Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.153784283039390.0
KLLA0A03069g89584226320.0
AEL297W89583426080.0
CAGL0I04224g94286525680.0
YGL163C (RAD54)89884525030.0
Scas_668.1887548120490.0
KLLA0F11814g9314958861e-105
Kwal_27.105139005038821e-105
YBR073W (RDH54)9245148591e-101
CAGL0M01958g9205138501e-100
AGL212W9034908481e-100
Scas_718.409264938401e-98
KLLA0E22726g10335096941e-77
Sklu_2125.310525096915e-77
CAGL0I01694g10715136891e-76
AEL065C10255096763e-75
Scas_549.410795146671e-73
YJR035W (RAD26)10855156573e-72
Kwal_34.160827264705739e-63
CAGL0C01683g11154845841e-62
YOR304W (ISW2)11204875831e-62
Scas_662.713424755691e-60
Kwal_56.2344214354705682e-60
Scas_652.1710254875633e-60
Scas_576.614574765647e-60
YER164W (CHD1)14684765648e-60
Scas_665.1710604855601e-59
KLLA0F24838g10624835601e-59
CAGL0I09614g10394865591e-59
Kwal_34.1592510254775554e-59
CAGL0L11770g14764785541e-58
CAGL0M04807g17304795532e-58
Kwal_14.160011024835512e-58
KLLA0C17578g15254755523e-58
AER375C12884755504e-58
AFR562C14444795488e-58
YAL019W (FUN30)11315305478e-58
Kwal_26.916414544925471e-57
Kwal_23.477713014755452e-57
YOR290C (SNF2)17034775443e-57
Scas_548.410545315404e-57
KLLA0F04521g13444795415e-57
Scas_594.717034815391e-56
Scas_597.810654855352e-56
ACR286C10195275333e-56
KLLA0B08327g15344865363e-56
AFR537W10254825315e-56
KLLA0F07513g10485185316e-56
AFL040W10864875282e-55
CAGL0G08756g13544875282e-55
YIL126W (STH1)13594755231e-54
Scas_520.58635205162e-54
KLLA0F06710g10964855202e-54
AGR123C14224765203e-54
KLLA0E23804g18735115203e-54
YBR245C (ISW1)11294835175e-54
CAGL0H06193g11265285167e-54
CAGL0H05533g19045245151e-53
Scas_664.918595165142e-53
ADL098C8045135062e-53
Kwal_26.712310815395112e-53
CAGL0J02662g8445155063e-53
AEL256C18665105123e-53
KLLA0E04048g8265225011e-52
YPL082C (MOT1)18675235035e-52
YFR038W8535274941e-51
Kwal_47.180778095144752e-49
KLLA0E08965g14893773031e-27
Scas_669.2013973063012e-27
Kwal_27.1138813343073002e-27
Kwal_55.2014314943062993e-27
ADR309W14863032967e-27
Scas_646.3*14563032931e-26
CAGL0E05038g14843172922e-26
Sklu_1582.22831512706e-26
CAGL0M01188g14503002886e-26
YGL150C (INO80)14893092879e-26
AGR379W14143092832e-25
YDR334W15141462805e-25
KLLA0F21758g15723062806e-25
AAR147W15801842458e-21
AFR220W10851882261e-18
KLLA0F17479g11141612134e-17
CAGL0A03432g11511532126e-17
Kwal_47.177719721332118e-17
Kwal_23.36607681272081e-16
CAGL0K07766g8301532072e-16
ADL345C7461272062e-16
Scas_591.107721532062e-16
Scas_721.10011371532054e-16
Kwal_14.186813571462037e-16
KLLA0C05368g16051332037e-16
YBR114W (RAD16)7901492028e-16
KLLA0B09240g8001272011e-15
CAGL0G09493g14081452001e-15
Scas_674.12d13231392002e-15
YLR032W (RAD5)11691341974e-15
Sklu_2412.711271731939e-15
YOR191W (RIS1)16191441902e-14
AAL030C15391231365e-08
YLR247C15561311303e-07
Kwal_14.128715181171303e-07
Scas_573.91502651222e-06
CAGL0B05049g1470631223e-06
KLLA0F12166g15281231171e-05
Sklu_2432.9147561960.003
Sklu_2234.2100663950.004
KLLA0F23716g554112850.049
Kwal_26.847042561770.47
KLLA0D08932g278100750.65
KLLA0C01210g49629693.6
CAGL0C03399g47833684.7
YNR038W (DBP6)629145685.3
Scas_588.1669356686.1
AAL069C66568676.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1537
         (830 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1537                                                         1521   0.0  
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...  1018   0.0  
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...  1009   0.0  
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...   993   0.0  
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...   968   0.0  
Scas_668.18                                                           793   0.0  
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   345   e-105
Kwal_27.10513                                                         344   e-105
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   335   e-101
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   332   e-100
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   331   e-100
Scas_718.40                                                           328   1e-98
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   271   1e-77
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           270   5e-77
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   270   1e-76
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   265   3e-75
Scas_549.4                                                            261   1e-73
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   257   3e-72
Kwal_34.16082                                                         225   9e-63
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   229   1e-62
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   229   1e-62
Scas_662.7                                                            223   1e-60
Kwal_56.23442                                                         223   2e-60
Scas_652.17                                                           221   3e-60
Scas_576.6                                                            221   7e-60
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...   221   8e-60
Scas_665.17                                                           220   1e-59
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   220   1e-59
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   219   1e-59
Kwal_34.15925                                                         218   4e-59
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...   218   1e-58
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   217   2e-58
Kwal_14.1600                                                          216   2e-58
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...   217   3e-58
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   216   4e-58
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   215   8e-58
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   215   8e-58
Kwal_26.9164                                                          215   1e-57
Kwal_23.4777                                                          214   2e-57
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   214   3e-57
Scas_548.4                                                            212   4e-57
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   213   5e-57
Scas_594.7                                                            212   1e-56
Scas_597.8                                                            210   2e-56
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   209   3e-56
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   211   3e-56
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   209   5e-56
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   209   6e-56
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   207   2e-55
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   207   2e-55
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   206   1e-54
Scas_520.5                                                            203   2e-54
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   204   2e-54
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...   204   3e-54
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   204   3e-54
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   203   5e-54
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   203   7e-54
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   202   1e-53
Scas_664.9                                                            202   2e-53
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   199   2e-53
Kwal_26.7123                                                          201   2e-53
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   199   3e-53
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   201   3e-53
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   197   1e-52
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   198   5e-52
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   194   1e-51
Kwal_47.18077                                                         187   2e-49
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   121   1e-27
Scas_669.20                                                           120   2e-27
Kwal_27.11388                                                         120   2e-27
Kwal_55.20143                                                         119   3e-27
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   118   7e-27
Scas_646.3*                                                           117   1e-26
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   117   2e-26
Sklu_1582.2 , Contig c1582 197-1048                                   108   6e-26
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   115   6e-26
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   115   9e-26
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   113   2e-25
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   112   5e-25
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   112   6e-25
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    99   8e-21
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    92   1e-18
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    87   4e-17
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    86   6e-17
Kwal_47.17771                                                          86   8e-17
Kwal_23.3660                                                           85   1e-16
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    84   2e-16
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    84   2e-16
Scas_591.10                                                            84   2e-16
Scas_721.100                                                           84   4e-16
Kwal_14.1868                                                           83   7e-16
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    83   7e-16
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    82   8e-16
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    82   1e-15
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    82   1e-15
Scas_674.12d                                                           82   2e-15
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    80   4e-15
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          79   9e-15
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    78   2e-14
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    57   5e-08
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    55   3e-07
Kwal_14.1287                                                           55   3e-07
Scas_573.9                                                             52   2e-06
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    52   3e-06
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    50   1e-05
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              42   0.003
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         41   0.004
KLLA0F23716g join(complement(2216857..2218129), some similaritie...    37   0.049
Kwal_26.8470                                                           34   0.47 
KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces c...    33   0.65 
KLLA0C01210g complement(93918..95408) some similarities with sp|...    31   3.6  
CAGL0C03399g 341755..343191 similar to sp|P39008 Saccharomyces c...    31   4.7  
YNR038W (DBP6) [4622] chr14 (695594..697483) Putative RNA helica...    31   5.3  
Scas_588.16                                                            31   6.1  
AAL069C [118] [Homologous to ScYDR295C (PLO2) - SH] (226816..228...    30   6.5  

