667..594171) similar to sp|P32528 Sac...   300   2e-83
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...   293   2e-81
Scas_721.40                                                           287   2e-79
Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement          281   1e-77
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...   278   1e-76
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...   274   4e-75
Kwal_27.11951                                                         264   7e-72
KLLA0F06072g 583276..589971 highly similar to sp|Q00955 Saccharo...   195   3e-50
Scas_720.74                                                           192   4e-49
CAGL0L10780g complement(1149588..1156289) highly similar to sp|Q...   191   7e-49
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...   191   8e-49
YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-Co...   187   7e-48
Kwal_23.6157                                                          187   1e-47
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...   184   6e-47
Scas_582.4*                                                            49   2e-05
CAGL0L05676g 619734..626369 highly similar to sp|P07259 Saccharo...    43   0.002
YJL130C (URA2) [2788] chr10 complement(165641..172285) Multifunc...    43   0.002
ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH] (827830..83...    42   0.004
Sklu_2331.1 YJL130C, Contig c2331 2029-8691                            40   0.012
Kwal_33.14061                                                          40   0.013
CAGL0C04917g 457506..460847 highly similar to sp|P03965 Saccharo...    39   0.028
Kwal_27.12090                                                          38   0.034
ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH] complement(6...    39   0.043
Kwal_47.19231                                                          38   0.051
KLLA0E23782g complement(2105401..2106582) highly similar to sp|Q...    37   0.086
Scas_712.17                                                            37   0.12 
KLLA0F03190g complement(296883..300236) highly similar to sp|P03...    37   0.14 
ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W ...    36   0.20 
KLLA0E15444g 1370741..1377427 highly similar to sp|P07259 Saccha...    36   0.27 
Scas_701.35                                                            35   0.32 
Kwal_55.19783                                                          35   0.37 
Sklu_2431.2 YDL131W, Contig c2431 3030-4214                            34   0.51 
CAGL0H07887g 769859..772234 highly similar to sp|P07244 Saccharo...    35   0.57 
Kwal_56.24401                                                          34   0.58 
KLLA0A00957g 89999..92377 gi|9957024|gb|AAG09178.1 Kluyveromyces...    35   0.61 
KLLA0F05489g 541146..542471 highly similar to sp|Q12122 Saccharo...    34   0.68 
AGR127C [4438] [Homologous to ScYDR062W (LCB2) - SH] (992732..99...    34   0.93 
YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase...    33   1.4  
CAGL0J09240g 911669..912982 highly similar to sp|Q12122 Saccharo...    33   1.5  
YJR109C (CPA2) [3001] chr10 complement(629500..632856) Carbamoyl...    33   1.6  
Scas_704.3                                                             33   1.6  
CAGL0J06402g complement(608851..610146) highly similar to sp|Q12...    33   1.8  
YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase...    33   1.9  
Sklu_2433.7 YGL234W, Contig c2433 9525-11915                           33   1.9  
Scas_698.17                                                            33   2.2  
Sklu_2413.4 YJR109C, Contig c2413 10886-14254                          32   2.8  

>Kwal_14.1803
          Length = 1174

 Score = 2283 bits (5915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1111/1157 (96%), Positives = 1111/1157 (96%)

Query: 1    MSKLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKA 60
            MSKLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKA
Sbjct: 1    MSKLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKA 60

Query: 61   DEAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITW 120
            DEAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITW
Sbjct: 61   DEAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITW 120

Query: 121  IGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFX 180
            IGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAF 
Sbjct: 121  IGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFG 180

Query: 181  XXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVV 240
                        DDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVV
Sbjct: 181  GGGRGMRVVREGDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVV 240

Query: 241  HLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQN 300
            HLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQN
Sbjct: 241  HLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQN 300

Query: 301  RHYFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRI 360
            RHYFIEINPRIQVEHTITEEITGIDIV                   DRITTRGFAIQCRI
Sbjct: 301  RHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQQLGLLQDRITTRGFAIQCRI 360

Query: 361  TTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEI 420
            TTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEI
Sbjct: 361  TTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEI 420

Query: 421  VRRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQ 480
            VRRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQ
Sbjct: 421  VRRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQ 480

Query: 481  KLLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEK 540
            KLLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEK
Sbjct: 481  KLLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEK 540

Query: 541  GPAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWG 600
            GPAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWG
Sbjct: 541  GPAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWG 600

Query: 601  GATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKE 660
            GATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKE
Sbjct: 601  GATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKE 660

Query: 661  NGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEITDK 720
            NGVDIFRVFDALNDLEQL              EATICYSGDMLQSGKKYNLDYYLEITDK
Sbjct: 661  NGVDIFRVFDALNDLEQLKVGVDAVKKAKGVVEATICYSGDMLQSGKKYNLDYYLEITDK 720

Query: 721  IVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFA 780
            IVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFA
Sbjct: 721  IVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFA 780

Query: 781  GADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEA 840
            GADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEA
Sbjct: 781  GADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEA 840

Query: 841  DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSK 900
            DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSK
Sbjct: 841  DLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSK 900

Query: 901  VVGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKR 960
            VVGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKR
Sbjct: 901  VVGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKR 960

Query: 961  RKLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSV 1020
            RKLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSV
Sbjct: 961  RKLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSV 1020

Query: 1021 LPTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVD 1080
            LPTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVD
Sbjct: 1021 LPTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVD 1080

Query: 1081 KSQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISS 1140
            KSQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISS
Sbjct: 1081 KSQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISS 1140

Query: 1141 PIDGQVKEVLVKDGENV 1157
            PIDGQVKEVLVKDGENV
Sbjct: 1141 PIDGQVKEVLVKDGENV 1157

>KLLA0C05764g complement(512470..515991) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 pyruvate
            carboxylase 2, start by similarity
          Length = 1173

 Score = 2041 bits (5287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 977/1156 (84%), Positives = 1053/1156 (91%), Gaps = 1/1156 (0%)

Query: 2    SKLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKAD 61
            S+LAGLRD+SNL+GEKNK+LVANRGEIPIRIFR+AHELSMKTVAIYSHEDRLSMHRLKAD
Sbjct: 3    SQLAGLRDNSNLMGEKNKLLVANRGEIPIRIFRTAHELSMKTVAIYSHEDRLSMHRLKAD 62

Query: 62   EAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWI 121
            EAY+IG+QGKYTPVGAYLAIDEI+ IAK H V+FIHPGYGFLSENSEFA KV  +GITW+
Sbjct: 63   EAYVIGEQGKYTPVGAYLAIDEIINIAKSHGVNFIHPGYGFLSENSEFAEKVAASGITWV 122

Query: 122  GPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXX 181
            GP A VIDSVGDKVSARNLA KANVPVVPGTPGPI++VEEAQAFV +YG+PVIIKAAF  
Sbjct: 123  GPPAAVIDSVGDKVSARNLAEKANVPVVPGTPGPIETVEEAQAFVDKYGFPVIIKAAFGG 182

Query: 182  XXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVH 241
                       DDI+DAFQRA SEA T+FGNGTCFIERFL+KPKHIEVQLLAD YGNVVH
Sbjct: 183  GGRGMRVVREGDDISDAFQRAKSEAITAFGNGTCFIERFLDKPKHIEVQLLADNYGNVVH 242

Query: 242  LFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNR 301
            LFERDCSVQRRHQKVVEVAPAKTLP++VRDAILTDAVKLA  A Y+NAGTAEFLVD+QNR
Sbjct: 243  LFERDCSVQRRHQKVVEVAPAKTLPEEVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNR 302

Query: 302  HYFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRIT 361
            HYFIEINPRIQVEHTITEEITGIDIV                   D+ITTRGFAIQCRIT
Sbjct: 303  HYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLEQLGLMQDKITTRGFAIQCRIT 362

Query: 362  TEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIV 421
            TEDP+KNFQPDTGRI+VYRSAGGNGVRLDGGNA+AGS+ISPHYDSMLVKCSCSGSTYEIV
Sbjct: 363  TEDPSKNFQPDTGRIDVYRSAGGNGVRLDGGNAFAGSVISPHYDSMLVKCSCSGSTYEIV 422

Query: 422  RRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQK 481
            RRKMLRALIEFRIRGVKTNIPFLLTLLT+PVF  G YWTTFIDDTP+LF+MVSSQNRAQK
Sbjct: 423  RRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFKSGEYWTTFIDDTPQLFEMVSSQNRAQK 482

Query: 482  LLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKG 541
            LLHYLADLAVNGSSIKGQ+GLPKL T PT+P +H+  G+++DV +  PP+GWR VLL+ G
Sbjct: 483  LLHYLADLAVNGSSIKGQIGLPKLTTHPTIPHLHNEDGSLVDV-SAKPPAGWRDVLLDYG 541

Query: 542  PAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGG 601
            P EFAK VR+ NGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHA+SGAFALECWGG
Sbjct: 542  PEEFAKQVRKFNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHAMSGAFALECWGG 601

Query: 602  ATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKEN 661
            ATFDV+MRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+N
Sbjct: 602  ATFDVSMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDN 661

Query: 662  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEITDKI 721
            GVDIFRVFDALNDLEQL              EATICYSGDML  GKKYNLDYYL+IT+KI
Sbjct: 662  GVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLAPGKKYNLDYYLDITEKI 721

Query: 722  VAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAG 781
            V  GTHILGIKDMAGTLKPSAA+LLIGSIRAKYP+LPIHVHTHDSAGT VASMAACA +G
Sbjct: 722  VNSGTHILGIKDMAGTLKPSAARLLIGSIRAKYPELPIHVHTHDSAGTGVASMAACALSG 781

Query: 782  ADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEAD 841
            ADVVDVATNSMSGLTSQPSINALLA+LDGEI+ N+NV  VRELDAYWA+MRLLYSCFEAD
Sbjct: 782  ADVVDVATNSMSGLTSQPSINALLAALDGEIDNNVNVGYVRELDAYWAEMRLLYSCFEAD 841

Query: 842  LKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKV 901
            LKGPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW+ETKRAYREAN LLGDLVKVTPTSKV
Sbjct: 842  LKGPDPEVYVHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYREANLLLGDLVKVTPTSKV 901

Query: 902  VGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRR 961
            VGDLAQFMVSNKL+SDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLR+DVL+NKRR
Sbjct: 902  VGDLAQFMVSNKLTSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRTDVLRNKRR 961

Query: 962  KLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVL 1021
            KLT RPGLE+APF+L KIKEDL  RF DI+ECDVASYNMYPKVYEDFRKI+E YGDLSVL
Sbjct: 962  KLTQRPGLELAPFELEKIKEDLSTRFSDIDECDVASYNMYPKVYEDFRKIKEKYGDLSVL 1021

Query: 1022 PTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDK 1081
            PTKNFLSPP +GEEIVVTIE+GKTLIIKPQAIG+LNKETG+REVYF+LNGELRKV+V D+
Sbjct: 1022 PTKNFLSPPVIGEEIVVTIEQGKTLIIKPQAIGDLNKETGIREVYFELNGELRKVSVADR 1081

Query: 1082 SQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSP 1141
            SQKV+ +SKPKADAHD +QIG+PMAGV++EVKVH GSL+ +GQPVAVLSAMKMEMVISSP
Sbjct: 1082 SQKVESVSKPKADAHDPFQIGSPMAGVVVEVKVHKGSLIAKGQPVAVLSAMKMEMVISSP 1141

Query: 1142 IDGQVKEVLVKDGENV 1157
             DGQVKEVLVKDGENV
Sbjct: 1142 ADGQVKEVLVKDGENV 1157

>YBR218C (PYC2) [399] chr2 complement(658664..662206) Pyruvate
            carboxylase 2 [3543 bp, 1180 aa]
          Length = 1180

 Score = 2039 bits (5282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 965/1155 (83%), Positives = 1055/1155 (91%)

Query: 3    KLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADE 62
            KLAGLRD+ +LLGEKNKILVANRGEIPIRIFRSAHELSM+T+AIYSHEDRLSMHRLKADE
Sbjct: 6    KLAGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADE 65

Query: 63   AYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIG 122
            AY+IG++G+YTPVGAYLA+DEI+EIAK+H VDFIHPGYGFLSENSEFA KV +AGITWIG
Sbjct: 66   AYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIG 125

Query: 123  PSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXX 182
            P AEVIDSVGDKVSAR+LAA+ANVP VPGTPGPI++V+EA  FV EYGYPVIIKAAF   
Sbjct: 126  PPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGG 185

Query: 183  XXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHL 242
                      DD+ADAFQRATSEA+T+FGNGTCF+ERFL+KPKHIEVQLLAD +GNVVHL
Sbjct: 186  GRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 245

Query: 243  FERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH 302
            FERDCSVQRRHQKVVEVAPAKTLP++VRDAILTDAVKLA V  Y+NAGTAEFLVD+QNRH
Sbjct: 246  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNRH 305

Query: 303  YFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 362
            YFIEINPRIQVEHTITEEITGIDIV                   D+ITTRGF+IQCRITT
Sbjct: 306  YFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITT 365

Query: 363  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVR 422
            EDP+KNFQPDTGR+EVYRSAGGNGVRLDGGNAYAG+ ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 366  EDPSKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVR 425

Query: 423  RKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKL 482
            RKM+RALIEFRIRGVKTNIPFLLTLLTNPVFI+GTYWTTFIDDTP+LF+MVSSQNRAQKL
Sbjct: 426  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 485

Query: 483  LHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGP 542
            LHYLADLAVNGSSIKGQ+GLPKL + P+VP +HDAQGNVI+V  +APPSGWRQVLLEKGP
Sbjct: 486  LHYLADLAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 545

Query: 543  AEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGA 602
            +EFAK VR+ NGTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHAL+GAFALECWGGA
Sbjct: 546  SEFAKQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGAFALECWGGA 605

Query: 603  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662
            TFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 606  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 665

Query: 663  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEITDKIV 722
            VDIFRVFDALNDLEQL              EAT+CYSGDMLQ GKKYNLDYYLE+ +KIV
Sbjct: 666  VDIFRVFDALNDLEQLKVGVNAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVVEKIV 725

Query: 723  AMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGA 782
             MGTHILGIKDMAGT+KP+AAKLLIGS+R +YPDLPIHVH+HDSAGTAVASM ACA AGA
Sbjct: 726  QMGTHILGIKDMAGTMKPAAAKLLIGSLRTRYPDLPIHVHSHDSAGTAVASMTACALAGA 785

Query: 783  DVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADL 842
            DVVDVA NSMSGLTSQPSINALLASL+G I+T INV  VRELDAYWA+MRLLYSCFEADL
Sbjct: 786  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 845

Query: 843  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVV 902
            KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGE+W+ETKRAYREANYLLGD+VKVTPTSKVV
Sbjct: 846  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 905

Query: 903  GDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRK 962
            GDLAQFMVSNKL+SDD+RRLA+SLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVL+NKRRK
Sbjct: 906  GDLAQFMVSNKLTSDDIRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRK 965

Query: 963  LTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022
            LTCRPGLE+ PFDL KI+EDLQ+RFGDI+ECDVASYNMYP+VYEDF+KIRETYGDLSVLP
Sbjct: 966  LTCRPGLELEPFDLEKIREDLQNRFGDIDECDVASYNMYPRVYEDFQKIRETYGDLSVLP 1025

Query: 1023 TKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKS 1082
            TKNFL+P    EEI VTIE+GKTLIIK QA+G+LNK+TG REVYF+LNGELRK+ V DKS
Sbjct: 1026 TKNFLAPAEPDEEIEVTIEQGKTLIIKLQAVGDLNKKTGQREVYFELNGELRKIRVADKS 1085

Query: 1083 QKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPI 1142
            Q +  ++KPKAD HD++QIGAPMAGVIIEVKVH GSLVK+G+ +AVLSAMKMEMV+SSP 
Sbjct: 1086 QNIQSVAKPKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPA 1145

Query: 1143 DGQVKEVLVKDGENV 1157
            DGQVK+V +KDGE+V
Sbjct: 1146 DGQVKDVFIKDGESV 1160

>YGL062W (PYC1) [1917] chr7 (385197..388733) Pyruvate carboxylase 1,
            catalyzes conversion of pyruvate to oxaloacetate in the
            gluconeogenesis pathway [3537 bp, 1178 aa]
          Length = 1178

 Score = 2026 bits (5249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 966/1155 (83%), Positives = 1046/1155 (90%)

Query: 3    KLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADE 62
            K AGLRD+ NLLGEKNKILVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLS H+ KADE
Sbjct: 5    KFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADE 64

Query: 63   AYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIG 122
            AY+IG+ G+YTPVGAYLAIDEI+ IA++H VDFIHPGYGFLSENSEFA KV +AGITWIG
Sbjct: 65   AYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIG 124

