Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.178936335919010.0
Sklu_2171.436236116470.0
KLLA0F09603g35433316450.0
AAR167C35935916320.0
Scas_686.2241633116260.0
YBR221C (PDB1)36633716050.0
CAGL0K06831g35833115960.0
Sklu_2101.356869663.0
Sklu_2244.235262653.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1789
         (359 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1789                                                          736   0.0  
Sklu_2171.4 YBR221C, Contig c2171 8787-9875                           639   0.0  
KLLA0F09603g complement(882778..883842) highly similar to sp|P32...   638   0.0  
AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH] (642620..643...   633   0.0  
Scas_686.22                                                           630   0.0  
YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate de...   622   0.0  
CAGL0K06831g complement(665672..666748) highly similar to sp|P32...   619   0.0  
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                            30   3.0  
Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement         30   3.8  

>Kwal_14.1789
          Length = 363

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/359 (100%), Positives = 359/359 (100%)

Query: 1   MAFKFSTGVISGAKQMLMGAGRAGTLSRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIG 60
           MAFKFSTGVISGAKQMLMGAGRAGTLSRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIG
Sbjct: 1   MAFKFSTGVISGAKQMLMGAGRAGTLSRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIG 60

Query: 61  EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSM 120
           EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSM
Sbjct: 61  EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSM 120

Query: 121 QAIDQVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVP 180
           QAIDQVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVP
Sbjct: 121 QAIDQVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVP 180

Query: 181 YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEECLSTDFTLPYTAKVEREGTDIS 240
           YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEECLSTDFTLPYTAKVEREGTDIS
Sbjct: 181 YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEECLSTDFTLPYTAKVEREGTDIS 240

Query: 241 IITYTRNVQFSLQAAEILDKQYGVSAEVINLRSIRPMDVNAIIKTVKKTNHLITVESTFP 300
           IITYTRNVQFSLQAAEILDKQYGVSAEVINLRSIRPMDVNAIIKTVKKTNHLITVESTFP
Sbjct: 241 IITYTRNVQFSLQAAEILDKQYGVSAEVINLRSIRPMDVNAIIKTVKKTNHLITVESTFP 300

Query: 301 NFGVGSEIVAQIMESEAFDYLDAPVKRVTGADVPTPYAKELEDFAFPDPDVIVSAVKSV 359
           NFGVGSEIVAQIMESEAFDYLDAPVKRVTGADVPTPYAKELEDFAFPDPDVIVSAVKSV
Sbjct: 301 NFGVGSEIVAQIMESEAFDYLDAPVKRVTGADVPTPYAKELEDFAFPDPDVIVSAVKSV 359

>Sklu_2171.4 YBR221C, Contig c2171 8787-9875
          Length = 362

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/361 (86%), Positives = 333/361 (92%), Gaps = 5/361 (1%)

Query: 1   MAFKFSTGVISGAKQMLMGAGRAGTLSRRLASTKT--MTVRDALNSAMAEEMDRDDDVFI 58
           M+  FS  V   AK   + A      + R+ASTKT  MTVR+ALNSAMAEE+DRDDDVFI
Sbjct: 1   MSSTFSAAVARTAK---LAAAPFRLNATRMASTKTTKMTVREALNSAMAEELDRDDDVFI 57

Query: 59  IGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLSVGAALKGLKPIVEFMSFNF 118
           IGEEVAQYNGAYKVTKGLLDR+GERRVVDTPITEMGFTGL+VGAALKGLKP+VEFMSFNF
Sbjct: 58  IGEEVAQYNGAYKVTKGLLDRYGERRVVDTPITEMGFTGLAVGAALKGLKPVVEFMSFNF 117

Query: 119 SMQAIDQVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVL 178
           SMQAID VVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQD++AWYGSIPG+KVL
Sbjct: 118 SMQAIDHVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDYTAWYGSIPGLKVL 177

Query: 179 VPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEECLSTDFTLPYTAKVEREGTD 238
            PYSAEDARGLLKAAIRDPNPVVFLENELLYGESF+VSEE LSTDFTLPYTAKVEREG+D
Sbjct: 178 SPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFDVSEEVLSTDFTLPYTAKVEREGSD 237