>Kwal_14.1537
          Length = 842

 Score = 1521 bits (3939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 754/830 (90%), Positives = 754/830 (90%)

Query: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLEXXXXXXXXXXXI 60
           MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLE           I
Sbjct: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLEPNCAANPANAAI 60

Query: 61  GKRTTRSKTHVYELTETAPEFEHSESESGLKRAKRPDALSARRLSRDPDRLRKIDSLLRR 120
           GKRTTRSKTHVYELTETAPEFEHSESESGLKRAKRPDALSARRLSRDPDRLRKIDSLLRR
Sbjct: 61  GKRTTRSKTHVYELTETAPEFEHSESESGLKRAKRPDALSARRLSRDPDRLRKIDSLLRR 120

Query: 121 SFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPTPELLIQMX 180
           SFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPTPELLIQM 
Sbjct: 121 SFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPTPELLIQMR 180

Query: 181 XXXXXXXXXXXXXXXXXXTRATQLXXXXXXXXXXXXXXKKLSNGLPNKTLRELLGDRQVD 240
                             TRATQL              KKLSNGLPNKTLRELLGDRQVD
Sbjct: 181 SQLPKSSSASALSKPRGSTRATQLSPTPPPPSPHPSHPKKLSNGLPNKTLRELLGDRQVD 240

Query: 241 EKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKXXXXXXXXXXXXXXXTTSKEQ 300
           EKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMK               TTSKEQ
Sbjct: 241 EKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKDYLDQQALLQNADAATTSKEQ 300

Query: 301 TPPADHXXXXXXXXXXXXXXXXXHTLTSDEKLPNQELDTPAPTDESSSEVSQNRGAYGCI 360
           TPPADH                 HTLTSDEKLPNQELDTPAPTDESSSEVSQNRGAYGCI
Sbjct: 301 TPPADHLPSPPAELLPSPPADPAHTLTSDEKLPNQELDTPAPTDESSSEVSQNRGAYGCI 360

Query: 361 MADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTLA 420
           MADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTLA
Sbjct: 361 MADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTLA 420

Query: 421 SLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLA 480
           SLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLA
Sbjct: 421 SLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLA 480

Query: 481 DEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRR 540
           DEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRR
Sbjct: 481 DEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRR 540

Query: 541 NFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVN 600
           NFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVN
Sbjct: 541 NFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVN 600

Query: 601 LKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDV 660
           LKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDV
Sbjct: 601 LKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDV 660

Query: 661 IPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERM 720
           IPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERM
Sbjct: 661 IPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERM 720

Query: 721 CRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMD 780
           CRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMD
Sbjct: 721 CRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMD 780

Query: 781 PDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           PDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS
Sbjct: 781 PDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/842 (62%), Positives = 617/842 (73%), Gaps = 55/842 (6%)

Query: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLEXXXXXXXXXXXI 60
           MARR+LPDRPPNGIGAG RP+LRPR+LD+  A  TLT+PFKVP +               
Sbjct: 1   MARRRLPDRPPNGIGAGARPNLRPRRLDTNQALETLTKPFKVPFK-----VNKTDHAKRY 55

Query: 61  GKRTTRSKTHVYELTETAPEFEHSESESGLKRAKRPDALSARRLSRDPDRLRKIDSLLRR 120
           G R++R     Y   +       S  +S L   KR DALS  RL+ +P RL  I S LRR
Sbjct: 56  GVRSSRRSQTTYANMD-------SSLDSDL-HVKRKDALSLSRLNAEPSRLDTIYSTLRR 107

Query: 121 SFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPTPELLIQMX 180
           SFTVPIKGYVPRHNIP++LGTK K+V+ PRPLHDPT+E AIVLYDP+VDG  PE    + 
Sbjct: 108 SFTVPIKGYVPRHNIPMALGTKAKVVIPPRPLHDPTDELAIVLYDPTVDGDIPEQHEDLE 167

Query: 181 XXXXXXXXXXXXXXXXXXTRATQLXXXXXXXXXXXXXX-KKLSNGLPNKTLRELLGDRQ- 238
                                 Q                K LSNG+ NKTL+ELLG  + 
Sbjct: 168 SFRQNAVDTKKSQKGKDSESQDQKAKESSPNSAPSIHHPKMLSNGVKNKTLKELLGSSED 227

Query: 239 -VDEKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKXXXXXXXXXXXXXXXTTS 297
              +KF +VPVVIDP L KILRPHQVEGVRFLYRCVTGLVMK                +S
Sbjct: 228 NTSKKFPNVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDAKTVL------DSS 281

Query: 298 KEQTPPADHXXXXXXXXXXXXXXXXXHTLTSDEKLPNQELDTPAPTDESS-------SEV 350
            +    AD                      +D  +   +  +P  TD SS       +E 
Sbjct: 282 SQSMEKAD--------------------TQADSNITGSK--SPVETDVSSLKDVIKINEN 319

Query: 351 SQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEI 410
           S+NRGAYGCIMADEMGLGKTLQC+AL+WT+L+QGPQG+ +IDKCIIVCPSSLVNNWANEI
Sbjct: 320 SRNRGAYGCIMADEMGLGKTLQCLALMWTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEI 379

Query: 411 VKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHL 470
            KWLG G+L+SL IDGKKSSLNNG VA +V  WA A+GR++VKPVLIISY+TLRRNVE L
Sbjct: 380 DKWLGPGSLSSLAIDGKKSSLNNGNVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQL 439

Query: 471 NNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 530
            NCE+GL+LADEGHRLKNA+S TFTALDSI CPRRVILSGTPIQNDLSEYFALLNFSNPG
Sbjct: 440 KNCEVGLMLADEGHRLKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPG 499

Query: 531 LLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLP 590
           LLG+R++FR+NFE PIL SRD+ ATD E+  G ++L+ LS IVSKFIIRRTN+IL+KYLP
Sbjct: 500 LLGSRNDFRKNFELPILQSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLP 559