Query: 123  PSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXX 182
            P AEVIDSVGDKVSARNLAAKANVP VPGTPGPI++VEEA  FV EYGYPVIIKAAF   
Sbjct: 125  PPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGG 184

Query: 183  XXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHL 242
                      DD+ADAFQRATSEA+T+FGNGTCF+ERFL+KPKHIEVQLLAD +GNVVHL
Sbjct: 185  GRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHL 244

Query: 243  FERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH 302
            FERDCSVQRRHQKVVEVAPAKTLP++VRDAILTDAVKLA    Y+NAGTAEFLVD+QNRH
Sbjct: 245  FERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304

Query: 303  YFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 362
            YFIEINPRIQVEHTITEEITGIDIV                   D+ITTRGFAIQCRITT
Sbjct: 305  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITT 364

Query: 363  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVR 422
            EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAG+IISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 365  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVR 424

Query: 423  RKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKL 482
            RKM+RALIEFRIRGVKTNIPFLLTLLTNPVFI+GTYWTTFIDDTP+LF+MVSSQNRAQKL
Sbjct: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNRAQKL 484

Query: 483  LHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGP 542
            LHYLAD+AVNGSSIKGQ+GLPKL + P+VP +HDAQGNVI+V  +APPSGWRQVLLEKGP
Sbjct: 485  LHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLLEKGP 544

Query: 543  AEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGA 602
            AEFA+ VR+ NGTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHAL+G FALECWGGA
Sbjct: 545  AEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALECWGGA 604

Query: 603  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662
            TFDVAMRFLHEDPWERLR LR LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 605  TFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 664

Query: 663  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEITDKIV 722
            VDIFRVFDALNDLEQL              EAT+C+SGDMLQ GKKYNLDYYLEI +KIV
Sbjct: 665  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIAEKIV 724

Query: 723  AMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGA 782
             MGTHILGIKDMAGT+KP+AAKLLIGS+RAKYPDLPIHVHTHDSAGTAVASM ACA AGA
Sbjct: 725  QMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACALAGA 784

Query: 783  DVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADL 842
            DVVDVA NSMSGLTSQPSINALLASL+G I+T INV  VRELDAYWA+MRLLYSCFEADL
Sbjct: 785  DVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCFEADL 844

Query: 843  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVV 902
            KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGE+W+ETKRAYREANYLLGD+VKVTPTSKVV
Sbjct: 845  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 904

Query: 903  GDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRK 962
            GDLAQFMVSNKL+SDDVRRLA+SLDFPDSVMDFFEGLIGQPYGGFPEP RSDVL+NKRRK
Sbjct: 905  GDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRNKRRK 964

Query: 963  LTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022
            LTCRPGLE+ PFDL KI+EDLQ+RFGD++ECDVASYNMYP+VYEDF+K+RETYGDLSVLP
Sbjct: 965  LTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDLSVLP 1024

Query: 1023 TKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKS 1082
            T++FLSP    EEI V IE+GKTLIIK QA+G+LNK+TG REVYFDLNGE+RK+ V D+S
Sbjct: 1025 TRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRVADRS 1084

Query: 1083 QKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPI 1142
            QKV+ ++K KAD HD   IGAPMAGVI+EVKVH GSL+K+GQPVAVLSAMKMEM+ISSP 
Sbjct: 1085 QKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMIISSPS 1144

Query: 1143 DGQVKEVLVKDGENV 1157
            DGQVKEV V DGENV
Sbjct: 1145 DGQVKEVFVSDGENV 1159

>CAGL0F06941g 679960..683502 highly similar to sp|P11154 Saccharomyces
            cerevisiae YGL062w PYC1 pyruvate carboxylase or sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2, hypothetical start
          Length = 1180

 Score = 2005 bits (5195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 952/1155 (82%), Positives = 1046/1155 (90%)

Query: 3    KLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADE 62
            KLAGLR + N+LGEK+KILVANRGEIPIRIFR+AHELSM+TVAIYSHEDRLS HRLKADE
Sbjct: 9    KLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHELSMRTVAIYSHEDRLSTHRLKADE 68

Query: 63   AYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIG 122
            AY+IG++G+YTPVGAYLAIDEI++IAK+H VDFIHPGYGFLSENSEFA KV++AGITWIG
Sbjct: 69   AYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENSEFADKVQKAGITWIG 128

Query: 123  PSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXX 182
            P  EVI+SVGDKVSARNLAAKA VP VPGTPGPI +VEEA+AFVAEYGYPVIIKAA+   
Sbjct: 129  PPPEVIESVGDKVSARNLAAKAKVPTVPGTPGPIKTVEEAEAFVAEYGYPVIIKAAYGGG 188

Query: 183  XXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHL 242
                      +DI DAFQRATSEAKT+FGNGTCF+ERFL+KPKHIEVQLLAD +GNV+HL
Sbjct: 189  GRGMRVVREGEDIGDAFQRATSEAKTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVIHL 248

Query: 243  FERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH 302
            FERDCSVQRRHQKVVEVAPAKTLP+DVRDAILTDAVKLA  A Y+NAGTAEFLVD+QNRH
Sbjct: 249  FERDCSVQRRHQKVVEVAPAKTLPRDVRDAILTDAVKLAKEAGYRNAGTAEFLVDNQNRH 308

Query: 303  YFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 362
            YFIEINPRIQVEHTITEEITGIDIV                   DRITTRGFAIQCRITT
Sbjct: 309  YFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLTELGLLQDRITTRGFAIQCRITT 368

Query: 363  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVR 422
            EDPAKNFQPDTGRIEVY S GGNGVRLDGGNAYAG++ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 369  EDPAKNFQPDTGRIEVYGSTGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 428

Query: 423  RKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKL 482
            RK++RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LF MVSSQNRAQKL
Sbjct: 429  RKIIRALIEFRIRGVKTNIPFLLTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKL 488

Query: 483  LHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGP 542
            LHYLADLAVNGSSIKGQ+GLPKL T+P +P +HD +G +I V   APP GWRQVLLEKGP
Sbjct: 489  LHYLADLAVNGSSIKGQIGLPKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGP 548

Query: 543  AEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGA 602
              FAKAVR   GTLLMDTTWRDAHQSLLATRVRT+DLAAIAPTTAHAL+GAFALECWGGA
Sbjct: 549  EGFAKAVRAFKGTLLMDTTWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAFALECWGGA 608

Query: 603  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662
            TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 609  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 668

Query: 663  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEITDKIV 722
            VDIFRVFDALNDLEQL              EAT+CYSGDMLQ GKKYNLDYYLE+TDKIV
Sbjct: 669  VDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTDKIV 728

Query: 723  AMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGA 782
             MGTH+LGIKDMAGTLKP+AAKLLIGSIRAKYPDLPIHVH+HDSAGTAVASMAACAFAGA
Sbjct: 729  EMGTHVLGIKDMAGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGA 788

Query: 783  DVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADL 842
            DVVDVA NSMSG+TSQ SINALLASLDGEI+T +NV   RELDAYWA+MRLLYSCFEADL
Sbjct: 789  DVVDVAINSMSGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADL 848

Query: 843  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVV 902
            KGPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW ETKRAY+EAN+LLGD+VKVTPTSKVV
Sbjct: 849  KGPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVV 908

Query: 903  GDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRK 962
            GDLAQFMV+N+L+S+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLRSD+L+NKRRK
Sbjct: 909  GDLAQFMVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRK 968

Query: 963  LTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022
            LT RPGLE+ PFDL  I+EDL++RFG+I+ECDVASYNMYPKVYEDF+K++E YGDLSVLP
Sbjct: 969  LTVRPGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLP 1028

Query: 1023 TKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKS 1082
            TKNFL+PP++GE+I V +E+GKTLIIK QA+G+LNKETG+R+VYF+LNGE+RK+ V D+S
Sbjct: 1029 TKNFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS 1088

Query: 1083 QKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPI 1142
            QKV+ +SKPKAD HD +QIGAPMAGVI+EVKVH GSLVK+GQPVA+LSAMKMEMV+SS  
Sbjct: 1089 QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSSQA 1148

Query: 1143 DGQVKEVLVKDGENV 1157
            DGQVK+V VKD ENV
Sbjct: 1149 DGQVKDVFVKDAENV 1163

>Sklu_1458.1 YGL062W, Contig c1458 155-3553 reverse complement
          Length = 1132

 Score = 2003 bits (5190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 962/1117 (86%), Positives = 1022/1117 (91%), Gaps = 1/1117 (0%)

Query: 41   MKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGY 100
            MKTVAIYS+EDRLSMHRLKADEAYMIG+ GKYTPVGAYLAIDEI+ IAKEH V FIHPGY
Sbjct: 1    MKTVAIYSNEDRLSMHRLKADEAYMIGEGGKYTPVGAYLAIDEIISIAKEHGVSFIHPGY 60

Query: 101  GFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVE 160
            GFLSEN+EFA KV +AGITWIGP  EVI+SVGDKVSAR+LAAKANVP VPGTPGPI+SVE
Sbjct: 61   GFLSENAEFAAKVIDAGITWIGPPPEVINSVGDKVSARDLAAKANVPTVPGTPGPIESVE 120

Query: 161  EAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERF 220
            EA+AFVAEYGYPVIIKAAF             DDI DAFQRATSEAKT+FGNGTCF+ERF
Sbjct: 121  EAEAFVAEYGYPVIIKAAFGGGGRGMRVVREGDDIGDAFQRATSEAKTAFGNGTCFVERF 180

Query: 221  LNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKL 280
            L+KPKHIEVQLLAD YGNV+HLFERDCSVQRRHQKVVEVAPAKTLPK+VRD+ILTDAVKL
Sbjct: 181  LDKPKHIEVQLLADNYGNVIHLFERDCSVQRRHQKVVEVAPAKTLPKEVRDSILTDAVKL 240

Query: 281  ASVANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXX 340
            A  A Y+NAGTAEFLVD QNRHYFIEINPRIQVEHTITEEITG+D+V             
Sbjct: 241  AKEAKYRNAGTAEFLVDAQNRHYFIEINPRIQVEHTITEEITGVDVVAAQIQIAAGASLQ 300

Query: 341  XXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSII 400
                  D+ITTRGFAIQCRITTEDP+KNFQPDTGRIEVYRSAGGNGVRLDGGNAYAG++I
Sbjct: 301  QLGLLQDKITTRGFAIQCRITTEDPSKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGAVI 360

Query: 401  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWT 460
            SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLT+ VF  G YWT
Sbjct: 361  SPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHSVFKSGEYWT 420

Query: 461  TFIDDTPELFKMVSSQNRAQKLLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGN 520
            TFIDDTP+LF+MVSSQNRAQKLLHYLADLAVNGSSIKGQ+GLPKL TQP+VP +HD+ GN
Sbjct: 421  TFIDDTPQLFEMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLTTQPSVPTLHDSNGN 480

Query: 521  VIDVLTTAPPSGWRQVLLEKGPAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLA 580
            V+DVL  APP+GWR VLLE+GP  FAK VR+ NGTLLMDTTWRDAHQSLLATRVRT+DLA
Sbjct: 481  VVDVLA-APPAGWRDVLLEQGPEGFAKQVRKYNGTLLMDTTWRDAHQSLLATRVRTHDLA 539

Query: 581  AIAPTTAHALSGAFALECWGGATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANG 640
             IAPTTAHAL+GAFALECWGGATF VAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANG
Sbjct: 540  TIAPTTAHALAGAFALECWGGATFVVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANG 599

Query: 641  VAYSSLPDNAIDHFVKQAKENGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSG 700
            VAYSSLPDNAIDHFV QAKENGVDIFRVFDALNDLEQL              EAT+CYSG
Sbjct: 600  VAYSSLPDNAIDHFVLQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSG 659

Query: 701  DMLQSGKKYNLDYYLEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIH 760
            DMLQ GKKYNLDYYLEITDKIV MGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIH
Sbjct: 660  DMLQPGKKYNLDYYLEITDKIVKMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIH 719

Query: 761  VHTHDSAGTAVASMAACAFAGADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNM 820
            VHTHDSAGTAVASMAACA AGADVVDVATNSMSGLTSQPSINALLASLDGEI  N++VNM
Sbjct: 720  VHTHDSAGTAVASMAACALAGADVVDVATNSMSGLTSQPSINALLASLDGEINNNVDVNM 779

Query: 821  VRELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKR 880
            VRELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGE+W+ETKR
Sbjct: 780  VRELDAYWAQMRLLYSCFEADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGERWAETKR 839

Query: 881  AYREANYLLGDLVKVTPTSKVVGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLI 940
            AYREANYLLGDLVKVTPTSKVVGDLAQFMV+NKL+SDDVRRLASSLDFPDSVMDFFEGLI
Sbjct: 840  AYREANYLLGDLVKVTPTSKVVGDLAQFMVTNKLNSDDVRRLASSLDFPDSVMDFFEGLI 899

Query: 941  GQPYGGFPEPLRSDVLKNKRRKLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNM 1000
            GQPYGGFPEPLR+DVLKNKRRKLTCRPGLE+ PFDL +IKEDL  RFGDI+ECDVASYNM
Sbjct: 900  GQPYGGFPEPLRTDVLKNKRRKLTCRPGLELPPFDLERIKEDLSSRFGDIDECDVASYNM 959

Query: 1001 YPKVYEDFRKIRETYGDLSVLPTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKET 1060
            YPKVYEDFRKIRE YGDLSVLPTKNFLSPP VGEEIVVTIE+GKTLIIKPQAIG+LNK+T
Sbjct: 960  YPKVYEDFRKIREQYGDLSVLPTKNFLSPPAVGEEIVVTIEQGKTLIIKPQAIGDLNKDT 1019

Query: 1061 GLREVYFDLNGELRKVAVVDKSQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLV 1120
            G+REVYF+LNGELRKV+VVD+SQKV+ ISKPKADAHD YQ+GAPMAGV++EVKVH GSLV
Sbjct: 1020 GIREVYFELNGELRKVSVVDRSQKVETISKPKADAHDPYQVGAPMAGVVVEVKVHKGSLV 1079

Query: 1121 KQGQPVAVLSAMKMEMVISSPIDGQVKEVLVKDGENV 1157
            K+GQPVAVLSAMKMEMVISSP  G VK+VL+KDGENV
Sbjct: 1080 KKGQPVAVLSAMKMEMVISSPAAGLVKDVLIKDGENV 1116

>AAR162C [350] [Homologous to ScYGL062W (PYC1) - SH; ScYBR218C (PYC2)
            - SH] (634067..637582) [3516 bp, 1171 aa]
          Length = 1171

 Score = 1980 bits (5130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1156 (82%), Positives = 1031/1156 (89%), Gaps = 1/1156 (0%)

Query: 2    SKLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKAD 61
            S+LAG R  SNLLGEKNK+LVANRGEIPIRIFR+AHELSM TVA+YS+EDRLSMHR KAD
Sbjct: 3    SQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATVAVYSYEDRLSMHRQKAD 62

Query: 62   EAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWI 121
            EAYMIG++G+YTPVGAYLAIDEIL IA++H+VDFIHPGYGFLSEN+EFA KVE AGITWI
Sbjct: 63   EAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFLSENAEFAAKVEGAGITWI 122

Query: 122  GPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXX 181
            GP A VI++VGDKVSARNLAA A+VP VPGT GPI SVEEA+ FV +YGYPVIIKAAF  
Sbjct: 123  GPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEAEEFVQKYGYPVIIKAAFGG 182

Query: 182  XXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVH 241
                       DDI DAFQRA SEA+T+FGNGTCF+ERFL++PKHIEVQLLAD YGNVVH
Sbjct: 183  GGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFLDQPKHIEVQLLADNYGNVVH 242

Query: 242  LFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNR 301
            LFERDCSVQRRHQKVVEVAPAKTL K+VRDAILTDAVKLA  + Y+NAGTAEFLVD QNR
Sbjct: 243  LFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKLAKASGYRNAGTAEFLVDKQNR 302

Query: 302  HYFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRIT 361
            HYFIEINPRIQVEHTITEEITG+DIV                   DRITTRGFAIQCRIT
Sbjct: 303  HYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASLEQLGLMQDRITTRGFAIQCRIT 362

Query: 362  TEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIV 421
            TEDP+KNFQPDTGR++VYRSAGGNGVRLDGGNA+AG++ISPHYDSMLVKCSCSGSTYEIV
Sbjct: 363  TEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGAVISPHYDSMLVKCSCSGSTYEIV 422

Query: 422  RRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQK 481
            RRKMLRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LF+MV+SQNRAQK
Sbjct: 423  RRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFEMVASQNRAQK 482

Query: 482  LLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKG 541
            LL YL+DLAVNGSSIKGQMG+PKL  QP++P +H+A+G VIDV  + PP+GWRQVLLE G
Sbjct: 483  LLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHNAKGEVIDV-QSQPPAGWRQVLLEHG 541