Query: 239 ISIITYTRNVQFSLQAAEILDKQYGVSAEVINLRSIRPMDVNAIIKTVKKTNHLITVEST 298
           ISI+TYTRNVQFSLQAAEIL+KQ+GVS EV+NLRSIRP+DV+AIIKTVKKTNHLITVEST
Sbjct: 238 ISIVTYTRNVQFSLQAAEILEKQHGVSVEVVNLRSIRPLDVDAIIKTVKKTNHLITVEST 297

Query: 299 FPNFGVGSEIVAQIMESEAFDYLDAPVKRVTGADVPTPYAKELEDFAFPDPDVIVSAVKS 358
           FP FGVGSEI+AQIMESEAFDYLDAPV+RVTGADVPTPYAKELEDFAFPDPD IV AVK 
Sbjct: 298 FPAFGVGSEIIAQIMESEAFDYLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAVKK 357

Query: 359 V 359
           V
Sbjct: 358 V 358

>KLLA0F09603g complement(882778..883842) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c PDB1 pyruvate
           dehydrogenase (lipoamide) beta chain precursor
           singleton, start by similarity
          Length = 354

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/333 (90%), Positives = 321/333 (96%)

Query: 27  SRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVV 86
           S R ASTKTMTVR+ALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVV
Sbjct: 18  SMRFASTKTMTVREALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVV 77

Query: 87  DTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQKCQIV 146
           DTPITEMGFTGL+VGAALKGLKPIVEFMSFNFSMQA+DQV+NSAAKTYYMSGGTQKCQIV
Sbjct: 78  DTPITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAMDQVINSAAKTYYMSGGTQKCQIV 137

Query: 147 FRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENE 206
           FRGPNG+AVGV AQHSQD+SAWYGS+PGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENE
Sbjct: 138 FRGPNGSAVGVAAQHSQDYSAWYGSVPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENE 197

Query: 207 LLYGESFEVSEECLSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQYGVSA 266
           LLYG+SFEVSEE LSTDFTLPY AKVEREG+DISII+YTRNVQFSL+AAEIL KQYGVSA
Sbjct: 198 LLYGQSFEVSEESLSTDFTLPYKAKVEREGSDISIISYTRNVQFSLEAAEILSKQYGVSA 257

Query: 267 EVINLRSIRPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLDAPVK 326
           EVINLR+IRP+DV AII TVKKTNHLITVESTFP FGVG+EI+AQIMESEAFDYLDAP++
Sbjct: 258 EVINLRAIRPLDVEAIINTVKKTNHLITVESTFPAFGVGAEIIAQIMESEAFDYLDAPIQ 317

Query: 327 RVTGADVPTPYAKELEDFAFPDPDVIVSAVKSV 359
           RVTGA+VPTPYAKELEDFAFPDPD IV A KSV
Sbjct: 318 RVTGAEVPTPYAKELEDFAFPDPDTIVRAAKSV 350

>AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH]
           (642620..643699) [1080 bp, 359 aa]
          Length = 359

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/359 (85%), Positives = 329/359 (91%), Gaps = 4/359 (1%)

Query: 1   MAFKFSTGVISGAKQMLMGAGRAGTLSRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIG 60
           M+ +FS  ++S   + L   GR   +  R AS+K+MTVRDALNSAMAEEMDRDDDVFIIG
Sbjct: 1   MSSRFS--LVSNLTRSLSSVGRMQQM--RFASSKSMTVRDALNSAMAEEMDRDDDVFIIG 56

Query: 61  EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSM 120
           EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGF GL+VGAALKGLKPIVEFMSFNFSM
Sbjct: 57  EEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFAGLAVGAALKGLKPIVEFMSFNFSM 116

Query: 121 QAIDQVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVP 180
           QAID VVNSAAKTYYMSGG Q CQIVFRGPNGAAVGV AQHSQD++AWYGSIPG+KVL P
Sbjct: 117 QAIDHVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTAWYGSIPGLKVLCP 176

Query: 181 YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEECLSTDFTLPYTAKVEREGTDIS 240
           YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEE LS DFTLPYT+KVEREGTDIS
Sbjct: 177 YSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTLPYTSKVEREGTDIS 236

Query: 241 IITYTRNVQFSLQAAEILDKQYGVSAEVINLRSIRPMDVNAIIKTVKKTNHLITVESTFP 300
           IITY+RNVQFSL AAEILDKQYGVSAEVIN+RSIRP+D++AIIKTVKKTNHLITVE+TFP
Sbjct: 237 IITYSRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKTVKKTNHLITVEATFP 296

Query: 301 NFGVGSEIVAQIMESEAFDYLDAPVKRVTGADVPTPYAKELEDFAFPDPDVIVSAVKSV 359
            FGVGSEI+AQIMESEAFD+LDAPV+RVTGADVPTPYAKELEDFAFPDPD IV A K V
Sbjct: 297 AFGVGSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDFAFPDPDTIVRAAKQV 355

>Scas_686.22
          Length = 416

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/331 (90%), Positives = 321/331 (96%)

Query: 29  RLASTKTMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT 88
           R AS+KTMTVR+ALN+AMAEE+DRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT
Sbjct: 82  RYASSKTMTVREALNTAMAEELDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT 141

Query: 89  PITEMGFTGLSVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQKCQIVFR 148
           PITEMGFTGL+VGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKT+YMSGGTQKCQIVFR
Sbjct: 142 PITEMGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTHYMSGGTQKCQIVFR 201

Query: 149 GPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELL 208
           GPNG+AVGV AQHSQD+SAWYGSIPG+KVLVPYSAEDARGLLKAAIRDPNPVVFLENELL
Sbjct: 202 GPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELL 261

Query: 209 YGESFEVSEECLSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQYGVSAEV 268
           YGESFE+S+E LS DFTLPY AKVEREGTDISIITYTRNVQFSL+AA IL+KQYGVS EV
Sbjct: 262 YGESFEISDEALSPDFTLPYKAKVEREGTDISIITYTRNVQFSLEAAAILEKQYGVSVEV 321

Query: 269 INLRSIRPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLDAPVKRV 328
           INLRSIRP+DV+AI+KTVKKTNHLITVESTFP+FGVG+EI+A++MESEAFDYLDAP++RV
Sbjct: 322 INLRSIRPLDVDAIVKTVKKTNHLITVESTFPSFGVGAEIIARVMESEAFDYLDAPIQRV 381

Query: 329 TGADVPTPYAKELEDFAFPDPDVIVSAVKSV 359
           TGADVPTPYAKELEDFAFPDPD IV AVK V
Sbjct: 382 TGADVPTPYAKELEDFAFPDPDTIVRAVKEV 412

>YBR221C (PDB1) [402] chr2 complement(665110..666210) Pyruvate
           dehydrogenase complex, E1-beta subunit
           (pyruvate:lipoamide 2-oxidoreductase) [1101 bp, 366 aa]
          Length = 366

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/337 (87%), Positives = 318/337 (94%)

Query: 23  AGTLSRRLASTKTMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGE 82
           A   + R +STKTMTVR+ALNSAMAEE+DRDDDVF+IGEEVAQYNGAYKV+KGLLDRFGE
Sbjct: 26  AAAAALRFSSTKTMTVREALNSAMAEELDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGE 85

Query: 83  RRVVDTPITEMGFTGLSVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQK 142
           RRVVDTPITE GFTGL+VGAALKGLKPIVEFMSFNFSMQAID VVNSAAKT+YMSGGTQK
Sbjct: 86  RRVVDTPITEYGFTGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQK 145

Query: 143 CQIVFRGPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVF 202
           CQ+VFRGPNGAAVGVGAQHSQDFS WYGSIPG+KVLVPYSAEDARGLLKAAIRDPNPVVF
Sbjct: 146 CQMVFRGPNGAAVGVGAQHSQDFSPWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVF 205

Query: 203 LENELLYGESFEVSEECLSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQY 262
           LENELLYGESFE+SEE LS +FTLPY AK+EREGTDISI+TYTRNVQFSL+AAEIL K+Y
Sbjct: 206 LENELLYGESFEISEEALSPEFTLPYKAKIEREGTDISIVTYTRNVQFSLEAAEILQKKY 265

Query: 263 GVSAEVINLRSIRPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLD 322
           GVSAEVINLRSIRP+D  AIIKTVKKTNHLITVESTFP+FGVG+EIVAQ+MESEAFDYLD
Sbjct: 266 GVSAEVINLRSIRPLDTEAIIKTVKKTNHLITVESTFPSFGVGAEIVAQVMESEAFDYLD 325

Query: 323 APVKRVTGADVPTPYAKELEDFAFPDPDVIVSAVKSV 359
           AP++RVTGADVPTPYAKELEDFAFPD   IV AVK V
Sbjct: 326 APIQRVTGADVPTPYAKELEDFAFPDTPTIVKAVKEV 362

>CAGL0K06831g complement(665672..666748) highly similar to sp|P32473
           Saccharomyces cerevisiae YBR221c Pyruvate dehydrogenase,
           hypothetical start
          Length = 358

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/331 (87%), Positives = 317/331 (95%)

Query: 29  RLASTKTMTVRDALNSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT 88
           R+ASTKTMTVR+ALNSA+AEE+DRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT
Sbjct: 24  RMASTKTMTVREALNSALAEELDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDT 83

Query: 89  PITEMGFTGLSVGAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQKCQIVFR 148
           PITE GF GL+VGAALKGLKPIVEFMSFNFSMQAID VVNSAAKT+YMSGGTQKCQIVFR
Sbjct: 84  PITEYGFAGLAVGAALKGLKPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQKCQIVFR 143

Query: 149 GPNGAAVGVGAQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELL 208
           GPNG+AVGV AQHSQD+SAWYGSIPG+KVLVPYSAEDARGLLKAAIRDPNPVVFLENELL
Sbjct: 144 GPNGSAVGVAAQHSQDYSAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELL 203

Query: 209 YGESFEVSEECLSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQYGVSAEV 268
           YGE FEVSEE LS DFTLPYTAKVE+EG DISIITYTRN +FSL AA+IL+++YGVSAEV
Sbjct: 204 YGEQFEVSEEALSPDFTLPYTAKVEKEGKDISIITYTRNTEFSLAAAKILEEKYGVSAEV 263

Query: 269 INLRSIRPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLDAPVKRV 328
           INLRSIRP+D++AI+KTVKKTNHLITVESTFP+FGVG+EI+AQ+MESEAFDYLDAP++RV
Sbjct: 264 INLRSIRPLDIDAIVKTVKKTNHLITVESTFPSFGVGAEIIAQVMESEAFDYLDAPIQRV 323

Query: 329 TGADVPTPYAKELEDFAFPDPDVIVSAVKSV 359
           TGADVPTPYAKELEDFAFPDP+ IV A K V
Sbjct: 324 TGADVPTPYAKELEDFAFPDPETIVRAAKEV 354

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 177 VLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEECLSTDFTLPYTAKVEREG 236
           +L+P+ +ED++G+L   I D   + F+E E ++   F+        D  LP    +    
Sbjct: 194 LLIPHRSEDSQGMLDPIIND-QTIRFIEEEGVHAWEFQ-------PDPNLPNDTILIENK 245

Query: 237 TDISIITYT 245
           T+I+ + Y 
Sbjct: 246 TEITFLNYN 254

>Sklu_2244.2 YOL151W, Contig c2244 1821-2879 reverse complement
          Length = 352

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 297 STFPNFGVGSEIVAQIMESEAFDYLDAPVKRVTGADVPT--PYAKELEDFAFPDPDVIVS 354
           S F N  +  EIV  I E +AFD++ A   +     + T  P+  E +DF   D D+++ 
Sbjct: 52  SQFSNSNLSMEIVPNIAEPDAFDHIFAKYAKDIKVVLHTASPFFFESKDF---DKDLLIP 108

Query: 355 AV 356
           AV
Sbjct: 109 AV 110

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,701,120
Number of extensions: 433603
Number of successful extensions: 1125
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1146
Number of HSP's successfully gapped: 9
Length of query: 359
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 256
Effective length of database: 13,030,455
Effective search space: 3335796480
Effective search space used: 3335796480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)