Query: 591 CKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQL 650
           CKYEHV+F+NL PFQ+S+Y+  ++ R VK  VK  +  +QPLK IG LKKLCNHPDLL+L
Sbjct: 560 CKYEHVIFINLTPFQQSLYQHFIESRAVKKIVKGDS--NQPLKAIGLLKKLCNHPDLLEL 617

Query: 651 PEDVEGSEDVIPEDYRNSTLSK--RGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIIS 708
            ED+ GSE++IP+DY++S  S+  R  + +QT +S KFS+L RFL+KIKTES+DKIV+IS
Sbjct: 618 SEDIPGSEELIPDDYQSSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLIS 677

Query: 709 NYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGI 768
           NYTQTLD+IE+MC ++ Y V+RLDGTM INKRQKLVDRFND EGQEFIFLLSSKAGGCGI
Sbjct: 678 NYTQTLDLIEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGI 737

Query: 769 NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMS 828
           NLIGANRLIL+DPDWNPAADQQALARVWRDGQKKDCFIYRFI TGTIEEKI+QRQSMKMS
Sbjct: 738 NLIGANRLILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMS 797

Query: 829 LS 830
           LS
Sbjct: 798 LS 799

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/834 (63%), Positives = 603/834 (72%), Gaps = 39/834 (4%)

Query: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLEXXXXXXXXXXXI 60
           MA+RKLPDRPPNG GAG+RPS+RPR+LDS  A++TLT+PF+VPL                
Sbjct: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNS-----ERTRHGERY 55

Query: 61  GKRTTRSKTHVYELTETAPEFEHSESESGLKRAKRPDALSARRLSRDPDRLRKIDSLLRR 120
           G R TR     Y       E   + SE      KR DALS +R+S+D  RL  I+  LRR
Sbjct: 56  GVRATRRAVTTYA------EEGGARSEENDVGGKRIDALSEQRVSKDAQRLAGIERTLRR 109

Query: 121 SFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPTPELLIQMX 180
           SF+VPIKGYVPRHNIPL+LG K ++V  PRPLHDPTEEFAIVLYDP+VDG  P+   +  
Sbjct: 110 SFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGEIPDETPREE 169

Query: 181 XXXXXXXXXXXXXXXXXXTRATQLXXXXXXXXXXXXXXKKLSNGLPNKTLRELLGDRQVD 240
                               AT                +KLSNGL NKTLRELLG     
Sbjct: 170 PAQKENDGGNEEQARPTRRTATH--------------PEKLSNGLRNKTLRELLGTVTET 215

Query: 241 EKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKXXXXXXXXXXXXXXXTTSKEQ 300
            KF SVPVVIDP L +ILRPHQVEGVRFLYRCVTGL MK                    +
Sbjct: 216 PKFPSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQDDGTGK 275

Query: 301 TPPADHXXXXXXXXXXXXXXXXXHTLTSDEKLPNQELDTPAPTDESSSEVSQNRGAYGCI 360
            P +                       +      + LD  A     S     NRGAYGCI
Sbjct: 276 DPGSKDSEPIVVEVLEETPTPTPTPTPTPSP---EILDANAAMTRES-----NRGAYGCI 327

Query: 361 MADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTLA 420
           MADEMGLGKTLQCIAL+WTLLRQG QG+PTI+KCIIVCPSSLVNNWANEIVKWLG   L+
Sbjct: 328 MADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKWLGPDALS 387

Query: 421 SLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLA 480
            L IDG+KSSL+NG+VAQ+VR WA+A+GR+VVKPVLIISYETLRRNVE+L  C++GL+LA
Sbjct: 388 PLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRNVENLKGCKVGLMLA 447

Query: 481 DEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRR 540
           DEGHRLKN +S TFT+LDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR++FR+
Sbjct: 448 DEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRAQFRK 507

Query: 541 NFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVN 600
           NFE PIL  RDADATD EIA G  KL  LS IVSKFIIRRTNDILSKYLPCKYEH+LFVN
Sbjct: 508 NFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRRTNDILSKYLPCKYEHILFVN 567

Query: 601 LKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDV 660
           L P Q+++YE  ++ R+V   +K   T SQPLK IG LKKLCNHPDLL LP+++ GS ++
Sbjct: 568 LSPMQKAIYEHFVRSREVAKLMKG--TGSQPLKAIGLLKKLCNHPDLLDLPDEIAGSTNL 625

Query: 661 IPEDYRNS-TLSKRG---HAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDV 716
           IP+DY+++ T + RG   H EVQT +S KF+IL RFL KIK ES+DKIV+ISNYTQTLD+
Sbjct: 626 IPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKIKHESNDKIVLISNYTQTLDL 685

Query: 717 IERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRL 776
           IE+MCR + Y V+RLDGTMTINKRQKLVD+FND  G+EFIFLLSSKAGGCGINLIGANRL
Sbjct: 686 IEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLIGANRL 745

Query: 777 ILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           ILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI TG+IEEKI QR SMKMSLS
Sbjct: 746 ILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLS 799

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/865 (61%), Positives = 613/865 (70%), Gaps = 55/865 (6%)

Query: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLEXXXXXXXXXXXI 60
           MARR+LPDRPPNGIGAG+RP L PR ++   + + LT+PFKVP++               
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSDLSR 60

Query: 61  GKRTTRSKTHVYEL---TETAPEFEHSES---ESGLK--RAKRPDALSARRLSRDPDRLR 112
            ++  +    V       ++  E +  E+   E G +  + +R DALSARRL  DP RL 
Sbjct: 61  QRQLRQRSQTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDPTRLD 120

Query: 113 KIDSLLRRSFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPT 172
            I+  L++SF VPIKGYV RH++PL+LGTK K++  PRPLHDPT+EFAIVLYDPSVDG  
Sbjct: 121 TIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSVDG-- 178

Query: 173 PELLIQMXXXXXXXXXXXXXXXXXXXTRATQLXXXXXXXXXXXXXXKKLSNGLPNKTLRE 232
            E++IQ                    +   Q               K LSNG+ NKTL+E
Sbjct: 179 -EMIIQ----------DDTETVQNVQSSEDQNAQEAEAEKSKYKHPKILSNGVKNKTLQE 227

Query: 233 LLGD------RQVDEKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKXXXXXXX 286
           LLG+        + +KFA+VPVVIDP L KILRPHQVEGV+FLYRCVTGLVMK       
Sbjct: 228 LLGNSPFNPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQL 287

Query: 287 XXXXXXXX--------TTSKEQTP----------PADHXXXXXXXXXXXXXXXXXHTLTS 328
                             SKE +P           A++                     +
Sbjct: 288 ASQSSNINFLECSDDDVCSKEVSPIDGGGAHDNSEANNDEAGNAIQNAKKNVKSKKQKKT 347

Query: 329 DEKLPNQELDTPAPTDESSSEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGK 388
             K    E D      +S S    NRGAYGCIMADEMGLGKTLQCIAL+WTLLRQGPQGK
Sbjct: 348 ITKKQQSENDFLEALKKSQS---NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK 404