Query: 542  PAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGG 601
            P  FAK VRE +GTLL DTTWRDAHQSLLATRVRTYDLAAIAPTTAHAL+GAFALECWGG
Sbjct: 542  PEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALAGAFALECWGG 601

Query: 602  ATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKEN 661
            ATFDVAMRFLHEDPWERLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKEN
Sbjct: 602  ATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKEN 661

Query: 662  GVDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEITDKI 721
            GVDIFRVFDALNDLEQL              EATICYSGDMLQ GKKYNLDYYLE+T+KI
Sbjct: 662  GVDIFRVFDALNDLEQLKVGVDAVKKAEGLVEATICYSGDMLQPGKKYNLDYYLELTEKI 721

Query: 722  VAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAG 781
            VAMGTHILGIKDMAGT+KP AAKLLIGSIRAKYPDLPIHVHTHDSAGT VASM  CA +G
Sbjct: 722  VAMGTHILGIKDMAGTMKPGAAKLLIGSIRAKYPDLPIHVHTHDSAGTGVASMVQCAISG 781

Query: 782  ADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEAD 841
            ADVVDVATNSMSGLTSQPSI AL ASL G+I T ++ +   ELDAYWA+MRLLYSCFEAD
Sbjct: 782  ADVVDVATNSMSGLTSQPSITALQASLGGDIATGVDPDHAIELDAYWAEMRLLYSCFEAD 841

Query: 842  LKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKV 901
            LKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGE+W+ETKRAY EAN LLGDLVKVTPTSKV
Sbjct: 842  LKGPDPEVYKHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYAEANQLLGDLVKVTPTSKV 901

Query: 902  VGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRR 961
            VGDLAQFMVSN+L+SDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVL+NKRR
Sbjct: 902  VGDLAQFMVSNRLNSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLRNKRR 961

Query: 962  KLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVL 1021
            KL  RPGLE+APFDL KI+E+L+ RF +I+ECDVASYNMYPKVYEDFRKIRETYGDLSVL
Sbjct: 962  KLKVRPGLELAPFDLDKIREELRSRFDNIDECDVASYNMYPKVYEDFRKIRETYGDLSVL 1021

Query: 1022 PTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDK 1081
            PT NFLSPP +GEEI+VTIE+GK LIIK QAIG+LNKETG REVYF+LNGELRKV+V DK
Sbjct: 1022 PTHNFLSPPKIGEEIIVTIEQGKVLIIKLQAIGDLNKETGKREVYFELNGELRKVSVADK 1081

Query: 1082 SQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSP 1141
            SQK++ +SK KADAHD +Q+GAPMAGVIIEVKVH GS V +GQPVAVLSAMKMEMVISSP
Sbjct: 1082 SQKLETVSKLKADAHDQFQVGAPMAGVIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSP 1141

Query: 1142 IDGQVKEVLVKDGENV 1157
             DGQVK+V V DGE V
Sbjct: 1142 SDGQVKDVFVSDGETV 1157

>Scas_686.17
          Length = 1176

 Score = 1979 bits (5127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 945/1155 (81%), Positives = 1037/1155 (89%), Gaps = 1/1155 (0%)

Query: 3    KLAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADE 62
            KL+GLRD+ +LLGEKNKILVANRGEIPIRIFRSAHELSM+TVAIYSHEDRLS HRLKADE
Sbjct: 5    KLSGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADE 64

Query: 63   AYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIG 122
            +Y+IG++G++TPVGAYLAIDEI+ IAK+H VDFIHPGYGFLSENSEFA KV +AGITWIG
Sbjct: 65   SYVIGEEGQFTPVGAYLAIDEIINIAKKHKVDFIHPGYGFLSENSEFADKVAKAGITWIG 124

Query: 123  PSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXX 182
            P AEVIDSVGDKVSAR LAA+A+VP VPGTPGPI SV+EA+ FVA+YGYPVIIKAAF   
Sbjct: 125  PPAEVIDSVGDKVSARYLAARADVPTVPGTPGPIKSVKEAEDFVAQYGYPVIIKAAFGGG 184

Query: 183  XXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHL 242
                      +DI DAFQRA+SEA T+FG+GTCF+ERFL+ PKHIEVQLL D YGNVVHL
Sbjct: 185  GRGMRVVREGEDINDAFQRASSEALTAFGDGTCFVERFLDHPKHIEVQLLGDNYGNVVHL 244

Query: 243  FERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH 302
            FERDCSVQRRHQKVVEVAPAK +P++VRDAILTDAVKLA    Y+NAGTAEFLVD+QNRH
Sbjct: 245  FERDCSVQRRHQKVVEVAPAKNIPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRH 304

Query: 303  YFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITT 362
            YFIEINPRIQVEHTITEEITGID+V                   DRITTRGFAIQCRITT
Sbjct: 305  YFIEINPRIQVEHTITEEITGIDLVAAQIQIAAGASLAQLGLLQDRITTRGFAIQCRITT 364

Query: 363  EDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVR 422
            EDPAKNFQPDTGR+EVYRSAGGNGVRLDGGNAYAG++ISPHYDSMLVKCSCSGSTYEIVR
Sbjct: 365  EDPAKNFQPDTGRLEVYRSAGGNGVRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVR 424

Query: 423  RKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKL 482
            RKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LFKMVSSQNRAQKL
Sbjct: 425  RKMIRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFKMVSSQNRAQKL 484

Query: 483  LHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGP 542
            LHYLADLAVNGSSIKGQ+GLPKL   P VP +HDA+GNVI+V  T P +GWR+VLLE+GP
Sbjct: 485  LHYLADLAVNGSSIKGQIGLPKLKKNPDVPHLHDAEGNVINV-ATPPTAGWRKVLLEQGP 543

Query: 543  AEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGA 602
            AEFAK VR   GTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHALSGAFALECWGGA
Sbjct: 544  AEFAKQVRNFQGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALSGAFALECWGGA 603

Query: 603  TFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENG 662
            TFDVAMRFLHEDPW RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NG
Sbjct: 604  TFDVAMRFLHEDPWARLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNG 663

Query: 663  VDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEITDKIV 722
            VDIFRVFDALNDL+QL              EAT+CYSGDMLQ GKKYNLDYYLE+T+KIV
Sbjct: 664  VDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTEKIV 723

Query: 723  AMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGA 782
             MGTHILGIKDMAGT+KP+AA+LLIGSIRAKYPDLPIHVHTHDSAGTAV+SM   A +GA
Sbjct: 724  QMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVSSMTVAALSGA 783

Query: 783  DVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADL 842
            DVVDVA NSMSGLTSQPSINALLASLDG+I+T INV  VRELDAYWA+MRLLYSCFEADL
Sbjct: 784  DVVDVAINSMSGLTSQPSINALLASLDGQIDTGINVQNVRELDAYWAEMRLLYSCFEADL 843

Query: 843  KGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVV 902
            KGPD EVYQHEIPGGQLTNLLFQAQQ GLGE+W+ETKRAYREANYLLGD+VKVTPTSKVV
Sbjct: 844  KGPDAEVYQHEIPGGQLTNLLFQAQQQGLGEQWAETKRAYREANYLLGDIVKVTPTSKVV 903

Query: 903  GDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRK 962
            GDLAQFMV+NK +SDD++RLA++LDFPDS+MDFFEGLIGQPYGGFPEPLRSD+L+NKRRK
Sbjct: 904  GDLAQFMVTNKFNSDDIKRLANTLDFPDSIMDFFEGLIGQPYGGFPEPLRSDILRNKRRK 963

Query: 963  LTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLP 1022
            LT RPGLE+APF++  I+EDL+ RFGDI+ECD+ASYNMYPKVYEDF+KI+E YGDLSVLP
Sbjct: 964  LTTRPGLELAPFNMQDIREDLETRFGDIDECDIASYNMYPKVYEDFQKIKEKYGDLSVLP 1023

Query: 1023 TKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKS 1082
            TK+FLSP  V EEI VTIE+GKTLI+K QAIG+LNK TG+REVYFDLNGELRK+ VVD+S
Sbjct: 1024 TKSFLSPLDVDEEIEVTIEQGKTLIVKLQAIGDLNKATGVREVYFDLNGELRKIRVVDRS 1083

Query: 1083 QKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPI 1142
            QKV+ I+KPKADAHD YQIGAPMAGV++EVKVH GSLVK+G+ VAVLSAMKMEMVISSP 
Sbjct: 1084 QKVETIAKPKADAHDPYQIGAPMAGVVVEVKVHKGSLVKKGEAVAVLSAMKMEMVISSPA 1143

Query: 1143 DGQVKEVLVKDGENV 1157
            DGQVKEVLV +G  V
Sbjct: 1144 DGQVKEVLVSNGNAV 1158

>CAGL0K06787g complement(659290..662817) highly similar to sp|P32327
            Saccharomyces cerevisiae YBR218c PYC2 Pyruvate
            carboxylase 2, start by similarity
          Length = 1175

 Score = 1959 bits (5075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 938/1154 (81%), Positives = 1029/1154 (89%), Gaps = 1/1154 (0%)

Query: 4    LAGLRDSSNLLGEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEA 63
            L GLRD+ +LLGEKNKILVANRGEIPIRIFRSAHELSM+TVAIYSHEDRLS HRLKADEA
Sbjct: 7    LTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMRTVAIYSHEDRLSTHRLKADEA 66

Query: 64   YMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGP 123
            Y+IGK+G+YTPVGAYLAIDEI++IAK+H VDFIHPGYGFLSEN+EFA KV++AGITWIGP
Sbjct: 67   YVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFADKVQKAGITWIGP 126

Query: 124  SAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXX 183
              EVI+SVGDKVSARNLAAKANVP VPGTPGPI++VEEAQ FV +YGYPVIIKAA+    
Sbjct: 127  PPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVEEAQDFVNKYGYPVIIKAAYGGGG 186

Query: 184  XXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLF 243
                     DD+ADAFQRA SEA T+FGNGTCF+ERFL+KPKHIEVQLLAD +GNVVHLF
Sbjct: 187  RGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLF 246

Query: 244  ERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRHY 303
            ERDCSVQRRHQKVVEVAPAKTLP++VRD+ILTDAV+LA  A Y+NAGTAEFLVD+QNRHY
Sbjct: 247  ERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAVRLAKEAGYRNAGTAEFLVDNQNRHY 306

Query: 304  FIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTE 363
            FIEINPRIQVEHTITEEITGID+V                   DRITTRGFAIQCRITTE
Sbjct: 307  FIEINPRIQVEHTITEEITGIDLVSAQIQIAAGASLPQLGLLQDRITTRGFAIQCRITTE 366

Query: 364  DPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRR 423
            DPAKNFQPDTGR+EVYRSAGGNGVRLDGG AYAG++ISPHYDSMLVKCSCSGSTYEIVRR
Sbjct: 367  DPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRR 426

Query: 424  KMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQKLL 483
            KMLRALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LF MVSS+NRAQKLL
Sbjct: 427  KMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQKLL 486

Query: 484  HYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLLEKGPA 543
            HYLADLAVNGSSIKGQ+G PKL T P +P +HD  G+ +DV +  P  GWR +L  +GP 
Sbjct: 487  HYLADLAVNGSSIKGQIGEPKLKTHPQIPRLHDEDGSPVDV-SVPPQKGWRYLLQSEGPE 545

Query: 544  EFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGAT 603
             FAKAVR N GTL+MDTTWRDAHQSLLATRVRTYDLAAIA TTAHA +GAFALECWGGAT
Sbjct: 546  AFAKAVRHNQGTLVMDTTWRDAHQSLLATRVRTYDLAAIAQTTAHAFAGAFALECWGGAT 605

Query: 604  FDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKENGV 663
            FDVAMRFLHEDPWERLR+LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAK+NGV
Sbjct: 606  FDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGV 665

Query: 664  DIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEITDKIVA 723
            DIFRVFDALNDLEQL              EAT+CYSGDMLQ GKKYNLDYYL++T+KIVA
Sbjct: 666  DIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLDVTEKIVA 725

Query: 724  MGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGAD 783
            MGTHILGIKDMAGT+KP+AAKLLIG+IRAK+PDLPIHVH+HDSAGTAVASMAACA AGAD
Sbjct: 726  MGTHILGIKDMAGTMKPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAGAD 785

Query: 784  VVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCFEADLK 843
            VVDVA NSMSGLTSQ S+NA+LASLDG+I+T INV  V ELDAYWA+MRLLYSCFEADLK
Sbjct: 786  VVDVAINSMSGLTSQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEADLK 845

Query: 844  GPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPTSKVVG 903
            GPDPEVY HEIPGGQLTNLLFQAQQLGLGEKW ETK+AY++AN LLGD+VKVTPTSKVVG
Sbjct: 846  GPDPEVYDHEIPGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKVVG 905

Query: 904  DLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRKL 963
            DLAQFMVSN+L+ DD+RRLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLR+D+LKNKRRKL
Sbjct: 906  DLAQFMVSNQLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKNKRRKL 965

Query: 964  TCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDLSVLPT 1023
              RPGLE+APFDLAKI+EDL+ RFGDI ECDVASYNMYPKVYEDF+KI E YGDLSVLPT
Sbjct: 966  NRRPGLELAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVLPT 1025

Query: 1024 KNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAVVDKSQ 1083
            +NFL+ P VGEEI V IE+GKTLIIK QA+G+LN+ETG+REVYF+LNGE RK+ + DKSQ
Sbjct: 1026 RNFLAKPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADKSQ 1085

Query: 1084 KVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPID 1143
             V  I+KPKAD HD  QIGAPMAGVI+EVKVH GS VK+GQPVAVLSAMKMEMVISS  +
Sbjct: 1086 VVQTIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGE 1145

Query: 1144 GQVKEVLVKDGENV 1157
            G VK+VLVKDGENV
Sbjct: 1146 GLVKDVLVKDGENV 1159

>Scas_563.12
          Length = 1216

 Score = 1952 bits (5056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 934/1159 (80%), Positives = 1030/1159 (88%), Gaps = 4/1159 (0%)

Query: 3    KLAGLRDSSNLLGEKNK----ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRL 58
            KL G RD+ NLLG +N+    I+V +    P+  FRSAHELSM+TVAIYSHEDRLS HRL
Sbjct: 42   KLNGPRDNFNLLGTRNRFLSPIVVKSPSYPPVCNFRSAHELSMQTVAIYSHEDRLSTHRL 101

Query: 59   KADEAYMIGKQGKYTPVGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGI 118
            KADE+Y+IG+  ++TPVGAYLAIDEI+ IAK H VD+IHPGYGFLSENSEFA KV +AGI
Sbjct: 102  KADESYVIGEPHQFTPVGAYLAIDEIINIAKRHGVDYIHPGYGFLSENSEFADKVAKAGI 161

Query: 119  TWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAA 178
            TWIGP A VIDSVGDKVSARNLA KANVP VPGTPGPI +V++AQ FV EYGYPVIIKAA
Sbjct: 162  TWIGPPASVIDSVGDKVSARNLATKANVPTVPGTPGPIRTVQDAQDFVNEYGYPVIIKAA 221

Query: 179  FXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGN 238
            F             DD+ADAFQRA+SEA T+FG+GTCF+ERFLNKPKHIEVQLLAD +GN
Sbjct: 222  FGGGGRGMRVVNEGDDLADAFQRASSEALTAFGDGTCFVERFLNKPKHIEVQLLADTHGN 281

Query: 239  VVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD 298
            V+HLFERDCSVQRRHQKVVEVAPAKTLP++VRDAILTDAVKLA    Y+NAGTAEFLVDD
Sbjct: 282  VIHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYQNAGTAEFLVDD 341

Query: 299  QNRHYFIEINPRIQVEHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQC 358
            QNRHYFIEINPRIQVEHTITEEITGIDIV                   D+ITTRGFAIQC
Sbjct: 342  QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLEQLGLLQDKITTRGFAIQC 401

Query: 359  RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTY 418
            RITTEDPAKNFQPDTGR+EVY SAGGNGVRLDGGNAYAG+IISPHYDSMLVKCSCSGSTY
Sbjct: 402  RITTEDPAKNFQPDTGRLEVYDSAGGNGVRLDGGNAYAGAIISPHYDSMLVKCSCSGSTY 461

Query: 419  EIVRRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNR 478
            E+VRRKM+RALIEFRIRGVKTNIPFLLTLLT+PVFI G YWTTFIDDTP+LFKMVSSQNR
Sbjct: 462  EVVRRKMIRALIEFRIRGVKTNIPFLLTLLTHPVFIAGDYWTTFIDDTPQLFKMVSSQNR 521

Query: 479  AQKLLHYLADLAVNGSSIKGQMGLPKLHTQPTVPPIHDAQGNVIDVLTTAPPSGWRQVLL 538
            AQKLLHYLADLAVNGSSIKGQ+G+P+L   P +P IHDAQGNVIDV    PP+GWRQVLL
Sbjct: 522  AQKLLHYLADLAVNGSSIKGQVGIPQLKKVPDIPHIHDAQGNVIDVTNVPPPAGWRQVLL 581

Query: 539  EKGPAEFAKAVRENNGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALEC 598
            E+GP EFAK VR+  GTLLMDTTWRDAHQSLLATRVRT+DLA IAPTTAHAL+ AFALEC
Sbjct: 582  EQGPEEFAKQVRQFQGTLLMDTTWRDAHQSLLATRVRTHDLAKIAPTTAHALASAFALEC 641

Query: 599  WGGATFDVAMRFLHEDPWERLRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 658
            WGGATFDVAMRFLHEDPW+RLR LRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA
Sbjct: 642  WGGATFDVAMRFLHEDPWKRLRTLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA 701

Query: 659  KENGVDIFRVFDALNDLEQLXXXXXXXXXXXXXXEATICYSGDMLQSGKKYNLDYYLEIT 718
            K+NGVDIFRVFDALNDL+QL              EAT+CYSGDMLQ GKKYNLDYYLE+T
Sbjct: 702  KDNGVDIFRVFDALNDLDQLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVT 761

Query: 719  DKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACA 778
            +KIV MGTHILGIKDMAGT+KP+AA+LLIGSIRAKYPDLPIHVHTHDSAGTAVASM+A A
Sbjct: 762  EKIVQMGTHILGIKDMAGTMKPAAARLLIGSIRAKYPDLPIHVHTHDSAGTAVASMSAAA 821

Query: 779  FAGADVVDVATNSMSGLTSQPSINALLASLDGEIETNINVNMVRELDAYWAQMRLLYSCF 838
            +AGADV+DVATNSMSGLTSQPSINALLASLDGEI T+INV  VRELDAYWA+MRLLYSCF
Sbjct: 822  YAGADVIDVATNSMSGLTSQPSINALLASLDGEINTSINVQHVRELDAYWAEMRLLYSCF 881

Query: 839  EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEKWSETKRAYREANYLLGDLVKVTPT 898
             ADLKGPDPEVY+HEIPGGQLTNLLFQAQQLGLGE+W+ETKRAY+EAN LLGD+VKVTPT
Sbjct: 882  GADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYKEANMLLGDIVKVTPT 941

Query: 899  SKVVGDLAQFMVSNKLSSDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKN 958
            SKVVGDLAQFMVSNKL+S+DV+RLA+SLDFPDSVMDFFEGL+GQPYGGFPEPLRSD+L+N
Sbjct: 942  SKVVGDLAQFMVSNKLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRN 1001

Query: 959  KRRKLTCRPGLEMAPFDLAKIKEDLQDRFGDIEECDVASYNMYPKVYEDFRKIRETYGDL 1018
            KRRKLTCRPGLE+ PF+L  IKEDLQ RFGDI ECD+ASYNMYPKVYEDF+K++E YGDL
Sbjct: 1002 KRRKLTCRPGLELVPFELNNIKEDLQTRFGDINECDIASYNMYPKVYEDFQKMKEKYGDL 1061

Query: 1019 SVLPTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVAV 1078
            SVLPTK+FL+P  +GEEI+VTI++GKTLIIK QAIG+LNKETG REV+F+LNGE+RK++V
Sbjct: 1062 SVLPTKSFLAPAEIGEEILVTIQQGKTLIIKLQAIGDLNKETGKREVFFELNGEMRKISV 1121

Query: 1079 VDKSQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVI 1138
             DKSQKV+ ++KPKAD HD +QIGAPMAGVI+EVKVH GSLVK+G+ VAVLSAMKMEMVI
Sbjct: 1122 TDKSQKVETVAKPKADTHDPFQIGAPMAGVIVEVKVHKGSLVKKGEAVAVLSAMKMEMVI 1181

Query: 1139 SSPIDGQVKEVLVKDGENV 1157
            SSP DG VKEVLV + ENV
Sbjct: 1182 SSPADGLVKEVLVNESENV 1200

>CAGL0M05533g complement(588667..594171) similar to sp|P32528
            Saccharomyces cerevisiae YBR208c DUR1 urea amidolyase,
            hypothetical start
          Length = 1834

 Score =  300 bits (767), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 168/451 (37%), Positives = 257/451 (56%), Gaps = 11/451 (2%)

Query: 15   GEKNKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTP 74
            G    +LVANRGEI +RI ++   + +K++AIYS  D+ S H L  D A  +     +T 
Sbjct: 628  GHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDG---HTV 684

Query: 75   VGAYLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDK 134
               YL +++I+ IAK+++VD I PGYGFLSEN+ FA + E+ GI +IGP  E I  +G K
Sbjct: 685  EETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLK 744

Query: 135  VSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDD 194
             SAR +A  A VP+VPG+P  + + +EA       GYPV++K+                D
Sbjct: 745  HSAREVAKSAGVPLVPGSP-LVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQD 803

Query: 195  IADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQ 254
            +  AF+    +  + FG+   F+E+F++  +H+EVQ++ DG G  + L ERDCS+QRR+Q
Sbjct: 804  MRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQ 863

Query: 255  KVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQ-NRHYFIEINPRIQV 313
            KV+E  PA  LP++ R  +LT A +L +  NY+ AGT EF+ D+Q ++ YF+E+N R+QV
Sbjct: 864  KVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQV 923

Query: 314  EHTITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDT 373
            EH ITE +TG+D+V                     I+  G +I+ R+  E+P K+F+P  
Sbjct: 924  EHPITEMVTGLDLVEWMIKISAGVMPSLDEF---NISQNGASIEVRVYAENPLKDFRPSP 980

Query: 374  GRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFR 433
            G  E+      N  R+D      G+ ISP +D  L K    G        KM +AL E +
Sbjct: 981  G--ELVDVQFPNDCRVDTW-VKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETK 1037

Query: 434  IRGVKTNIPFLLTLLTNPVFIDGTYWTTFID 464
            I G  TN+ +L +L+++ +F +    T +++
Sbjct: 1038 IYGCVTNVDYLKSLISSEMFRNAQLSTNYLN 1068

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 1097 DSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPIDGQVKEVLVKDGEN 1156
            D   I +  AG   +  V  G+ +++ Q VAV+ AMK EM++SS + G++K+ L K+G+ 
Sbjct: 1762 DCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSSSVVGKLKKFLFKNGDM 1821

Query: 1157 V 1157
            V
Sbjct: 1822 V 1822

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score =  293 bits (751), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 167/448 (37%), Positives = 255/448 (56%), Gaps = 11/448 (2%)

Query: 18   NKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGA 77
            + +L+ANRGEI +RI ++  +L +++VA+YS  D+ S H   AD +  +      T    
Sbjct: 634  DTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGT---TAAQT 690

Query: 78   YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSA 137
            YL +++I++ AK+ N   I PGYGFLSEN++F+     AGIT++GPS ++I  +G K SA
Sbjct: 691  YLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSA 750

Query: 138  RNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIAD 197
            R +A KA VP+VPG+   I SVEEA+   AE  YPV++K+               +DI  
Sbjct: 751  RQIAQKAGVPLVPGSL-LITSVEEAKKVAAELEYPVMVKSTAGGGGIGLQKVDSEEDIEH 809

Query: 198  AFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVV 257
             F+    + +T FG+   F+ERF+   +H+EVQL+ DG+G  + L ERDCS+QRR+QKV+
Sbjct: 810  IFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVI 869

Query: 258  EVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD-QNRHYFIEINPRIQVEHT 316
            E  PA  LP+  R A+   A  L S+ NYK AGT EF+ D+ ++  YF+E+N R+QVEH 
Sbjct: 870  EETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHP 929

Query: 317  ITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRI 376
            ITE +TG+D+V                    ++   G +++ R+  E+P KNF+P  G +
Sbjct: 930  ITEMVTGLDLVEWMIRIAANDAPDFDST---KVEVNGVSMEARLYAENPLKNFRPSPGLL 986

Query: 377  EVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRG 436
               +    +  R+D      G+ ISP YD  L K    G   +    K+ +AL E ++ G
Sbjct: 987  VDVKFP--DWARVDTW-VKKGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYG 1043

Query: 437  VKTNIPFLLTLLTNPVFIDGTYWTTFID 464
              TNI +L +++T+  F      T  ++
Sbjct: 1044 CITNIDYLKSIITSDFFAKAKVSTNILN 1071

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%)

Query: 1117 GSLVKQGQPVAVLSAMKMEMVISSPIDGQVKEVLVKDGENV 1157
            G +++ GQ + ++ AMK EM+IS+P  G++ ++   +G+ V
Sbjct: 1782 GDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGDMV 1822

>Scas_721.40
          Length = 1834

 Score =  287 bits (734), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 161/449 (35%), Positives = 256/449 (57%), Gaps = 17/449 (3%)

Query: 20   ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYL 79
            +LVANRGEI +RI ++  ++ +++VAI+S  DR S H + AD    +  +G  +    YL
Sbjct: 630  VLVANRGEIAVRIIKTLKKMEIQSVAIFSTPDRYSQHVIDAD--LTVDLKG-VSAADTYL 686

Query: 80   AIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139
             I++I++ AK+     I PGYGFLSEN++F+ + +  GIT++GPS +V+  +G K SAR 
Sbjct: 687  NIEKIIDAAKKTGAQAIIPGYGFLSENADFSERCDAEGITFVGPSGDVMRGLGLKHSARE 746

Query: 140  LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAF 199
            +A KANVP+VPG+   I +  EA+   A+  YP+++K+               DDI   F
Sbjct: 747  IAKKANVPLVPGS-SLITTAHEAKEIAAKLEYPIMVKSTAGGGGIGLQKVESEDDIERIF 805

Query: 200  QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEV 259
            +    +    FG+   F+ERF+   +H+EVQ++ DG GN + + ERDCS+QRR+QK++E 
Sbjct: 806  ETVKHQGAAYFGDSGVFMERFIENARHVEVQIMGDGLGNALAIGERDCSLQRRNQKIIEE 865

Query: 260  APAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD-QNRHYFIEINPRIQVEHTIT 318
             PA  LP+  R  +   A +L S+  YK AGT EF+ D+ ++  YF+E+N R+QVEH IT
Sbjct: 866  TPAPNLPETTRQKLREAAQRLGSLLKYKCAGTVEFIYDEIRDEFYFLEVNTRLQVEHPIT 925

Query: 319  EEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGR--- 375
            E +TGID+V                    +I   G A++ R+  E+P  +F+P  G+   
Sbjct: 926  EMVTGIDLVEWMLVIAADMAPDFNQL---KIDVNGVAMEARLYAENPVHDFKPSPGQLVE 982

Query: 376  IEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIR 435
            +E  + A     R+D   +  G+I++P YD  L K    G        K+ +AL+E ++ 
Sbjct: 983  VEFPKWA-----RIDTWVS-KGTIVTPEYDPTLAKIIVHGKDRHDALEKLNKALVETKVS 1036

Query: 436  GVKTNIPFLLTLLTNPVFIDGTYWTTFID 464
            G  TNI +L ++ ++ +F D    T  ++
Sbjct: 1037 GCITNIDYLRSISSSEMFRDAKVSTNILN 1065

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 1070 NGELRKVAVVDKSQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVL 1129
            N EL +   ++K Q  D          +S  I +  +G   +  V  G  VK GQ + ++
Sbjct: 1740 NAELDENDEIEKDQVNDY-------PENSVMIYSEYSGRFWKPLVTEGEFVKSGQGLIII 1792

Query: 1130 SAMKMEMVISSPIDGQVKEVLVKDGENV 1157
             AMK EM++ +  DG+V +++ K+G  V
Sbjct: 1793 EAMKTEMLVPTLHDGKVLKIVHKNGSMV 1820

>Sklu_2124.1 YBR208C, Contig c2124 43-5535 reverse complement
          Length = 1830

 Score =  281 bits (720), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 162/446 (36%), Positives = 246/446 (55%), Gaps = 11/446 (2%)

Query: 20   ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYL 79
            +L+ANRGEI +RI ++  +L++++VA+YS  D+ S H + AD    +  +   T    YL
Sbjct: 629  VLIANRGEIAVRIIKTLKKLNIRSVAVYSDPDKYSQHVIDADLGVALNGR---TAAETYL 685

Query: 80   AIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139
             ID+I++ AK+ N   I PGYGFLSEN+EFA K  E GI ++GPS E I  +G K SAR 
Sbjct: 686  DIDKIIKAAKDTNAQAIIPGYGFLSENAEFADKCVEEGIVFVGPSGEAIRKLGLKHSARE 745

Query: 140  LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAF 199
            +A KA VP+VPG+ G + S +EA+    +  YPV++K+               ++I   F
Sbjct: 746  IAEKAGVPLVPGS-GLVTSAKEAKEIANKLEYPVMVKSTAGGGGIGLQKVDSENEIERVF 804

Query: 200  QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEV 259
            +    + K  FG+   F+ERF+   +H+E+Q++ DGYG  + + ERDCS+QRR+QK++E 
Sbjct: 805  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGYGKAIAIGERDCSLQRRNQKIIEE 864

Query: 260  APAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD-QNRHYFIEINPRIQVEHTIT 318
             PA  L +  R  +   A  L S+  YK AGT EF+ D+ ++  YF+E+N R+QVEH IT
Sbjct: 865  TPAPNLGETTRTKMRQAAESLGSLLKYKCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 924

Query: 319  EEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRIEV 378
            E +TG+D+V                     I   G +I+ R+  E+PAK+F+P  G +  
Sbjct: 925  EMVTGLDLVEWMLRIAADDAPDFESA---NIVVTGASIEARLYAENPAKDFRPSPGLLTD 981

Query: 379  YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 438
                     R+D   +  G+ +S  YD  L K    G        KM +AL E  + G  
Sbjct: 982  VHFP--EWARVDTWVS-KGTTVSAEYDPTLAKIIVHGKDRNDAIMKMNKALNETVVYGCI 1038

Query: 439  TNIPFLLTLLTNPVFIDGTYWTTFID 464
            TNI +L ++ ++ +F      T  +D
Sbjct: 1039 TNIDYLRSIASSEMFKTAKVATKILD 1064

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 34/62 (54%)

Query: 1096 HDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPIDGQVKEVLVKDGE 1155
             D+  + +  +G   +  V  G  V +G  + ++ AMK EMV+ +   G+V +++ K+G+
Sbjct: 1759 EDAEMVYSEYSGRFWKPMVSAGDTVTKGDGLVIVEAMKTEMVVPAKKSGKVLKIVHKNGD 1818

Query: 1156 NV 1157
             V
Sbjct: 1819 MV 1820

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score =  278 bits (712), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 157/446 (35%), Positives = 248/446 (55%), Gaps = 11/446 (2%)

Query: 20   ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYL 79
            +L+ANRGEI +RI ++   + +K+VA+YS  D+ S H   AD  + +   G+ T    YL
Sbjct: 627  VLIANRGEIAVRIMKTLKRMGIKSVAVYSDPDKYSQHVTDAD--FSVALHGR-TAAETYL 683

Query: 80   AIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139
             ID+I+  AK+     I PGYGFLSEN++F+ +  +  I ++GPS + I  +G K SAR 
Sbjct: 684  DIDKIINAAKKTGAQAIIPGYGFLSENADFSDRCSQENIVFVGPSGDAIRKLGLKHSARE 743

Query: 140  LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAF 199
            +A +A VP+VPG+ G I   +EA+    +  YPV++K+               DDI   F
Sbjct: 744  IAERAKVPLVPGS-GLIKDAKEAKEVAKKLEYPVMVKSTAGGGGIGLQKVDSEDDIERVF 802

Query: 200  QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEV 259
            +    + K+ FG+   F+ERF+N  +H+E+Q++ DG+G  + + ERDCS+QRR+QKV+E 
Sbjct: 803  ETVQHQGKSYFGDAGVFMERFVNNARHVEIQMMGDGFGKAIAIGERDCSLQRRNQKVIEE 862

Query: 260  APAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQ-NRHYFIEINPRIQVEHTIT 318
             PA  LP+  R  +   + +L S+  YK AGT EF+ D+Q +  YF+E+N R+QVEH IT
Sbjct: 863  TPAPNLPEATRAKMRAASERLGSLLKYKCAGTVEFIYDEQRDEFYFLEVNARLQVEHPIT 922

Query: 319  EEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRIEV 378
            E +TG+D+V                    +I   G +I+ R+  E+P K+F+P  G++  
Sbjct: 923  EMVTGLDLVEWMLRIAANDSPDFDNT---KIEVSGASIEARLYAENPVKDFRPSPGQLT- 978