Query: 389 PTIDKCIIVCPSSLVNNWANEIVKWLGKGTLASLPIDGKKSSLNNG--TVAQAVRGWALA 446
             I KCIIVCPSSLVNNWANE+VKWLG  TL+ L +DGKKSSL +G  +VA+A++ WA A
Sbjct: 405 RLISKCIIVCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQA 464

Query: 447 RGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRV 506
           +GR++VKPVLIISY+TLRRNV+ L N E+GLLLADEGHRLKN +S TFTALDSINCPRRV
Sbjct: 465 QGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRV 524

Query: 507 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKL 566
           ILSGTPIQNDLSEYFALLNFSNPGLLGTR+EFRRNFE PIL SRDADATD+++  G +KL
Sbjct: 525 ILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKL 584

Query: 567 QALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGT 626
           Q LS IVSKFIIRRTNDILSKYLPCKYEHV+FVNL PFQ+ VY +++K RD+K  VK G 
Sbjct: 585 QLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVK-GD 643

Query: 627 TPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDV-IPEDYRNSTLSKRGHAEVQTWYSGK 685
             SQPLK IG LKKLCNHPDL++L E+++   D+ IP+DY   T   R   +VQT +SGK
Sbjct: 644 GGSQPLKAIGVLKKLCNHPDLIKLDEELDNYNDLDIPDDYSIPTGKSR---DVQTQFSGK 700

Query: 686 FSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVD 745
           F+IL RFLHKIKTESDDKIV+ISNYTQTLD+IERMCR   Y  VRLDGTM+INKRQKLVD
Sbjct: 701 FAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVD 760

Query: 746 RFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCF 805
           RFND EGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCF
Sbjct: 761 RFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCF 820

Query: 806 IYRFICTGTIEEKIYQRQSMKMSLS 830
           IYRFI TGTIEEKIYQRQSMKMSLS
Sbjct: 821 IYRFISTGTIEEKIYQRQSMKMSLS 845

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/845 (62%), Positives = 593/845 (70%), Gaps = 59/845 (6%)

Query: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLE----XXXXXXXX 56
           MARR+LPDRPPNGIGAG+RP L PR ++   +   LT+PF+VP +               
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60

Query: 57  XXXIGKRT--TRSKTHVYE-LTETAPEFEHSESESGLKR--AKRPDALSARRLSRDPDRL 111
              +G R+   RS T  Y  L   A E E++  +    +   +R DALSA+RL++DP RL
Sbjct: 61  DNIVGGRSLRKRSATVCYSGLDINADEAEYNSQDISFSQLTKRRKDALSAQRLAKDPTRL 120

Query: 112 RKIDSLLRRSFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGP 171
             I   LRRSFTVPIKGYV RH++PL+LG K KI   PRPLHDPT+EFAIVLYDPSVDG 
Sbjct: 121 SHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPSVDGE 180

Query: 172 TPELLIQMXXXXXXXXXXXXXXXXXXXTRATQLXXXXXXXXXXXXXXKKLSNGLPNKTLR 231
                  M                       +                 ++NG+ NK LR
Sbjct: 181 MIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRNKPLR 240

Query: 232 ELLGDRQVD----EKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKXXXXXXXX 287
           ELLGD +      +KFASVPVVIDP L KILRPHQVEGVRFLYRCVTGLVMK        
Sbjct: 241 ELLGDSENSAENKKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDYLEAEAF 300

Query: 288 XXXXXXXTTSKEQTPPADHXXXXXXXXXXXXXXXXXHTLTSDEKLPNQELDTPAPTDESS 347
                   TS E                          L SDEK         A T+   
Sbjct: 301 -------NTSSEDP------------------------LKSDEK---------ALTESQK 320

Query: 348 SEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWA 407
           +E   NRGAYGCIMADEMGLGKTLQCIAL+WTLLRQGPQGK  IDKCIIVCPSSLVNNWA
Sbjct: 321 TE-QNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWA 379

Query: 408 NEIVKWLGKGTLASLPIDGKKSSLNNG--TVAQAVRGWALARGRSVVKPVLIISYETLRR 465
           NE++KWLG  TL  L +DGKKSS+  G  TV+QA+  WA A+GR++VKPVLIISYETLRR
Sbjct: 380 NELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKPVLIISYETLRR 439

Query: 466 NVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLN 525
           NV+ L NC +GL+LADEGHRLKN +S TFTALDSI+CPRRVILSGTPIQNDLSEYFALL+
Sbjct: 440 NVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFALLS 499

Query: 526 FSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDIL 585
           FSNPGLLG+R+EFR+NFENPIL  RDADATD EI KG  +LQ LSTIVSKFIIRRTNDIL
Sbjct: 500 FSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEAQLQKLSTIVSKFIIRRTNDIL 559

Query: 586 SKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHP 645
           +KYLPCKYEHV+FVNLKP Q  +Y  ++K R+VK  VK     SQPL+ IG LKKLCNHP
Sbjct: 560 AKYLPCKYEHVIFVNLKPLQNELYNKLIKSREVKKVVKGVGG-SQPLRAIGILKKLCNHP 618

Query: 646 DLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIV 705
           +LL   ++ +  +D+   D  N   SK    +VQT YS KFSIL RFLHKIKTESDDKIV
Sbjct: 619 NLLNFEDEFDDEDDLELPDDYNMPGSK--ARDVQTKYSAKFSILERFLHKIKTESDDKIV 676

Query: 706 IISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGG 765
           +ISNYTQTLD+IE+MCR   Y  VRLDGTM+INKRQKLVDRFND EGQEFIFLLSSKAGG
Sbjct: 677 LISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGG 736

Query: 766 CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSM 825
           CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI TGTIEEKI+QRQSM
Sbjct: 737 CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSM 796

Query: 826 KMSLS 830
           KMSLS
Sbjct: 797 KMSLS 801

>Scas_668.18
          Length = 875

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/481 (80%), Positives = 420/481 (87%), Gaps = 7/481 (1%)

Query: 353 NRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVK 412
           NRGAYGCIMADEMGLGKTLQCIAL+WTLLRQGPQGK  IDKCIIVCPSSLVNNWANE+VK
Sbjct: 302 NRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVK 361

Query: 413 WLGKGTLASLPIDGKKSSL--NNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHL 470
           WLG GTL+ L +DGKKSSL   N TVA+AV  WA A GR++VKPVLIISYETLRRNV+ L
Sbjct: 362 WLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRNVDQL 421

Query: 471 NNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 530
            NC++GL+LADEGHRLKN +S TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG
Sbjct: 422 RNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 481

Query: 531 LLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLP 590
           LLGTRSEFR+NFE PIL SRDAD+TD EI KG E+LQ LSTIVSKFIIRRTNDILSKYLP
Sbjct: 482 LLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTIVSKFIIRRTNDILSKYLP 541

Query: 591 CKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQL 650
           CKYEHV+FVNLKPFQ+ VY  +LK RDV   VK G   +QPLK IG LKKLCNHP+L+ L
Sbjct: 542 CKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVK-GVGGTQPLKAIGVLKKLCNHPNLINL 600

Query: 651 PEDVEGSEDV-IPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISN 709
            E+++  +D+ IP++Y       R   +VQ  +SGKF+IL RFLHKIKTESDDKIV+ISN
Sbjct: 601 DEEIDDFDDLEIPDEYNMQGSKSR---DVQPQFSGKFAILERFLHKIKTESDDKIVLISN 657