Query: 379  YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 438
               +  +  R+D      G+ +S  YD  L K    G        K+ +AL E  + G  
Sbjct: 979  -SVSFPSWARVDTW-VKKGTNVSAEYDPTLAKIIVHGKDRNDAIMKLNQALNETAVYGCI 1036

Query: 439  TNIPFLLTLLTNPVFIDGTYWTTFID 464
            TNI +L ++ ++ +F +    T  +D
Sbjct: 1037 TNIDYLRSIASSKMFKEAKVATKVLD 1062

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 11/90 (12%)

Query: 1070 NGELRKVAVVDKSQKVDLISKPKADAHDSY--QIGAPMAGVIIEVKVHTGSLVKQGQPVA 1127
            N EL+K    DK Q V+         +  Y  +   P+A V        G  V+ G  V 
Sbjct: 1739 NAELKKSGD-DKPQDVEEYPDDAELLYSEYTGRFWKPVAAV--------GDHVEAGDGVI 1789

Query: 1128 VLSAMKMEMVISSPIDGQVKEVLVKDGENV 1157
            ++ AMK EMV+ +   G+V ++L K+G+ V
Sbjct: 1790 IIEAMKTEMVVGATKSGKVYKILHKNGDMV 1819

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score =  274 bits (700), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 166/461 (36%), Positives = 246/461 (53%), Gaps = 19/461 (4%)

Query: 18   NKILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGA 77
            + +LVANRGEI +RI R+   L +++VA+YS  DR S H   AD A  +G     +    
Sbjct: 623  DTVLVANRGEIAVRIIRTLKRLGIRSVAVYSDPDRHSQHVRDADVAVALGGS---SAAET 679

Query: 78   YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSA 137
            YL ID+IL  AK+ +   I PGYGFLSEN+ FA +    GI ++GPS + I  +G K  A
Sbjct: 680  YLDIDKILAAAKKTDTQAIIPGYGFLSENATFAERCGAEGIVFVGPSGDSIRKLGLKHWA 739

Query: 138  RNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIAD 197
            R LAA A VP+  GT G + S   A     E GYP+++K+                ++A 
Sbjct: 740  RELAASAGVPLTKGT-GLLQSASAALEAGEEIGYPLMVKSTAGGGGIGLQRVDSAAELAA 798

Query: 198  AFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVV 257
            AF++   + +  F +   F+E F+ + +H+EVQ++ DG+G  V L ERDCS+QRR+QK++
Sbjct: 799  AFEQVQRQGELYFTDSGVFLESFIARARHVEVQIMGDGHGRTVALGERDCSLQRRNQKII 858

Query: 258  EVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQ-NRHYFIEINPRIQVEHT 316
            E  PA  LP   R  +   A +L S   YK AGT EF+ D+Q +  YF+E+N R+QVEH 
Sbjct: 859  EETPAPNLPAHTRQKMRQAAQRLCSAVKYKCAGTVEFMYDEQKDEFYFLEVNTRLQVEHP 918

Query: 317  ITEEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRI 376
            ITE +TG+D+V                     +   G +++ R+  E+P K F P  G +
Sbjct: 919  ITEMVTGLDLVEWMLRIAANTPPDFDAG----VEIEGVSMEARVYVENPVKGFTPSPGLL 974

Query: 377  E--VYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRI 434
               V+ S      R+D      G+ ++  YD  L K    G   E    K+L AL E RI
Sbjct: 975  TEVVFPSWA----RVDTW-ILKGTRVAAEYDPTLAKIIVHGKDREDAVSKLLLALSETRI 1029

Query: 435  RGVKTNIPFLLTLLTNPVFIDGTYWTTFIDD---TPELFKM 472
             G  TN+ +L ++ ++  F   + +T  ++D   TP  F++
Sbjct: 1030 AGCMTNLDYLKSIASSEEFRKASVFTRLLNDFEYTPTAFEV 1070

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 50/99 (50%), Gaps = 3/99 (3%)

Query: 1059 ETGLREVYFDLNGELRKVAVVDKSQKVDLISKPKADAHDSYQIGAPMAGVIIEVKVHTGS 1118
            ++G R   F     L KVA  D    V   ++P     D++ + +  AG   +  V  G 
Sbjct: 1712 QSGERAAEF---ARLIKVANSDLETAVRKEAEPVEYPEDAHMVYSEYAGRFWKQVVSVGD 1768

Query: 1119 LVKQGQPVAVLSAMKMEMVISSPIDGQVKEVLVKDGENV 1157
             VK+G  + ++ AMK EMV+S+  DG+V  +L  +G+ V
Sbjct: 1769 KVKEGDKLVIIEAMKTEMVVSATADGEVINILHANGDMV 1807

>Kwal_27.11951
          Length = 1869

 Score =  264 bits (674), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 162/459 (35%), Positives = 253/459 (55%), Gaps = 14/459 (3%)

Query: 20   ILVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYL 79
            +LVANRGEI +RI ++  +L +K+VA+YS  D+ S H   AD A  +  +G+ T    YL
Sbjct: 668  VLVANRGEIAVRIIKTLKKLKIKSVAVYSDPDKYSQHVTDADVA--VALKGR-TAAETYL 724

Query: 80   AIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139
             ID+I+  AKE   + I PGYGFLSEN++F+ +    GI ++GP+ + I  +G K SAR 
Sbjct: 725  DIDKIIAAAKETGTEAIIPGYGFLSENADFSDRCASEGIVFVGPAGDAIRKLGLKHSARE 784

Query: 140  LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAF 199
            +A KA VP+VPG+ G + + +EA+       YPV++K+               +DI   F
Sbjct: 785  IAEKAGVPLVPGS-GLVKTPQEAREIAKALEYPVMVKSTAGGGGIGLQKVDSEEDIERVF 843

Query: 200  QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEV 259
            +    + K  FG+   F+ERF+   +H+E+Q++ DG G  + + ERDCS+QRR+QKV+E 
Sbjct: 844  ETVQHQGKAYFGDSGVFLERFVENARHVEIQMMGDGKGKAIAIGERDCSLQRRNQKVIEE 903

Query: 260  APAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDD-QNRHYFIEINPRIQVEHTIT 318
             PA  L +  R  +   +  L S+  Y+ AGT EF+ D+ ++  YF+E+N R+QVEH IT
Sbjct: 904  TPAPNLSEKTRARMREASENLGSLLKYRCAGTVEFIYDERRDEFYFLEVNARLQVEHPIT 963

Query: 319  EEITGIDIVXXXXXXXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRIEV 378
            E +TG+D+V                    +IT  G +I+ R+  E+P K+F+P  G++  
Sbjct: 964  EMVTGLDLVEWMLLIAAGTPPDFDAT---KITVTGASIEARLYAENPVKDFRPSPGQLT- 1019

Query: 379  YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVK 438
               +     R+D   +  G+ IS  YD  L K    G   +   +K+ +AL E  I G  
Sbjct: 1020 -DVSFPEWARVDTWVS-KGTTISAEYDPTLAKIIVHGKDRDEAIQKLNQALNETSIYGCI 1077

Query: 439  TNIPFLLTLLTNPVFIDGTYWTTFIDD---TPELFKMVS 474
            TNI +L ++ ++ +F      T  +D     P  F++ S
Sbjct: 1078 TNIDYLRSIASSEMFKTAKVATKVLDSYDYRPSAFEITS 1116

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%)

Query: 1096 HDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPIDGQVKEVLVKDGE 1155
             D+  + +  +G   +  V  G +VK G  + V+ AMK EM++S+P  G+V +V+ K+G+
Sbjct: 1798 EDAEMVYSEYSGRFWKPLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGD 1857

Query: 1156 NV 1157
             V
Sbjct: 1858 MV 1859

>KLLA0F06072g 583276..589971 highly similar to sp|Q00955
           Saccharomyces cerevisiae YNR016c ACC1 acetyl-CoA
           carboxylase, start by similarity
          Length = 2231

 Score =  195 bits (496), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 154/534 (28%), Positives = 239/534 (44%), Gaps = 89/534 (16%)

Query: 18  NKILVANRGEIPIRIFRSAHELSMKT---------VAIYSHEDRLSMHRLKADEAYM-IG 67
           +K+L+AN G   ++  RS  + + +T         VA+ + ED      L+A+  Y+ + 
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGDERTVQFVAMATPED------LEANAEYIRMA 114

Query: 68  KQGKYTPVGA----YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEA--GITWI 121
            Q    P G     Y  +D I+E+A+  +VD +  G+G  SEN     ++  +   I +I
Sbjct: 115 DQYIEVPGGTNNNNYANVDLIVEVAERADVDAVWAGWGHASENPLLPERLAASHRKIIFI 174

Query: 122 GPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSV---------------------- 159
           GP    + S+GDK+S+  +A  A VP +P +   +D V                      
Sbjct: 175 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDEVHVDKETNLVSVEDKVYQEGCCS 234

Query: 160 --EEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFI 217
             E+      E G+P+++KA+              D+    +Q+A +E   S      FI
Sbjct: 235 SPEDGLKKAKEIGFPIMVKASEGGGGKGIRKVENEDEFLSLYQQAANEIPGS----PIFI 290

Query: 218 ERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDA 277
            +   K +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      D    +   A
Sbjct: 291 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMEKAA 350

Query: 278 VKLASVANYKNAGTAEFLVD-DQNRHYFIEINPRIQVEHTITEEITGIDIVXXXXXXXX- 335
           V+L  +  Y +AGT E+L   D+++ YF+E+NPR+QVEH  TE +TG+++          
Sbjct: 351 VRLGQLVGYVSAGTVEYLYSHDEDKFYFLELNPRLQVEHPTTEMVTGVNLPSAQLQIAMG 410

Query: 336 -------------------------XXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQ 370
                                                + T +G    CRIT+EDP + F+
Sbjct: 411 IPMHRIRDIRLLYGVDPKSASEIDFNFSTPESAKTQRKPTPKGHCTACRITSEDPNEGFK 470

Query: 371 PDTGRIEV--YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRA 428
           P  G +    +RS+         GN   G I S   DS        G   +  R+ M+ A
Sbjct: 471 PSGGALHELNFRSSSNVWGYFSVGN--NGGIHS-FSDSQFGHIFAFGENRQASRKHMVVA 527

Query: 429 LIEFRIRG-VKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQK 481
           L E  IRG  +T + +L+ LL    F D T  T ++DD      ++S +  A+K
Sbjct: 528 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD------LISQKMTAEK 575

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 1096 HDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPIDGQVK 1147
            +D  Q+  P  G +++  V  G  V  GQP A +  MKM+M + S  +G V+
Sbjct: 699  NDPTQLRTPSPGKLVKFLVENGDHVIAGQPYAEVEVMKMQMPLISQENGVVQ 750

>Scas_720.74
          Length = 2231

 Score =  192 bits (487), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 153/518 (29%), Positives = 235/518 (45%), Gaps = 83/518 (16%)

Query: 18  NKILVANRGEIPIRIFRS---------AHELSMKTVAIYSHEDRLSMHRLKADEAYM-IG 67
           +KIL+AN G   ++  RS          +E +++ VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGNERTIQFVAMATPED------LEANAEYIRMA 113

Query: 68  KQGKYTPVGA----YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKV--EEAGITWI 121
            Q    P G     Y  +D I++IA+  +VD +  G+G  SEN     K+   +  + +I
Sbjct: 114 DQYVEVPGGTNNKNYANVDLIVDIAERADVDAVWAGWGHASENPHLPEKLAMSKRKVVFI 173

Query: 122 GPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSV---------------------- 159
           GP    + S+GDK+S+  +A  A+VP +P +   ID V                      
Sbjct: 174 GPPGSAMRSLGDKISSTIVAQSAHVPCIPWSGTGIDKVQVDKDTGLVSVADEVYAQGCCS 233

Query: 160 --EEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFI 217
             E+      + G+PV+IKA+              +D    + +A +E   S      FI
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGS----PIFI 289

Query: 218 ERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDA 277
            +   K +H+EVQLLAD YGN + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAAPETFAMMEKSA 349

Query: 278 VKLASVANYKNAGTAEFLVDDQNRH-YFIEINPRIQVEHTITEEITGIDI---------- 326
           V+L  +  Y +AGT E+L   +++  YF+E+NPR+QVEH  TE +TG+++          
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHEDKKFYFLELNPRLQVEHPTTEMVTGVNLPATQLQIAMG 409

Query: 327 ----------VXXXXXXXXXXXXXXXXXXXDRITT------RGFAIQCRITTEDPAKNFQ 370
                     V                   + + T      +G    CRIT+EDP + F+
Sbjct: 410 IPMHRISDIRVFYGMNPHTASEIDFDFSTEESLKTQRKPVPKGHCTACRITSEDPDEGFK 469

Query: 371 PDTGRIEV--YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRA 428
           P  G +    +RS+         GN   G I S   DS        G   +  R+ M+ A
Sbjct: 470 PSGGSLHELNFRSSSNVWGYFSVGN--NGGIHS-FSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 429 LIEFRIRG-VKTNIPFLLTLLTNPVFIDGTYWTTFIDD 465
           L E  IRG  +T + +L+ LL    F D T  T ++DD
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 1096 HDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEM 1136
            +D  Q+  P  G +++  V +G  +  GQP A +  MKM+M
Sbjct: 698  NDPTQLRTPSPGKLVKFLVESGDHIAAGQPYAEIEVMKMQM 738

>CAGL0L10780g complement(1149588..1156289) highly similar to
           sp|Q00955 Saccharomyces cerevisiae YNR016c ACC1 or
           sp|P32874 Saccharomyces cerevisiae YMR207c HFA1, start
           by similarity
          Length = 2233

 Score =  191 bits (485), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 156/534 (29%), Positives = 243/534 (45%), Gaps = 89/534 (16%)

Query: 18  NKILVANRGEIPIRIFRSAHELSMKT---------VAIYSHEDRLSMHRLKADEAYM-IG 67
           +K+L+AN G   ++  RS  + + +T         VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPED------LEANAEYIRMA 113

Query: 68  KQGKYTPVGA----YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAG--ITWI 121
            Q    P G     Y  +D I++IA+  +VD +  G+G  SEN     K+  +   I +I
Sbjct: 114 DQYVEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLARSKRKILFI 173

Query: 122 GPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSV--EEAQAFVA------------ 167
           GP    + S+GDK+S+  +A  A VP +P +   +D+V  +E    V+            
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNGLVSVDDDIYQKGCCS 233

Query: 168 ----------EYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFI 217
                     + G+PV+IKA+              +D  + + +A +E   S      FI
Sbjct: 234 SPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYHQAANEIPGS----PIFI 289

Query: 218 ERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDA 277
            +   K +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 290 MKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAGPETFGEMEKAA 349

Query: 278 VKLASVANYKNAGTAEFLVD-DQNRHYFIEINPRIQVEHTITEEITGIDI---------- 326
           V+L  +  Y +AGT E+L   D N+ YF+E+NPR+QVEH  TE +TG+++          
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMG 409

Query: 327 ----------VXXXXXXXXXXXXXXXXXXXDRITT------RGFAIQCRITTEDPAKNFQ 370
                     +                   D + T      +G    CRIT+EDP   F+
Sbjct: 410 IPMHRISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIPKGHCTACRITSEDPNDGFK 469

Query: 371 PDTGRIEV--YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRA 428
           P  G +    +RS+         GN   G I S   DS        G   +  R+ M+ A
Sbjct: 470 PSGGTLNELNFRSSSNVWGYFSVGN--NGGIHS-FSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 429 LIEFRIRG-VKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQK 481
           L E  IRG  +T + +L+ LL    F + T  T ++DD      ++S++  A+K
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEENTITTGWLDD------LISTKMTAKK 574

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score =  191 bits (484), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 154/532 (28%), Positives = 235/532 (44%), Gaps = 86/532 (16%)

Query: 7   LRDSSNLLGEK---NKILVANRGEIPIRIFRSAHELSMKT---------VAIYSHEDRLS 54
           LRD   L G     +KIL+AN G   ++  RS  + + +T         V + + ED   
Sbjct: 46  LRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPED--- 102

Query: 55  MHRLKADEAYM-IGKQGKYTPVGA----YLAIDEILEIAKEHNVDFIHPGYGFLSENSEF 109
              L+A+  Y+ +  Q    P G     Y  +D I+++A+  +VD +  G+G  SEN   
Sbjct: 103 ---LEANTEYIRMADQYVEVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLL 159

Query: 110 ARKVEEAG--ITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVE------- 160
             K+  +   + +IGP    + S+GDK+S+  +A  A VP +P +   +D VE       
Sbjct: 160 PEKLARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKL 219

Query: 161 -----------------EAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRAT 203
                            +      + G+PV++KA+              +D    +Q+A 
Sbjct: 220 VSVADDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAA 279

Query: 204 SEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAK 263
           +E   S      FI +   K +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP  
Sbjct: 280 NEIPGS----PIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVT 335