Query: 710 YTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGIN 769
           YTQTLD+IE+MCR   Y  VRLDGTMTINKRQKLVDRFND EGQEFIFLLSSKAGGCGIN
Sbjct: 658 YTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGIN 717

Query: 770 LIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           LIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI TG+IEEKIYQRQSMKMSL
Sbjct: 718 LIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSL 777

Query: 830 S 830
           S
Sbjct: 778 S 778

 Score =  241 bits (614), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/290 (45%), Positives = 175/290 (60%), Gaps = 18/290 (6%)

Query: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLE---XXXXXXXXX 57
           MARRKLPDRPPNGIG G RP L PR ++   + +TL++PFKVP +  +            
Sbjct: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60

Query: 58  XXIGKRTTRSKTHVY-----ELTETAPEFEHSESESGLKRAKRPDALSARRLSRDPDRLR 112
             +  R  R ++H       +++  A + + +         +R DALSA RL+ DP RL 
Sbjct: 61  VQVNGRILRKRSHTVSYSGLDISSAAADVDENSLTFSQSTKRRKDALSASRLANDPTRLH 120

Query: 113 KIDSLLRRSFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPT 172
            I+  L+RSFTVPIKGY+ RH++PL+LGTK KI++ PRPLHDPT+EFAIVLYDPSVDG  
Sbjct: 121 SIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSVDG-- 178

Query: 173 PELLIQMXXXXXXXXXXXXXXXXXXXTRATQLXXXXXXXXXXXXXXKKLSNGLPNKTLRE 232
            ++++                     ++  +               K ++NG+ NK+L+E
Sbjct: 179 -DMIMHDNSQDVRNDKKDSTKEKGTDSKDEE----TKTGSKKFAHPKLMTNGVRNKSLKE 233

Query: 233 LLGDRQVDE---KFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMK 279
           LLG  + DE   KF +VPVVIDP L KILRPHQVEGV+FLYRCVTGLVMK
Sbjct: 234 LLGSSEEDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMK 283

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  345 bits (886), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/495 (39%), Positives = 288/495 (58%), Gaps = 51/495 (10%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTI------------DKCIIVCPSSLVNN 405
           GC++ADEMGLGKTL  I L+WTLL+Q P   PTI             K +IVCP +L+ N
Sbjct: 315 GCLLADEMGLGKTLMTITLIWTLLKQTPY--PTIINQRGVTLAGEISKVLIVCPVTLIGN 372

Query: 406 WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVK-----PVLIISY 460
           W  E  KWL    +  L +  + S   +            A+ RS +K      VLI+ Y
Sbjct: 373 WKKEFKKWLPMNRIGVLTLHSRNSPTEDK-----------AQVRSFLKVPRTYQVLIVGY 421

Query: 461 ETLRRNVEHLNNCE--IGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLS 518
           E L    + L N +  + L++ DEGHRLKN +S+    L S++  ++++LSGTPIQNDL 
Sbjct: 422 EKLLSIKDELQNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLE 481

Query: 519 EYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSE--IAKGNEKLQALSTIVSKF 576
           E++ +++F NPG+LG+   F+R +  PI  SRD +A  ++  + +G  +   L  I  +F
Sbjct: 482 EFYTIIDFINPGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRF 541

Query: 577 IIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIG 636
           I+RRTN+IL +YLP + + ++F      Q   +  +L    +  +     T +  L  I 
Sbjct: 542 ILRRTNEILQQYLPPRTDLIIFCKPTAEQVEAFHKILTEGQLNFS---NMTFNSSLGLIT 598

Query: 637 ALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSK-RGHAEVQTWYSGKFSILNRFLHK 695
             KK+CN   L++             + Y    LS+ +  +    + SGK  IL   LH+
Sbjct: 599 LFKKICNSTRLIK------------TDPYYEERLSQVQTSSTSGKFTSGKLRILLSLLHE 646

Query: 696 IKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEF 755
           +KT++D+K+V+ISNYTQTLD+IE  C +  Y   RLDG+     R ++V  FN+ +   F
Sbjct: 647 LKTKTDEKVVVISNYTQTLDIIEGHCSSEGYTSARLDGSTATKTRDQIVTSFNN-DPSIF 705

Query: 756 IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTI 815
           +FLLS+K+GG G+NLIGA+RL+L D DWNP+ D QA++R+ RDGQ++ CFIYR + TG I
Sbjct: 706 VFLLSAKSGGVGLNLIGASRLVLFDNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGCI 765

Query: 816 EEKIYQRQSMKMSLS 830
           +EKI QRQ MK++LS
Sbjct: 766 DEKILQRQLMKIALS 780

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/32 (65%), Positives = 25/32 (78%)

Query: 246 VPVVIDPLLVKILRPHQVEGVRFLYRCVTGLV 277
           V V++DPLL K LRPHQ EGV+FLY CV  +V
Sbjct: 266 VSVIVDPLLSKTLRPHQREGVKFLYDCVMNMV 297

>Kwal_27.10513
          Length = 900

 Score =  344 bits (882), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/503 (40%), Positives = 289/503 (57%), Gaps = 43/503 (8%)

Query: 347 SSEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGP--------------QGKPTID 392
           S+++ +     GC++ADEMGLGKTL  I L+WTLL+Q P              QG    +
Sbjct: 282 STKLKRTNEIQGCLLADEMGLGKTLMTITLVWTLLKQTPIPSKANSSQNGISLQG--LCN 339

Query: 393 KCIIVCPSSLVNNWANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVV 452
           K ++VCP +L+ NW  E  KWL    +  L +  K ++  +      VR + L   R+  
Sbjct: 340 KILVVCPVTLIGNWKREFSKWLNVNRIGILTLSSKSNAEKDKLT---VRNF-LRVQRTY- 394

Query: 453 KPVLIISYETLRRNVEHL--NNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSG 510
             VL+I YE L    E L     +I L++ DEGHRLKN +S+T  A+ S+  PR+++L+G
Sbjct: 395 -QVLVIGYEKLLSVTEELLEAKSKIDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTG 453

Query: 511 TPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEI--AKGNEKLQA 568
           TPIQNDL+E+F + +F N G+LGT S+F+R+F NPI  +RD +   + +   KG +K Q 
Sbjct: 454 TPIQNDLAEFFTIADFLNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQE 513

Query: 569 LSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTP 628
           L  I   F +RRT + +SK+LP K + VLF      Q   +   L    +  +     T 
Sbjct: 514 LIEITKNFTLRRTAETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFS---RLTF 570

Query: 629 SQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSI 688
           +  L  I   KK+CN P L+        S+D     Y   T+      ++    SGK  +
Sbjct: 571 NSSLGLITLFKKICNSPSLI--------SQD----SYYLETIKPNSEVKISAPDSGKLRV 618

Query: 689 LNRFLHKIKTES-DDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRF 747
           L   L  ++  S  +K+VI+SNYTQTLD+I+ M  ++S    RLDG+     R K+V+ F
Sbjct: 619 LMALLDNLRKLSPQEKVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSF 678