Query: 264 TLPKDVRDAILTDAVKLASVANYKNAGTAEFLVD-DQNRHYFIEINPRIQVEHTITEEIT 322
               D    +   AV+L  +  Y +AGT E+L   ++++ YF+E+NPR+QVEH  TE +T
Sbjct: 336 IAKPDTFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVT 395

Query: 323 GIDIVXXXXXXXX--------------------------XXXXXXXXXXXDRITTRGFAI 356
           G+++                                               R   +G   
Sbjct: 396 GVNLPAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCT 455

Query: 357 QCRITTEDPAKNFQPDTGRIEV--YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCS 414
            CRIT+EDP + F+P  G +    +RS+         GN   G I S   DS        
Sbjct: 456 ACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGN--NGGIHS-FSDSQFGHIFAF 512

Query: 415 GSTYEIVRRKMLRALIEFRIRG-VKTNIPFLLTLLTNPVFIDGTYWTTFIDD 465
           G   +  R+ M+ AL E  IRG  +T + +L+ LL    F D T  T ++DD
Sbjct: 513 GENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 1096 HDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEM 1136
            +D  Q+  P  G ++   V +G  ++ GQP A +  MKM+M
Sbjct: 698  NDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQM 738

>YNR016C (ACC1) [4599] chr14 complement(654672..661373) Acetyl-CoA
           carboxylase, first and rate-limiting step in fatty acid
           biosynthesis pathway [6702 bp, 2233 aa]
          Length = 2233

 Score =  187 bits (476), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 150/518 (28%), Positives = 231/518 (44%), Gaps = 83/518 (16%)

Query: 18  NKILVANRGEIPIRIFRSAHELSMKT---------VAIYSHEDRLSMHRLKADEAYM-IG 67
           +KIL+AN G   ++  RS  + + +T         VA+ + ED      L+A+  Y+ + 
Sbjct: 60  SKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPED------LEANAEYIRMA 113

Query: 68  KQGKYTPVGA----YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEAG--ITWI 121
            Q    P G     Y  +D I++IA+  +VD +  G+G  SEN     K+ ++   + +I
Sbjct: 114 DQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFI 173

Query: 122 GPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSV--EEAQAFVA------------ 167
           GP    + S+GDK+S+  +A  A VP +P +   +D+V  +E    V+            
Sbjct: 174 GPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCT 233

Query: 168 ----------EYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFI 217
                       G+PV+IKA+              +D    + +A +E   S      FI
Sbjct: 234 SPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGS----PIFI 289

Query: 218 ERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDA 277
            +   + +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      +    +   A
Sbjct: 290 MKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAA 349

Query: 278 VKLASVANYKNAGTAEFLVD-DQNRHYFIEINPRIQVEHTITEEITGIDIVXXXXXXXX- 335
           V+L  +  Y +AGT E+L   D  + YF+E+NPR+QVEH  TE ++G+++          
Sbjct: 350 VRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMG 409

Query: 336 -------------------------XXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQ 370
                                                R   +G    CRIT+EDP   F+
Sbjct: 410 IPMHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFK 469

Query: 371 PDTGRIEV--YRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRA 428
           P  G +    +RS+         GN   G+I S   DS        G   +  R+ M+ A
Sbjct: 470 PSGGTLHELNFRSSSNVWGYFSVGN--NGNIHS-FSDSQFGHIFAFGENRQASRKHMVVA 526

Query: 429 LIEFRIRG-VKTNIPFLLTLLTNPVFIDGTYWTTFIDD 465
           L E  IRG  +T + +L+ LL    F D T  T ++DD
Sbjct: 527 LKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDD 564

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 1096 HDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPIDGQVK 1147
            +D  Q+  P  G +++  V  G  + +GQP A +  MKM+M + S  +G V+
Sbjct: 698  NDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKMQMPLVSQENGIVQ 749

>Kwal_23.6157
          Length = 2230

 Score =  187 bits (474), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 153/538 (28%), Positives = 237/538 (44%), Gaps = 97/538 (18%)

Query: 18  NKILVANRGEIPIRIFRSAHELSMKT---------VAIYSHEDRLSMHRLKADEAYM-IG 67
           +K+L+AN G   ++  RS  + + +T         VA+ + ED      L+A+  Y+ + 
Sbjct: 61  SKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPED------LEANAEYLRMA 114

Query: 68  KQGKYTPVGA----YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKVEEA--GITWI 121
            Q    P G     Y  +D I+E+A+  +VD +  G+G  SEN     ++  +   + +I
Sbjct: 115 DQYVEVPGGTNNNNYANVDLIVELAERADVDAVWAGWGHASENPLLPERLAASPRKVIFI 174

Query: 122 GPSAEVIDSVGDKVSARNLAAKANVPVVP--GT----------------------PGPID 157
           GP    + S+GDK+S+  +A  A VP +P  GT                       G  D
Sbjct: 175 GPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVHLDEENGLVSVTDDIYQKGCCD 234

Query: 158 SVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFI 217
           S E+  A   + G+PV++KA+               D    +++A +E   S      FI
Sbjct: 235 SPEDGLAKAKKIGFPVMVKASEGGGGKGIRKVEREQDFIPLYKQAANEIPGS----PIFI 290

Query: 218 ERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDA 277
            +     +H+EVQLLAD YG  + LF RDCSVQRRHQK++E AP      D    +   A
Sbjct: 291 MKLAGNARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFTEMERSA 350

Query: 278 VKLASVANYKNAGTAEFLVD-DQNRHYFIEINPRIQVEHTITEEITGIDIVXXXXXXXXX 336
           V+L  +  Y +AGT E+L   D ++ YF+E+NPR+QVEH  TE ++G+++          
Sbjct: 351 VRLGKLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMG 410

Query: 337 X--------------------------XXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQ 370
                                                R T +G    CRIT+EDP + F+
Sbjct: 411 IPMHRIKDIRLMYGVDPHTATEIDFDFSSKDSTKIQRRPTPKGHCTACRITSEDPNEGFK 470

Query: 371 PDTGRIEV--YRSA----GGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRK 424
           P  G +    +RS+    G   V   GG       I    DS        G   +  R+ 
Sbjct: 471 PSGGSLHELNFRSSSNVWGYFSVSSSGG-------IHSFSDSQFGHIFAFGENRQASRKH 523

Query: 425 MLRALIEFRIRG-VKTNIPFLLTLLTNPVFIDGTYWTTFIDDTPELFKMVSSQNRAQK 481
           M+ AL E  IRG  +T + +L+ LL    F   +  T ++DD      ++S +  A+K
Sbjct: 524 MVVALKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLDD------LISQKMTAEK 575

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 1096 HDSYQIGAPMAGVIIEVKVHTGSLVKQGQPVAVLSAMKMEMVISSPIDGQVKEVLVKDGE 1155
            +D  Q+  P  G +++    +G  V  GQP A +  MKM+M + S   G + ++L + G 
Sbjct: 699  NDPTQLRTPSPGKLVKFLFESGDHVIAGQPYAEVEVMKMQMPLVSQESG-IIQLLKQPGS 757

Query: 1156 NV 1157
             V
Sbjct: 758  TV 759

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score =  184 bits (468), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 133/449 (29%), Positives = 210/449 (46%), Gaps = 57/449 (12%)

Query: 78  YLAIDEILEIAKEHNVDFIHPGYGFLSENSEFARKV--EEAGITWIGPSAEVIDSVGDKV 135
           Y  ID IL++A++ +VD +  G+G  SEN      +   +  I +IGP    + S+GDK+
Sbjct: 54  YANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKI 113

Query: 136 SARNLAAKANVPVVPGTPGPIDSV------------------------EEAQAFVAEYGY 171
           S+  +A  A +P +P +   ID++                        E+A       G+
Sbjct: 114 SSTIVAQSAKIPCIPWSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGF 173

Query: 172 PVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQL 231
           PV+IKA+              DD    +++A +E   S      F+ + +   +H+EVQL
Sbjct: 174 PVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNETPGS----PMFVMKVVTDARHLEVQL 229

Query: 232 LADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGT 291
           LAD YG  + LF RDCS+QRRHQK++E AP      +    +   A++L  +  Y +AGT
Sbjct: 230 LADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGT 289

Query: 292 AEFLVDDQ-NRHYFIEINPRIQVEHTITEEITGIDI------------------VXXXXX 332
            E+L   + ++ YF+E+NPR+QVEH  TE I+G+++                  +     
Sbjct: 290 VEYLYSPKDDKFYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMISDIRKLYG 349

Query: 333 XXXXXXXXXXXXXXDRITTRGFAIQCRITTEDPAKNFQPDTGRIEV--YRSAGGNGVRLD 390
                          R + +G  I CRIT+EDP + F+P TG+I    +RS+        
Sbjct: 350 LDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFKPSTGKIHELNFRSSSNVWGYFS 409

Query: 391 GGNAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRG-VKTNIPFLLTLLT 449
            GN  A   I    DS        G+  +  ++ M+ AL +F IRG  KT I +L+ LL 
Sbjct: 410 VGNNGA---IHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLE 466

Query: 450 NPVFIDGTYWTTFIDDTPELFKMVSSQNR 478
              F      T ++DD   + K +SS ++
Sbjct: 467 TRDFESNNISTGWLDDL--ILKNLSSDSK 493

>Scas_582.4*
          Length = 2193

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/297 (18%), Positives = 116/297 (39%), Gaps = 24/297 (8%)

Query: 34   RSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYLAIDEILEIAKEHNV 93
            R+     +KT+ I  + + +S    +AD  Y              + ++ IL+I +  N 
Sbjct: 982  RTLRANKIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERILDIYEIENS 1030

Query: 94   DFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTP 153
              +    G  + N+  A  +    +  +G S E+IDS  ++     +  +  V      P
Sbjct: 1031 SGVVVSMGGQTSNN-IAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIGV----DQP 1085

Query: 154  G--PIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFG 211
                + S++EA++F  + GYPV+++ ++             +D+A    +A   ++    
Sbjct: 1086 AWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLASYLNQAVEVSR---- 1141

Query: 212  NGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPKDVR 270
            +    I +++   K IE+  +A     V+H+          H      + P + L K+  
Sbjct: 1142 DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAKETV 1201

Query: 271  DAILTDAVKLASVANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
            D I+    K+            +F+  D N    IE N R         ++ G++++
Sbjct: 1202 DRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1257

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 92/232 (39%), Gaps = 19/232 (8%)

Query: 99  GYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDS 158
           G   LS   E   + E  G+  +G   + I +  D+    N   + N           +S
Sbjct: 518 GQTALSVGIEMKDEFESLGVKVLGTQIDTIITTEDRELFANAIDEINEKCAKSHAA--NS 575

Query: 159 VEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIE 218
           VEEA   V + G+PVI++AA+              ++ D    A + +          +E
Sbjct: 576 VEEALTAVKDIGFPVIVRAAYALGGLGSGFANNEQELIDLCNVAFASSP------QVLVE 629

Query: 219 RFLNKPKHIEVQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVRDA 272
           R +   K IE +++ D + N V +    C+++            + VAP++TL  +  + 
Sbjct: 630 RSMKGWKEIEYEVVRDAFDNCVTV----CNMENFDPLGIHTGDSIVVAPSQTLSDEEYNM 685

Query: 273 ILTDAVKLASVANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
           +   AV +            ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 686 LRNTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATG 737

>CAGL0L05676g 619734..626369 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2, start by
           similarity
          Length = 2211

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 76/174 (43%), Gaps = 17/174 (9%)

Query: 157 DSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCF 216
           +SVEEA A V + G+PVI++AA+              ++ D    A + +          
Sbjct: 577 NSVEEALAAVKDIGFPVIVRAAYALGGLGSGFANNEQELIDLCNVAFASSP------QVL 630

Query: 217 IERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVR 270
           +ER +   K +E +++ D + N + +    C+++            + VAP++TL  +  
Sbjct: 631 VERSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDY 686

Query: 271 DAILTDAVKLASVANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
           + + T AV +            ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 687 NMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATG 740

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/297 (17%), Positives = 114/297 (38%), Gaps = 24/297 (8%)

Query: 34   RSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYLAIDEILEIAKEHNV 93
            R+    ++KT+ I  + + +S    +AD  Y              + ++ +L+I +    
Sbjct: 1005 RTLRANNIKTIMINYNPETVSTDYDEADRLYF-----------ETINLERVLDIYEAEAS 1053

Query: 94   DFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTP 153
            + +    G  + N+  A  +    +  +G S ++IDS  ++     +  +  V      P
Sbjct: 1054 NGVVVSMGGQTSNN-IAMSLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGV----DQP 1108

Query: 154  G--PIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFG 211
                + S++EA+ F  + GYPV+++ ++             +D+     +A   ++    
Sbjct: 1109 AWKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR---- 1164

Query: 212  NGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPKDVR 270
            +    I +++   K IE+  +A     V+H+          H      + P + L  +  
Sbjct: 1165 DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETV 1224

Query: 271  DAILTDAVKLASVANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
            D I+    K+            +F+  D N    IE N R         ++ G++++
Sbjct: 1225 DRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1280

>YJL130C (URA2) [2788] chr10 complement(165641..172285)
           Multifunctional protein of pyrimidine biosynthesis
           pathway, contains glutamine amidotransferase,
           glutamine-dependent carbamylphosphate synthetase
           (CPSase), dihydroorotase-like (DHOase) domain, and
           aspartate carbamyltransferase (ATCase) [6645 bp, 2214
           aa]
          Length = 2214

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 76/174 (43%), Gaps = 17/174 (9%)

Query: 157 DSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCF 216
           +SV+EA A V E G+PVI++AA+              ++ D    A S +          
Sbjct: 579 NSVDEALAAVKEIGFPVIVRAAYALGGLGSGFANNEKELVDLCNVAFSSSP------QVL 632

Query: 217 IERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVR 270
           +E+ +   K +E +++ D + N + +    C+++            + VAP++TL  +  
Sbjct: 633 VEKSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDY 688

Query: 271 DAILTDAVKLASVANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
           + + T AV +            ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 689 NMLRTTAVNVIRHLGVVGECNIQYALNPVSKDYCIIEVNARLSRSSALASKATG 742

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/297 (17%), Positives = 115/297 (38%), Gaps = 24/297 (8%)

Query: 34   RSAHELSMKTVAIYSHEDRLSMHRLKADEAYMIGKQGKYTPVGAYLAIDEILEIAKEHNV 93
            R+    ++KT+ +  + + +S    +AD  Y              + ++ +L+I +  N 
Sbjct: 1007 RTLRANNIKTIMVNYNPETVSTDYDEADRLYF-----------ETINLERVLDIYEIENS 1055

Query: 94   DFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTP 153
              +    G  + N+  A  +    +  +G S ++IDS  ++     +  +  V      P
Sbjct: 1056 SGVVVSMGGQTSNN-IAMTLHRENVKILGTSPDMIDSAENRYKFSRMLDQIGV----DQP 1110

Query: 154  G--PIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFG 211
                + S++EA++F  + GYPV+++ ++             +D+     +A   ++    
Sbjct: 1111 AWKELTSMDEAESFAEKVGYPVLVRPSYVLSGAAMNTVYSKNDLESYLNQAVEVSR---- 1166

Query: 212  NGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPKDVR 270
            +    I +++   K IE+  +A     V+H+          H      + P + L  +  
Sbjct: 1167 DYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAGVHSGDATLIVPPQDLAPETV 1226

Query: 271  DAILTDAVKLASVANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
            D I+    K+            +F+  D N    IE N R         ++ G++++
Sbjct: 1227 DRIVVATAKIGKALKITGPYNIQFIAKD-NEIKVIECNVRASRSFPFISKVVGVNLI 1282

>ACR263C [1310] [Homologous to ScYJL130C (URA2) - SH]
           (827830..834552) [6723 bp, 2240 aa]
          Length = 2240

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 93/232 (40%), Gaps = 19/232 (8%)

Query: 99  GYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDS 158
           G   LS   E   + E  G+  +G S + I +  D+    N   + N            +
Sbjct: 539 GQTALSVGIEMKDEFEALGVKVLGTSIDTIITTEDRELFANAMDEINEKCAKSKAA--ST 596

Query: 159 VEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIE 218
           V+EA   V + G+PVI++AA+              ++ D    A + +          +E
Sbjct: 597 VDEALEAVKDIGFPVIVRAAYALGGLGSGFASNEQELVDLCNVAFASSP------QVLVE 650

Query: 219 RFLNKPKHIEVQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVRDA 272
           R +   K +E +++ D + N + +    C+++            + VAP++TL  +  + 
Sbjct: 651 RSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNM 706

Query: 273 ILTDAVKLASVANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
           + T AV +            ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 707 LRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATG 758

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 42/226 (18%), Positives = 86/226 (38%), Gaps = 14/226 (6%)

Query: 106  NSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPG--PIDSVEEAQ 163
            ++  A  +    +  +G S E+IDS  ++     +  +  V      P    + S+EEA+
Sbjct: 1083 SNNIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIEV----DQPAWKELTSMEEAE 1138

Query: 164  AFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNK 223
             F  + GYPV+++ ++             DD+     +A   ++         I +++  
Sbjct: 1139 DFANKVGYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY----PVVITKYIEN 1194

Query: 224  PKHIEVQLLADGYGNVVHLFERDCSVQRRHQ--KVVEVAPAKTLPKDVRDAILTDAVKLA 281
             K IE+  +A     ++H+          H     + V P    P+ VR  I+    K+ 
Sbjct: 1195 AKEIEMDAVAKDGEMIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVR-RIVDATAKIG 1253

Query: 282  SVANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
                       +F+  + N    IE N R         ++ G++++
Sbjct: 1254 RALKITGPYNIQFIAKN-NEIKVIECNVRASRSFPFISKVIGVNLI 1298

>Sklu_2331.1 YJL130C, Contig c2331 2029-8691
          Length = 2220

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/225 (17%), Positives = 86/225 (38%), Gaps = 12/225 (5%)

Query: 106  NSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPG--PIDSVEEAQ 163
            ++  A  +    +  +G S E+IDS  ++     +  +  V      P    + S++EA+
Sbjct: 1067 SNNIAMSLHREKVKILGTSPEMIDSAENRYKFSRMLDQIGV----DQPAWKELTSIDEAE 1122

Query: 164  AFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNK 223
             F    GYPV+++ ++             DD+A    +A   ++    +    I +++  
Sbjct: 1123 GFAENVGYPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR----DYPVVITKYIEN 1178

Query: 224  PKHIEVQLLADGYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPKDVRDAILTDAVKLAS 282
             K IE+  +A     V+H+          H      + P + L  +  + I+    K+  
Sbjct: 1179 AKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVNRIVVATAKIGK 1238

Query: 283  VANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
                      +F+  + N    IE N R         ++ G++++
Sbjct: 1239 ALKITGPYNIQFIAKN-NDIKVIECNVRASRSFPFISKVVGVNLI 1282

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/232 (19%), Positives = 92/232 (39%), Gaps = 19/232 (8%)

Query: 99  GYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDS 158
           G   LS   E   + E  G+  +G   + + +  D+    N   + N            +
Sbjct: 523 GQTALSVGIEMKDEFETLGVKVLGTPIDTVITTEDRELFSNAMDEINEKCAKSKAA--ST 580

Query: 159 VEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIE 218
           V+EA   V E G+PVI++AA+              ++ D    A + +          +E
Sbjct: 581 VKEALEAVKEIGFPVIVRAAYALGGLGSGFASNETELVDLCNVAFASSP------QVLVE 634

Query: 219 RFLNKPKHIEVQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVRDA 272
           R +   K +E +++ D + N + +    C+++            + VAP++TL  +  + 
Sbjct: 635 RSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNM 690

Query: 273 ILTDAVKLASVANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
           + T AV +            ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 691 LRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATG 742

>Kwal_33.14061
          Length = 2221

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 91/232 (39%), Gaps = 19/232 (8%)

Query: 99  GYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDS 158
           G   LS   E   + E  G+  +G   + + +  D+    N   + N            +
Sbjct: 523 GQTALSVGIEMKDEFEALGVKVLGTPIDTVITTEDRELFSNAMDEINEKCAKSKAAA--T 580

Query: 159 VEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIE 218
           VEEA   V E G+PVI +AA+              ++ D    A + +          +E
Sbjct: 581 VEEALEAVKEIGFPVICRAAYALGGLGSGFANNEKELVDLCNIAFASSP------QVLVE 634

Query: 219 RFLNKPKHIEVQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVRDA 272
           R +   K +E +++ D + N + +    C+++            + VAP++TL  +  + 
Sbjct: 635 RSMKGWKEVEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVVAPSQTLSDEDYNM 690

Query: 273 ILTDAVKLASVANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
           + T AV +            ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 691 LRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATG 742

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 37/225 (16%), Positives = 84/225 (37%), Gaps = 12/225 (5%)

Query: 106  NSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPG--PIDSVEEAQ 163
            ++  A  +    +  +G + E+IDS  ++     +  +  V      P    + S+EEA+
Sbjct: 1067 SNNIAMSLHRENVKILGTTPEMIDSAENRYKFSRMLDQIGV----DQPAWKELTSIEEAE 1122

Query: 164  AFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNK 223
             F     +PV+++ ++             DD+A    +A   ++    +    I +++  
Sbjct: 1123 QFADAVSFPVLVRPSYVLSGAAMNTVYSKDDLASYLNQAVEVSR----DYPVVITKYIEN 1178

Query: 224  PKHIEVQLLADGYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPKDVRDAILTDAVKLAS 282
             K IE+  +A     V+H+          H      + P + L  +  + I+    K+  
Sbjct: 1179 AKEIEMDAVAKDGELVMHVVSEHVENAGVHSGDATLIVPPQDLDPETVERIVVATAKIGK 1238

Query: 283  VANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
                      +F+  + N    IE N R         ++  ++++
Sbjct: 1239 ALKITGPFNIQFIAKN-NDIKVIECNVRASRSFPFISKVVNVNLI 1282

>CAGL0C04917g 457506..460847 highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2, hypothetical
           start
          Length = 1113

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 90/230 (39%), Gaps = 13/230 (5%)

Query: 101 GFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTP--GPIDS 158
           G L +N   A  + E G   +G S + ID+  ++    ++    NV    G P    + S
Sbjct: 663 GQLPQN--IALSLYEYGCKILGTSPKDIDNAENRHKFSSILDSINV----GQPEWKELTS 716

Query: 159 VEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIE 218
           VEEA+ F  +  YPV+I+ ++              ++ D    A+  +     +    + 
Sbjct: 717 VEEAKTFANKVSYPVLIRPSYVLSGAAMSVVNNEHELEDKLTLASDVSP----DHPVVMS 772

Query: 219 RFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPKDVRDAILTDA 277
           +F+   + I+V  +A     +VH           H      + P + L ++V+  + T A
Sbjct: 773 KFIQGAQEIDVDAVACNGELLVHAISEHVEDAGVHSGDATLILPPQHLSENVKSQLKTIA 832

Query: 278 VKLASVANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
            K+A   N       + +   +N    IE N R         ++ G++ +
Sbjct: 833 KKVAKAWNITGPFNMQVIKAGENDLKVIECNIRASRSFPFVSKVLGVNFI 882

>Kwal_27.12090
          Length = 394

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 91/225 (40%), Gaps = 27/225 (12%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   + A+G + +GI D  G   P     L+ +++       I  H HD  G A+ + 
Sbjct: 165 LNIYKTVSAIGVNRVGIADTVGCANPRQVYDLVRTLKGVVT-CDIECHFHDDTGCAIGNA 223

Query: 775 AACAFAGADVVDVAT---NSMSGLTSQPSINA-LLASLDGEIETNINVNMVRELDAYWAQ 830
            +   AGA ++DV+       +G+T    + A ++ +    +++   ++ +R+++   A+
Sbjct: 224 YSALEAGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKYKLHKIRDIENLVAE 283

Query: 831 MRLLYSCFEADLKG-----PDPEVYQHEIPGGQLTNLLFQAQQLGLGE---------KWS 876
              +   F   + G         ++   I     T  +   Q  GL            W+
Sbjct: 284 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPQDFGLKRYIHFANRLTGWN 343

Query: 877 ETKRAYREAN-YLLGDLVK-VTPTSKVVGDLAQFMVSNKLSSDDV 919
             K    + N +L  D +K VT   K +GD+ Q      LS DDV
Sbjct: 344 AIKSRVEQLNLHLTDDQIKDVTQKIKKIGDVRQ------LSIDDV 382

>ABR157W [750] [Homologous to ScYJR109C (CPA2) - SH]
           complement(695747..699088) [3342 bp, 1113 aa]
          Length = 1113

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 94/225 (41%), Gaps = 27/225 (12%)

Query: 110 ARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKA----NVPVVPGTPGPIDSVEEAQAF 165
           A  +E+ G+T +G    V+++  D    R L A+A    N+P+         +VE+A A 
Sbjct: 126 AVTLEKYGVTVLGTPISVLETTED----RELFARALKEINMPIAESVA--CSTVEDAVAA 179

Query: 166 VAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPK 225
             + GYPVI+++A+                 D  Q     A++   +    +E+ L   K
Sbjct: 180 ANDIGYPVIVRSAYALGGLGSGFAD------DDLQLRQLCAQSLALSPQVLVEKSLKGWK 233

Query: 226 HIEVQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVRDAILTDAVK 279
            IE +++ D  GN + +    C+++            + +AP++TL  +    + T A++
Sbjct: 234 EIEYEVVRDRVGNCITV----CNMENFDPLGIHTGDSIVLAPSQTLSDEEFHMLRTAAIE 289

Query: 280 LASVANYKNAGTAEF-LVDDQNRHYFIEINPRIQVEHTITEEITG 323
           +            ++ L  D      IE+N R+     +  + TG
Sbjct: 290 IIRHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATG 334

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 40/226 (17%), Positives = 84/226 (37%), Gaps = 18/226 (7%)

Query: 110 ARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGP----IDSVEEAQAF 165
           A ++ E G   +G S E ID   D+     +          G   P    + S+ E + F
Sbjct: 665 ASQLYEQGANILGTSPEDIDKAEDRHKFSTILDTL------GLDQPRWSELKSLSEVKHF 718

Query: 166 VAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPK 225
           + + GYPV+++ ++             +D+   F+ A + +          I +F+   +
Sbjct: 719 LDDVGYPVLVRPSYVLSGAAMSTVYNSEDLEGVFESAVAVSPEH----PVVISKFIEGAQ 774

Query: 226 HIEVQLLADGYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPKDVRDAILTDAVKLASVA 284
            +++  +A     +VH           H      V P ++L ++ +  +   A ++A+  
Sbjct: 775 ELDIDAVAYKGSLLVHAISEHVENAGVHSGDATLVLPPQSLKEEEKTRLKQLAAQVAAAW 834

Query: 285 NYKNAGTAEFLVDDQNRHY---FIEINPRIQVEHTITEEITGIDIV 327
           N       + +   +  H     IE N R         ++ G++ V
Sbjct: 835 NITGPFNMQIIKTAEGGHTCLKIIECNIRASRSFPFVSKVLGVNFV 880

>Kwal_47.19231
          Length = 795

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 115 EAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVI 174
           +AGI   GPSA+     G K  +++  AK N+P         D  E+A+ ++ +  Y V+
Sbjct: 92  KAGIPVFGPSAKAAIFEGSKTFSKDFMAKHNIPTA--RYANFDDYEKAKEYLEKVDYQVV 149

Query: 175 IKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLAD 234
           +KA                +  DA +    E +      +  IE FL +   I +  ++D
Sbjct: 150 LKADGIAAGKGVLIPTTPQEAQDALKALMVERQFGAAGDSIVIEEFL-EGDEISILTISD 208

Query: 235 GY 236
           GY
Sbjct: 209 GY 210

>KLLA0E23782g complement(2105401..2106582) highly similar to
           sp|Q12122 Saccharomyces cerevisiae YDL131w LYS21
           homocitrate synthase, start by similarity
          Length = 393

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 87/218 (39%), Gaps = 21/218 (9%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G + +GI D  G   P     L+ ++++      I  H HD  G A+ + 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHDDTGCAIGNS 223

Query: 775 AACAFAGADVVDVAT---NSMSGLTSQPSINA-LLASLDGEIETNINVNMVRELDAYWAQ 830
            +   AGA ++DV+       +G+TS   + A ++ S    +++   ++ +R+L+   A 
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPEYVKSKYKLHKLRDLENLVAD 283

Query: 831 MRLLYSCFEADLKG-----PDPEVYQHEIPGGQLTNLLFQAQQLGLGE---------KWS 876
              +   F   + G         ++   I     T  +   +  G+            W+
Sbjct: 284 AVSVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPEDFGMKRYIHFANRLTGWN 343

Query: 877 ETKRAYREANYLLGD--LVKVTPTSKVVGDLAQFMVSN 912
             K    + N  L D  + +VT   K +GD+ Q  + +
Sbjct: 344 AIKSRVEQLNLHLSDDQIKEVTSKIKQIGDVRQLSIED 381

>Scas_712.17
          Length = 793

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 70/164 (42%), Gaps = 22/164 (13%)

Query: 82  DEILEIAKEHNVDFIHPG--YGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139
           D + E A  H+++ + PG     +   +    KV   GI   GPSA+V    G KV ++ 
Sbjct: 61  DALREFALNHDINLVIPGPEQPLVDGITTIFNKV---GIPVFGPSAKVAQLEGSKVFSKR 117

Query: 140 LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAF 199
              K  +P            E+A+ ++AE  Y V++KA                 I D+ 
Sbjct: 118 FMDKHGIPTA--KYASFTDFEKAKKYLAEVDYNVVLKADGIAAGKGVL-------IPDSK 168

Query: 200 QRATSEAKT-----SFGNG--TCFIERFLNKPKHIEVQLLADGY 236
           ++A  +  T      FG+   +  IE FL + + I +  ++DGY
Sbjct: 169 EQALKDLDTIMVERQFGSAGDSVVIEEFL-EGEEISILTISDGY 211

>KLLA0F03190g complement(296883..300236) highly similar to sp|P03965
           Saccharomyces cerevisiae YJR109c CPA2 arginine-specific
           carbamoylphosphate synthase, large chain, start by
           similarity
          Length = 1117

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/176 (19%), Positives = 69/176 (39%), Gaps = 8/176 (4%)

Query: 156 IDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTC 215
           + SVEEA+ F  + GYPV+I+ ++              ++      A+  +     +   
Sbjct: 714 LSSVEEAKVFANQVGYPVLIRPSYVLSGAAMSVVTGEHELEVKLTTASDVSP----DHPV 769

Query: 216 FIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQ-KVVEVAPAKTLPKDVRDAIL 274
            + +F+   + I+V  +A     +VH           H      V P + L ++++D + 
Sbjct: 770 VMSKFIEGAQEIDVDAVAHNGMVLVHAISEHVENAGIHSGDATLVLPPQNLSQNIKDRLK 829

Query: 275 TDAVKLASVANYKNAGTAEFLVDDQNRHY---FIEINPRIQVEHTITEEITGIDIV 327
             A K+A   N       + + DD++       IE N R         ++ G++ +
Sbjct: 830 EIADKVAKAWNITGPFNMQIIKDDRDEGVSLKVIECNIRASRSFPFVSKVLGVNFI 885

>ADR107W [1848] [Homologous to ScYDL131W (LYS21) - SH; ScYDL182W
           (LYS20) - SH] complement(897769..897784,897846..899158)
           [1329 bp, 442 aa]
          Length = 442

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 51/251 (20%), Positives = 95/251 (37%), Gaps = 41/251 (16%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G + +GI D  G   P     L+ ++++      +  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDVECHFHNDTGCAIANA 240

Query: 775 AACAFAGADVVDVATNSMSGLTSQPSINALLASL----DGEIETNINVNMVRELDAYWAQ 830
                 GA +VDV+   +        +  L+A +       +++   ++ +R+++   A+
Sbjct: 241 YTALDGGAKLVDVSVLDIGERNEITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVAE 300

Query: 831 MRLLYSCFEADLKG----------------PDPEVYQHEIPGG-QLTNLLFQAQQLGLGE 873
              +   F   + G                 +P  Y+   P    +T  +  A +L    
Sbjct: 301 AVEVNVPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPNDFGMTRYIHFANRL---T 357

Query: 874 KWSETKRAYREAN-YLLGDLVKVTPTSKVVGDLAQFMVSNKLSSDDVRRLASSLDFPDSV 932
            W+  K    + N +L  D VK     +V   + QF  S  L+ DDV          DS+
Sbjct: 358 GWNAIKSRVDQLNLHLTDDQVK-----EVTAKIKQFGTSRPLNIDDV----------DSI 402

Query: 933 MDFFEGLIGQP 943
           +  F   I  P
Sbjct: 403 IKAFHAQIATP 413

>KLLA0E15444g 1370741..1377427 highly similar to sp|P07259
           Saccharomyces cerevisiae YJL130c URA2 multifunctional
           pyrimidine biosynthesis protein, start by similarity
          Length = 2228

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/165 (18%), Positives = 69/165 (41%), Gaps = 17/165 (10%)

Query: 166 VAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPK 225
           V + G+PVI++AA+              ++ D    A + +          +ER +   K
Sbjct: 586 VKDIGFPVIVRAAYALGGLGSGFASNEKELVDLCNVAFASSP------QVLVERSMKGWK 639