Query: 748 NDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY 807
           N V    F FLLS+K+GG G+NLIGA+RLIL D DWNPA D QA++R+ RDGQK++C+IY
Sbjct: 679 NTVPSI-FAFLLSAKSGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIY 737

Query: 808 RFICTGTIEEKIYQRQSMKMSLS 830
           R + TG I+EKI+QRQ  K SLS
Sbjct: 738 RLLTTGCIDEKIFQRQLAKTSLS 760

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 24/33 (72%)

Query: 244 ASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGL 276
           A   VV+DP+L K LRPHQ  GV+F+Y C+ GL
Sbjct: 237 ADTDVVVDPILSKHLRPHQRIGVKFMYDCILGL 269

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  335 bits (859), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 208/514 (40%), Positives = 296/514 (57%), Gaps = 42/514 (8%)

Query: 333 PNQELDTPAPTDESSSEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGP------- 385
           P+ +  T +   E+ S++S      GC++AD+MGLGKTL  I L+WTL+RQ P       
Sbjct: 288 PDIDCTTKSLVLENDSDIS------GCLLADDMGLGKTLMSITLIWTLIRQTPFASKVSC 341

Query: 386 --QGKPTIDKC---IIVCPSSLVNNWANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAV 440
              G P    C   ++VCP +L+ NW  E  KWL    +  L +  + S         AV
Sbjct: 342 SQSGIPLTGLCKKILVVCPVTLIGNWKREFGKWLNLSRIGVLTLSSRNSP---DMDKMAV 398

Query: 441 RGWALARGRSVVKPVLIISYETLRRNVEHL--NNCEIGLLLADEGHRLKNAESQTFTALD 498
           R + L   R+    VLII YE L    E L  N   I +L+ DEGHRLKN  S+    L 
Sbjct: 399 RNF-LKVQRTY--QVLIIGYEKLLSVSEELEKNKHLIDMLVCDEGHRLKNGASKILNTLK 455

Query: 499 SINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRD-ADATDS 557
           S++  R+++L+GTPIQNDL+E+F +++F NPG+LG+ + F+R F  PI  +RD A+  + 
Sbjct: 456 SLDIRRKLLLTGTPIQNDLNEFFTIIDFINPGILGSFASFKRRFIIPITRARDTANRYNE 515

Query: 558 EI-AKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCR 616
           E+  KG E+ + +  I  +FI+RRTN IL KYLP K + +LF   KP+ + +       +
Sbjct: 516 ELLEKGEERSKEMIEITKRFILRRTNAILEKYLPPKTDIILFC--KPYSQQILAFKDILQ 573

Query: 617 DVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHA 676
             +L      T S  L  I  LKK+CN P L+       GS D   + +   T S+  ++
Sbjct: 574 GARLDFGQ-LTFSSSLGLITLLKKVCNSPGLV-------GS-DPYYKSHIKDTQSQDSYS 624

Query: 677 EVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMT 736
             ++  SGK  +L   L  I+  + +K+V++SNYTQTLD+IE +   +     RLDG++ 
Sbjct: 625 --RSLNSGKLKVLMTLLEGIRKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIP 682

Query: 737 INKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 796
             +R  +V  FN      F FLLS+K+GG G+NL+G +RLIL D DWNP+ D QA++R+ 
Sbjct: 683 AKQRDSIVTSFNRNPAI-FGFLLSAKSGGVGLNLVGRSRLILFDNDWNPSVDLQAMSRIH 741

Query: 797 RDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           RDGQKK CFIYR + TG I+EKI QRQ MK SLS
Sbjct: 742 RDGQKKPCFIYRLVTTGCIDEKILQRQLMKNSLS 775

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 26/34 (76%)

Query: 244 ASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLV 277
           A V V++DPLL K LRPHQ EGV+F+Y C+ GL 
Sbjct: 248 AEVDVIVDPLLGKFLRPHQREGVKFMYDCLMGLA 281

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  332 bits (850), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 209/513 (40%), Positives = 300/513 (58%), Gaps = 46/513 (8%)

Query: 339 TPAPTDESSSEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGP---------QGKP 389
           T   TD+ S  + ++    GCI+AD+MGLGKTL  I L+WTLL+Q P          G P
Sbjct: 290 TAESTDDKSCRLERDSDIKGCILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVP 349

Query: 390 ---TIDKCIIVCPSSLVNNWANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQ-AVRGWAL 445
               I K +IVCP +L+ NW  E  KWLG   +  L ++ K    NN  + + +VR + +
Sbjct: 350 LSGMISKVVIVCPVTLIGNWKREFKKWLGLNRIGILTLNPK----NNVDMDKISVRNF-I 404

Query: 446 ARGRSVVKPVLIISYETLRRNVEHL--NNCEIGLLLADEGHRLKNAESQTFTALDSINCP 503
              R+    VLI+ YE +    E L     ++ LL+ DEGHRLKN  S+    L S++  
Sbjct: 405 KVNRTY--QVLILGYEKVLTVQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKSLDID 462

Query: 504 RRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADA--TDSEIAK 561
           ++VIL+GTPIQNDL+E+F +++F NPG+LGT + F++ + NPI  +RD +       I +
Sbjct: 463 KKVILTGTPIQNDLNEFFTIIDFVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQ 522

Query: 562 GNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLA 621
           G EK   L     +FI+RR+N+ILSK+LP K + +LF       R   E +   RD+   
Sbjct: 523 GEEKSNQLIEFTKRFILRRSNNILSKFLPPKTDIILFC------RPTIEQIKAFRDIIEN 576

Query: 622 VK---DGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEV 678
           V+   +  T +  L  I  +KK+CN P LL    D     +V   D    T+S + ++  
Sbjct: 577 VRVDMNNITFNTSLGLINLMKKVCNSPSLL--CNDPYYQSNV---DSNIFTVSNKSNS-- 629

Query: 679 QTWYSGKFSILNRFLHKIKTESD-DKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTI 737
               SGK ++L   L +IK  S  +K+VI+SNYTQ+LD+I+ +  ++     RLDG    
Sbjct: 630 ----SGKLTVLLELLLEIKATSPMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPA 685

Query: 738 NKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 797
            +R  LV+ FN+     F FLLS+KAGG G+NLIGA+RL+L D DWNPA D QA++R+ R
Sbjct: 686 KQRDMLVNTFNN-NPNIFGFLLSAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHR 744

Query: 798 DGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           +GQK+ C+IYR I TG I+EKI QRQ MK +L+
Sbjct: 745 EGQKRPCYIYRLITTGCIDEKILQRQLMKHNLT 777

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 223 NGLPNKTLRELLGDRQVDEKF-------ASVPVVIDPLLVKILRPHQVEGVRFLYRCVTG 275
           N +P +  R L     ++          + V +++DPLL K+LR HQ  GV+F+Y C+ G
Sbjct: 225 NTVPTQKFRSLFDCNTIENPLIMNTFQGSEVDIIVDPLLCKMLRNHQRIGVKFMYDCLLG 284

Query: 276 L 276
           L
Sbjct: 285 L 285

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  331 bits (848), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 195/490 (39%), Positives = 279/490 (56%), Gaps = 37/490 (7%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPT------------IDKCIIVCPSSLVNN 405
           GC++ADEMGLGKT   IAL+WTLL+Q P+                  K ++VCP +L+ N
Sbjct: 293 GCLLADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGN 352

Query: 406 WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRR 465
           W  E +KWL    +  L +  K +   +      VR + L   R+    VLI+ YE L  
Sbjct: 353 WKKEFIKWLPMNRIGILTLSSKNTPEKD---KNDVRNF-LRVQRTY--QVLILGYEKLLN 406

Query: 466 NVEHLNNCE--IGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFAL 523
               L+  +  + LL+ DEGHRLKN+ S+    L  +   R+VIL+GTPIQNDL+E++ +
Sbjct: 407 VFSELDQAKSKLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFYTI 466

Query: 524 LNFSNPGLLGTRSEFRRNFENPILLSRDAD--ATDSEIAKGNEKLQALSTIVSKFIIRRT 581
           +NF NPG+LGT + F+R +  PI  +RD +    D  ++ G  + Q L  I  KFI+RRT
Sbjct: 467 INFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILRRT 526

Query: 582 NDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKL 641
           + I++ YLP + + V+F      Q   +  +L    V        + +  L  I   KK+
Sbjct: 527 SSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVDFQ---NMSFNSSLGLITLFKKI 583

Query: 642 CNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESD 701
           CN P L+        S+          T + R     Q+  SGK  +L   LH+I   SD
Sbjct: 584 CNSPSLVS-------SDSYFQSKVNGGTPALR---IAQSTTSGKLKVLMSLLHQIAHRSD 633

Query: 702 -DKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLS 760
            +K+V+ISNYTQTLD+I  +  ++S   +RLDG+    +R  +V+ FN  +   F FLLS
Sbjct: 634 NEKVVVISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQ-TIFGFLLS 692

Query: 761 SKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIY 820
           +K+GG G+NL+GA+RLIL D DWNP+ D QA++R+ RDGQKK CFIYR + TG I+EKI+
Sbjct: 693 AKSGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKIF 752

Query: 821 QRQSMKMSLS 830
           QRQ MK +LS
Sbjct: 753 QRQLMKNNLS 762

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (71%)

Query: 246 VPVVIDPLLVKILRPHQVEGVRFLYRCVTGLV 277
           V VV+DP+L K LR HQ  G++F+Y CV GL 
Sbjct: 241 VEVVVDPILSKKLRQHQRTGIKFMYDCVRGLA 272

>Scas_718.40
          Length = 926

 Score =  328 bits (840), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 201/493 (40%), Positives = 277/493 (56%), Gaps = 42/493 (8%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQ---------GKPTIDKC---IIVCPSSLVNN 405
           GC++ADEMGLGKTL  I L+WTLL+Q P          G P    C   ++VCP +L+ N
Sbjct: 303 GCLLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGN 362

Query: 406 WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRR 465
           W  E  KWL    +  L +  + +   + T   AV+ + L   R+    VL+I YE L  
Sbjct: 363 WKREFAKWLNLNRIGILTLSSRNTPEMDKT---AVKNF-LRVQRTF--QVLVIGYEKLLS 416

Query: 466 NVEHLNNCE--IGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFAL 523
             E L+     I LL+ DEGHRLKN  S+    L ++   R+++LSGTPIQNDL+E++ +
Sbjct: 417 VSEELHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTI 476

Query: 524 LNFSNPGLLGTRSEFRRNFENPILLSRDADATDSE--IAKGNEKLQALSTIVSKFIIRRT 581
           ++F NPG+LG+   F++ F  PI   RD +   +E  I  G  + + +  I  KF +RRT
Sbjct: 477 IDFLNPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFTLRRT 536

Query: 582 NDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKL 641
           N ILSKYLP K + +LF      Q   +  +L    +  A     + +  L  I   KK+
Sbjct: 537 NAILSKYLPPKTDIILFCKPTQSQLLAFNDILSRSRIDFA---NLSFNSSLGLITLFKKI 593

Query: 642 CNHPDLLQLPEDVEGS---EDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIK- 697
           CN P L+      +     + VI E Y  S              SGK  IL   L KIK 
Sbjct: 594 CNSPTLIGDDSYYQSKIRPDGVIQERYDRS------------LNSGKLKILMTLLEKIKG 641

Query: 698 TESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIF 757
             +++K+VI+SNYTQTLD+I+ +  ++     RLDG+    +R  +V+ FN      F F
Sbjct: 642 NTNNEKVVIVSNYTQTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNR-NPSIFAF 700

Query: 758 LLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEE 817
           LLS+K+GG G+NLIGA+RLIL D DWNP+ D QA++R+ RDGQKK C+IYR I TG I+E
Sbjct: 701 LLSAKSGGVGLNLIGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDE 760

Query: 818 KIYQRQSMKMSLS 830
           KI QRQ MK SLS
Sbjct: 761 KILQRQLMKHSLS 773

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 27/34 (79%)

Query: 244 ASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLV 277
           A V V++DPLL K+LRPHQ EGV+F+Y CV GL 
Sbjct: 245 ADVDVIVDPLLGKLLRPHQREGVKFMYDCVMGLA 278

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  271 bits (694), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 174/509 (34%), Positives = 255/509 (50%), Gaps = 60/509 (11%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---- 413
           G I+ DEMGLGKT+Q IA L TL        P     ++VCP++++  W NE   W    
Sbjct: 285 GGIIGDEMGLGKTIQIIAFLATLHHSRKLNGP----VLVVCPATVMKQWCNEFHTWWPPF 340

Query: 414 -----------LGKGT------LASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVL 456
                      + KGT      L  + +     +       +  +       R  VK +L
Sbjct: 341 RAVILHSIGAGMNKGTQIPEEELEKMLMTSNYGTFTYNDYEKKEKTRTSLESRKSVKKLL 400

Query: 457 ----------IISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRV 506
                     I +Y  LR + E L N   G  + DEGH+++N +S        +    R+
Sbjct: 401 EKVITDGHIIITTYVGLRLHSEALLNVRWGYAILDEGHKIRNPDSDISLTCKQLKTQNRI 460

Query: 507 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKL 566
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F NPI +   A+A++ ++  G +  
Sbjct: 461 ILSGTPIQNNLTELWSLFDFVYPGKLGTLPVFQQQFANPINMGGYANASNIQVKTGYKCA 520

Query: 567 QALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGT 626
            AL  ++S +++RR    ++K LP K E VLF  L  +Q+S Y   L   ++ + ++ G 
Sbjct: 521 VALRDLISPYLLRRVKSDVAKDLPKKNEMVLFCKLTQYQKSKYLEFLHSDEL-MKIRKG- 578

Query: 627 TPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKF 686
              Q L  I  L+K+CNHPDLL L    +   D    DY N               SGK 
Sbjct: 579 -KRQVLYGIDILRKICNHPDLLDLKR--KKMNDYEDADYGNPA------------RSGKM 623

Query: 687 SILNRFLHKIKTESDDKIVIISNYTQTLDVIERMC-----RTSSYPVVRLDGTMTINKRQ 741
            ++ + L    ++   K ++ +   Q LD+++          S    +R+DGT  I  RQ
Sbjct: 624 QVVKQLLLLWHSQG-HKTLLFTQSRQMLDILQEFISYKDPELSDLKFLRMDGTTNIGSRQ 682