Query: 226 HIEVQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVRDAILTDAVK 279
            IE +++ D + N + +    C+++            + +AP++TL  +  + + T AV 
Sbjct: 640 EIEYEVVRDAFDNCITV----CNMENFDPLGIHTGDSIVIAPSQTLSDEDYNMLRTTAVN 695

Query: 280 LASVANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
           +            ++ ++  ++ Y  IE+N R+     +  + TG
Sbjct: 696 VIRHLGVVGECNIQYALNPTSKEYCIIEVNARLSRSSALASKATG 740

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/226 (17%), Positives = 86/226 (38%), Gaps = 14/226 (6%)

Query: 106  NSEFARKVEEAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPG--PIDSVEEAQ 163
            ++  A  +    +  +G S E+IDS  ++     +  + +V      P    + S++EA+
Sbjct: 1065 SNNIAMSLHRENVKILGTSPEMIDSAENRYKFSRMLDQIDV----DQPAWKELTSMDEAE 1120

Query: 164  AFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNK 223
             F  +  YPV+++ ++             DD+     +A   ++         I +++  
Sbjct: 1121 DFAEKVSYPVLVRPSYVLSGAAMNTVYSKDDLESYLNQAVEVSREY----PVVITKYIEN 1176

Query: 224  PKHIEVQLLADGYGNVVHLFERDCSVQRRHQ--KVVEVAPAKTLPKDVRDAILTDAVKLA 281
             K IE+  +A     ++H+          H     + V P    P+ VR  I+    K+ 
Sbjct: 1177 AKEIEMDAVALDGELIMHVVSEHVENAGVHSGDATLIVPPQDLDPETVR-RIVEATAKIG 1235

Query: 282  SVANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
                       +F+  + N    IE N R         ++ G++++
Sbjct: 1236 RALQITGPYNIQFIAKN-NEIKVIECNVRASRSFPFISKVVGVNLI 1280

>Scas_701.35
          Length = 430

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   + ++G + +GI D  G   P     L+ ++R+      I  H H+  G A+A+ 
Sbjct: 170 LNIYKTVNSIGVNRVGIADTVGCANPRQVYELVRTLRS-VVSCDIECHFHNDTGCAIANA 228

Query: 775 AACAFAGADVVDVA 788
                 GA ++DV+
Sbjct: 229 YTALEGGARLIDVS 242

>Kwal_55.19783
          Length = 1121

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 54/260 (20%), Positives = 101/260 (38%), Gaps = 25/260 (9%)

Query: 79  LAIDEILEIAK-EHNVDFIHPGYGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSA 137
           L+ + +++I + EH+   +    G L +N   A K+ E G   +G S E ID       A
Sbjct: 643 LSFERVMDIYELEHSEGAVISVGGQLPQN--IALKMLENGANILGTSPEDIDR------A 694

Query: 138 RNLAAKANVPVVPGTPGP----IDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXD 193
            N    +++    G   P    + SV EA+ F    GYPV+I+ ++             D
Sbjct: 695 ENRHKFSSILDTIGVDQPEWSELSSVSEAKDFSKSVGYPVLIRPSYVLSGAAMSVVNSED 754

Query: 194 DIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRH 253
           ++      A+  +     +    I +F+   + I+V  +A     +VH           H
Sbjct: 755 ELETKLTNASDVSP----DHPVVISKFIEGAQEIDVDAVAYNGEVLVHAISEHVENAGVH 810

Query: 254 Q-KVVEVAPAKTLPKDVRDAILTDAVKLASVANYKNAGTAEFLVDDQNRH-----YFIEI 307
                 + P ++L + +++ +   A K+A    +K  G     +   +RH       IE 
Sbjct: 811 SGDATLILPPQSLSESIKERLYDIAKKVAHA--WKITGPFNMQIIKDDRHEGTSLKVIEC 868

Query: 308 NPRIQVEHTITEEITGIDIV 327
           N R         ++ G + +
Sbjct: 869 NIRASRSFPFVSKVLGCNFI 888

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 41/222 (18%), Positives = 92/222 (41%), Gaps = 27/222 (12%)

Query: 113 VEEAGITWIGPSAEVIDSVGDKVSARNLAAKA----NVPVVPGTPGPIDSVEEAQAFVAE 168
           +++ G+  +G   + +++  D    R+L A+A    N+P         ++V+EA +  + 
Sbjct: 132 LQKYGVKVLGTPIKTLETSED----RDLFAQALKEINIPTAESFA--CETVDEALSAASR 185

Query: 169 YGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIE 228
            GYPVI+++A+              ++ +   +A S +          +E+ L   K +E
Sbjct: 186 VGYPVIVRSAYALGGLGSGFAENEAEMKELAAQALSLSP------QILVEKSLKGWKEVE 239

Query: 229 VQLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVRDAILTDAVKLAS 282
            +++ D   N + +    C+++            +  AP++TL  +    + T A+K+  
Sbjct: 240 YEVVRDRVDNCITV----CNMENFDPLGVHTGDSIVFAPSQTLSDEEFHMLRTAAIKIIR 295

Query: 283 VANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
                     ++ +      Y  IE+N R+     +  + TG
Sbjct: 296 HLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATG 337

>Sklu_2431.2 YDL131W, Contig c2431 3030-4214
          Length = 394

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G   +GI D  G   P     L+ ++++      I  H H+  G A+ + 
Sbjct: 165 LNIYKTVDKIGVDRVGIADTVGCANPRQVYELVRTLKS-VIHCDIECHFHNDTGCAIGNS 223

Query: 775 AACAFAGADVVDVAT---NSMSGLTSQPSINA-LLASLDGEIETNINVNMVRELDAYWAQ 830
            +   AGA ++DV+       +G+TS   + A ++ S    +++   ++ +R+L+   A+
Sbjct: 224 YSALEAGARLIDVSVLGIGERNGITSLGGLMARMIVSAPDYVKSKYKLHKLRDLETLVAE 283

>CAGL0H07887g 769859..772234 highly similar to sp|P07244
           Saccharomyces cerevisiae YGL234w ADE5, start by
           similarity
          Length = 791

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 64/157 (40%), Gaps = 8/157 (5%)

Query: 82  DEILEIAKEHNVDFIHPG--YGFLSENSEFARKVEEAGITWIGPSAEVIDSVGDKVSARN 139
           +++ E A   +++ + PG     +   ++   KV   GI   GPSA+     G K  +++
Sbjct: 58  EKLREFAVSKDINLVVPGPEVPLIDGVTDLFAKV---GIPVFGPSAKAAQLEGSKGFSKD 114

Query: 140 LAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAF 199
              + N+P         +S EEA+  + E  Y V++KA               ++   A 
Sbjct: 115 FMQRHNIPTA--RHKTFESYEEAKRHLEEVNYRVVLKADGVAAGKGVLIPENKEEALKAL 172

Query: 200 QRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGY 236
                E +      T  IE FL +   I +  ++DGY
Sbjct: 173 DVIMVEKQFGDAGNTVVIEEFL-EGDEISILTISDGY 208

>Kwal_56.24401
          Length = 441

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   + A+G + +GI D  G   P     L+ +++       +  H H+  G A+A+ 
Sbjct: 179 LNIYKTVDAIGVNRVGIADTVGCANPRQVYELMRTLKT-VVSCDVECHFHNDTGCAIANA 237

Query: 775 AACAFAGADVVDVA 788
                 GA ++DVA
Sbjct: 238 YTALEGGAKLIDVA 251

>KLLA0A00957g 89999..92377 gi|9957024|gb|AAG09178.1 Kluyveromyces
           lactis purine biosynthetic pathway protein ADE5, 7,
           start by similarity
          Length = 792

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 3/120 (2%)

Query: 117 GITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVIIK 176
           GI   GPSA+     G K  +++   K N+P         D  E A+A++ +  Y V++K
Sbjct: 93  GIPVFGPSAKAAIFEGSKTFSKDFMQKHNIPTA--RYANFDDYEAAKAYLEKVDYQVVLK 150

Query: 177 AAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLADGY 236
           A               ++  +A +    E +      +  IE FL +   I +  ++DGY
Sbjct: 151 ADGIAAGKGVLIPTTQEEAQEALKIIMVERQFGDAGKSVVIEEFL-EGDEISILTISDGY 209

>KLLA0F05489g 541146..542471 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 homocitrate
           synthase, start by similarity
          Length = 441

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G + +GI D  G   P     L+ ++++      I  H H+  G A+A+ 
Sbjct: 182 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 240

Query: 775 AACAFAGADVVDVA 788
                 GA ++DVA
Sbjct: 241 YTALEGGARLIDVA 254

>AGR127C [4438] [Homologous to ScYDR062W (LCB2) - SH]
           (992732..994420) [1689 bp, 562 aa]
          Length = 562

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 693 EATICYSGDMLQSGKKYNLDYYLEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRA 752
           E T+C    +++  KKY    Y++    I AMG H  G+ D  G + P+   +L+G++  
Sbjct: 307 EGTMCNLPKLIELKKKYKCYLYVDEAHSIGAMGPHGRGVCDYFG-VDPTEVDILMGTLTK 365

Query: 753 KY 754
            +
Sbjct: 366 SF 367

>YDL131W (LYS21) [738] chr4 (227393..228715) Homocitrate synthase
           isoenzyme, involved in lysine metabolism [1323 bp, 440
           aa]
          Length = 440

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G + +GI D  G   P     LI ++++      I  H H+  G A+A+ 
Sbjct: 180 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 238

Query: 775 AACAFAGADVVDVA 788
                 GA ++DV+
Sbjct: 239 YTALEGGARLIDVS 252

>CAGL0J09240g 911669..912982 highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, start by
           similarity
          Length = 437

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G + +GI D  G   P     L+ ++++      I  H H+  G A+A+ 
Sbjct: 177 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 235

Query: 775 AACAFAGADVVDVA 788
                 GA ++DV+
Sbjct: 236 YTALEGGAKLIDVS 249

>YJR109C (CPA2) [3001] chr10 complement(629500..632856)
           Carbamoylphosphate synthetase of arginine biosynthetic
           pathway, synthetase (large) subunit [3357 bp, 1118 aa]
          Length = 1118

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 67/173 (38%), Gaps = 5/173 (2%)

Query: 156 IDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTC 215
           + SVEEA+ F ++  YPV+I+ ++             +++      A+  +     +   
Sbjct: 714 LTSVEEAKLFASKVNYPVLIRPSYVLSGAAMSVVNNEEELKAKLTLASDVSP----DHPV 769

Query: 216 FIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVE-VAPAKTLPKDVRDAIL 274
            + +F+   + I+V  +A     +VH           H      V P + L  DV+ A+ 
Sbjct: 770 VMSKFIEGAQEIDVDAVAYNGNVLVHAISEHVENAGVHSGDASLVLPPQHLSDDVKIALK 829

Query: 275 TDAVKLASVANYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIV 327
             A K+A           + + D ++    IE N R         ++ G++ +
Sbjct: 830 DIADKVAKAWKITGPFNMQIIKDGEHTLKVIECNIRASRSFPFVSKVLGVNFI 882

>Scas_704.3
          Length = 438

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G + +GI D  G   P     L+ ++++      I  H H+  G A+A+ 
Sbjct: 179 LNIYKTVNKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 237

Query: 775 AACAFAGADVVDVA 788
                 GA ++DV+
Sbjct: 238 YTALEGGARLIDVS 251

>CAGL0J06402g complement(608851..610146) highly similar to sp|Q12122
           Saccharomyces cerevisiae YDL131w LYS21 or sp|P48570
           Saccharomyces cerevisiae YDL182w LYS20, hypothetical
           start
          Length = 431

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G + +GI D  G   P     L+ ++++      I  H H+  G A+A+ 
Sbjct: 165 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKS-VVSCDIECHFHNDTGCAIANA 223

Query: 775 AACAFAGADVVDVA 788
                 GA ++DV+
Sbjct: 224 YTALEGGAKLIDVS 237

>YDL182W (LYS20) [690] chr4 (133438..134724) Homocitrate synthase
           isoenzyme, involved in lysine biosynthesis [1287 bp, 428
           aa]
          Length = 428

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 715 LEITDKIVAMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASM 774
           L I   +  +G + +GI D  G   P     LI ++++      I  H H+  G A+A+ 
Sbjct: 166 LNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKS-VVSCDIECHFHNDTGCAIANA 224

Query: 775 AACAFAGADVVDVA 788
                 GA ++DV+
Sbjct: 225 YTALEGGARLIDVS 238

>Sklu_2433.7 YGL234W, Contig c2433 9525-11915
          Length = 796

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 51/122 (41%), Gaps = 3/122 (2%)

Query: 115 EAGITWIGPSAEVIDSVGDKVSARNLAAKANVPVVPGTPGPIDSVEEAQAFVAEYGYPVI 174
           + GI   GPSA+     G K  +++  AK N+P            E+A++++    + V+
Sbjct: 92  KVGIPVFGPSAKAAAFEGSKTFSKDFMAKHNIPTA--AYANFSDYEKAKSYLDTVDHQVV 149

Query: 175 IKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEVQLLAD 234
           +KA               ++  +A +    E +      +  IE FL +   I +  ++D
Sbjct: 150 LKADGIAAGKGVLIPTTKEEAQEALKTIMVEKQFGSAGESVVIEEFL-EGDEISILTISD 208

Query: 235 GY 236
           GY
Sbjct: 209 GY 210

>Scas_698.17
          Length = 711

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 8/62 (12%)

Query: 232 LADGYGNVVHLFERDC--------SVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLASV 283
           L++G+   +H+ E D         S+ R +QK++E +    + K   DA+  D  K  + 
Sbjct: 320 LSNGFNKFIHIIETDIKNLQLQNDSIYRNYQKLIEKSEQLKISKQKNDALNNDLTKFQNY 379

Query: 284 AN 285
            N
Sbjct: 380 IN 381

>Sklu_2413.4 YJR109C, Contig c2413 10886-14254
          Length = 1122

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 34/176 (19%), Positives = 68/176 (38%), Gaps = 8/176 (4%)

Query: 156 IDSVEEAQAFVAEYGYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTC 215
           + SV EA+ F ++ GYPV+I+ ++             D++      A+  +     +   
Sbjct: 717 LTSVNEAKIFASKVGYPVLIRPSYVLSGAAMSVVNSEDELEVKLTNASDVSP----DHPV 772

Query: 216 FIERFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVE-VAPAKTLPKDVRDAIL 274
            I +F+   + I+V  +A     +VH           H      + P + L ++ +  + 
Sbjct: 773 VISKFIEGAQEIDVDAVAYDGKVLVHAISEHVENAGVHSGDASLILPPQHLSEETKQRLK 832

Query: 275 TDAVKLASVANYKNAGTAEFLVDDQNRHY---FIEINPRIQVEHTITEEITGIDIV 327
             A K+A   N       + + DD++       IE N R         ++ GI+ +
Sbjct: 833 DIADKVAKAWNICGPFNMQIIKDDRDHGTSLKVIECNIRASRSFPFVSKVLGINFI 888

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 41/221 (18%), Positives = 92/221 (41%), Gaps = 27/221 (12%)

Query: 114 EEAGITWIGPSAEVIDSVGDKVSARNLAAKA----NVPVVPGTPGPIDSVEEAQAFVAEY 169
           E+ G+  +G   + +++  D    R+L A+A    N+P+        +++++A    A+ 
Sbjct: 133 EKYGVKVLGTPIKTLETSED----RDLFAQALKEINIPIAESFA--CETIDQALEAAAKV 186

Query: 170 GYPVIIKAAFXXXXXXXXXXXXXDDIADAFQRATSEAKTSFGNGTCFIERFLNKPKHIEV 229
            YPVI+++A+              ++ +   ++ S A          +E+ L   K IE 
Sbjct: 187 KYPVIVRSAYALGGLGSGFANDEQEMKELASQSLSLAP------QILVEKSLKGWKEIEY 240

Query: 230 QLLADGYGNVVHLFERDCSVQR------RHQKVVEVAPAKTLPKDVRDAILTDAVKLASV 283
           +++ D  GN + +    C+++            +  AP++TL  +    + + A+K+   
Sbjct: 241 EVVRDRVGNCITV----CNMENFDPLGIHTGDSIVFAPSQTLSDEEFHMLRSAAIKIIRH 296

Query: 284 ANYKNAGTAEFLVDDQNRHY-FIEINPRIQVEHTITEEITG 323
                    ++ +      Y  IE+N R+     +  + TG
Sbjct: 297 LGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATG 337

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 35,029,040
Number of extensions: 1462425
Number of successful extensions: 3725
Number of sequences better than 10.0: 62
Number of HSP's gapped: 3715
Number of HSP's successfully gapped: 94
Length of query: 1157
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1044
Effective length of database: 12,684,275
Effective search space: 13242383100
Effective search space used: 13242383100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)