Query: 742 KLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 801
            LVD+FN+      +FLL+++ GG GINL GANR+I+ DPDWNP+ D QA  R WR GQK
Sbjct: 683 SLVDKFNNEPYD--VFLLTTRVGGLGINLTGANRIIIFDPDWNPSTDMQARERAWRIGQK 740

Query: 802 KDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           ++  IYR +  G+IEEKIY RQ  K  LS
Sbjct: 741 REVTIYRLMIAGSIEEKIYHRQIFKQFLS 769

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  270 bits (691), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 177/509 (34%), Positives = 260/509 (51%), Gaps = 64/509 (12%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---- 413
           G I+ DEMGLGKT+Q I+ L +L   G    P     +IVCP++++  W NE   W    
Sbjct: 305 GGIIGDEMGLGKTIQIISFLASLHHSGMLDGP----ILIVCPATVMKQWCNEFHTWWPPF 360

Query: 414 -------LGKGT---------------LASLP-----IDGKKSSLNNGTVAQAVRGWALA 446
                  +G G                + S P     +D   S     T+   +    L 
Sbjct: 361 RAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSKKTKSTMESKLNLTKLV 420

Query: 447 RGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRV 506
                   VLI +Y  LR + + L   + G  + DEGH+++N +S        +    RV
Sbjct: 421 DKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPDSDISLTCKQLKTSNRV 480

Query: 507 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKL 566
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI +   A+AT+ ++  G +  
Sbjct: 481 ILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGGYANATNIQVQTGYKCA 540

Query: 567 QALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGT 626
            AL  ++S +++RR    ++K LP K E VLF  L  +QR+ Y   L   D+ + +K+G 
Sbjct: 541 VALRDLISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRNKYLQFLNSGDL-VKIKNG- 598

Query: 627 TPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKF 686
              Q L  I  L+K+CNHPD+  L  D+  SE+   +  R                SGK 
Sbjct: 599 -KRQVLYGIDILRKICNHPDI--LVRDMRHSEESYGDPKR----------------SGKM 639

Query: 687 SILNRFLHKIKTESDDKIVIISNYTQTLDVIERMC-----RTSSYPVVRLDGTMTINKRQ 741
            ++ + L K+  E   K ++ +   Q LD++E+         SS   +R+DGT  I  RQ
Sbjct: 640 QVVKQLL-KLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYLRMDGTTNIAARQ 698

Query: 742 KLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 801
            LVD+FN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK
Sbjct: 699 HLVDKFNNELYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQK 756

Query: 802 KDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           ++  IYR +  G+IEEKIY RQ  K  L+
Sbjct: 757 REVTIYRLMIAGSIEEKIYHRQIFKQFLT 785

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  270 bits (689), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 177/513 (34%), Positives = 260/513 (50%), Gaps = 74/513 (14%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---- 413
           G I+ DEMGLGKT+Q  A L  L        P     +IVCP++++  W NEI +W    
Sbjct: 317 GGIIGDEMGLGKTIQVTAFLAALHHSNLLSGP----VLIVCPATVMKQWCNEIHQWWPPF 372

Query: 414 -------LGKGT----------LASLPIDGK---------------KSSLNNGTVAQAVR 441
                  +G G           + ++ I  +               KS +  G   Q + 
Sbjct: 373 RAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENASKLKSKVETGMHMQNLI 432

Query: 442 GWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSIN 501
              +A G      ++I +Y  LR + + L N      + DEGH+++N +S+       + 
Sbjct: 433 SKVVADGH-----IIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPDSEISLTCKKLK 487

Query: 502 CPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAK 561
           C  R+ILSGTPIQN+L E ++L +F  PG LGT   F++ F  PI +   A+AT++++  
Sbjct: 488 CKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPINMGGYANATNTQVQT 547

Query: 562 GNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLA 621
           G     AL  ++S +++RR    ++K LP K E VLF  L  FQR  Y   L   ++   
Sbjct: 548 GYRCAVALRDLISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRRKYLEFLSSDELS-Q 606

Query: 622 VKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTW 681
           +K G      L  I  L+K+CNHPDLL               DY  +T    G+ + +  
Sbjct: 607 IKGG--KRHVLYGIDILRKICNHPDLL-------------DRDYIKNT---SGYGDPKR- 647

Query: 682 YSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCR-----TSSYPVVRLDGTMT 736
            SGK  ++ + L   K+E   K ++ +   Q LD++E   +      S    +R+DGT +
Sbjct: 648 -SGKMQVVKQLLKLWKSEG-HKTLLFTQSRQMLDILEEFIKFKEPELSDIRYLRMDGTTS 705

Query: 737 INKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 796
           I  RQ LVDRFN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R W
Sbjct: 706 IQVRQTLVDRFNNESYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDLQARERAW 763

Query: 797 RDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           R GQK++  IYR + +GTIEEKIY RQ  K  L
Sbjct: 764 RIGQKREVSIYRLMISGTIEEKIYHRQIFKQFL 796

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  265 bits (676), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 169/509 (33%), Positives = 260/509 (51%), Gaps = 64/509 (12%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---- 413
           G I+ DEMGLGKT+Q ++ L +L   G    P     ++VCP++++  W +E   W    
Sbjct: 283 GGIVGDEMGLGKTIQIVSFLASLHHSGKLKGP----VLVVCPATVMKQWCSEFQTWWPPF 338

Query: 414 -------LGKGTLASLPIDGKK-------------SSLNNGTVAQAVRGWALARG-RSVV 452
                  +G G +    +  ++             S      + +  +     RG  S+V
Sbjct: 339 RAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANLGRTKKQLEARRGIESLV 398

Query: 453 KPV------LIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRV 506
           + V      LI +Y  L+ + + L +      + DEGH+++N ++        +  P R+
Sbjct: 399 QKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNPDAGISLTCKRLRTPHRI 458

Query: 507 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKL 566
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F NPI     A+AT+ ++  G +  
Sbjct: 459 ILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINAGGYANATNIQVQTGYKCA 518

Query: 567 QALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGT 626
            AL  ++S +++RR  + ++K LP K E VLF  +  FQ+  Y   L   D+ + +K+G 
Sbjct: 519 VALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKYLQFLNSEDM-IKIKNGR 577

Query: 627 TPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKF 686
              Q L  I  L+K+CNHPDLL+   D    E    +  R                SGK 
Sbjct: 578 --RQVLYGIDILRKICNHPDLLE--RDFRKHEPSFGDPRR----------------SGKM 617

Query: 687 SILNRFLHKIKTESDDKIVIISNYTQTLDVIERMC-----RTSSYPVVRLDGTMTINKRQ 741
           +++ + L   K +   K ++ +   Q LD++E          +    +R+DGT  I  RQ
Sbjct: 618 TVIKQLLLTWKKQG-HKALLFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTTNIAHRQ 676

Query: 742 KLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 801
            LVDRFN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK
Sbjct: 677 ALVDRFNN--GPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQK 734

Query: 802 KDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           +D  IY  +  G+IEEKIY RQ  K  L+
Sbjct: 735 RDVTIYLLMVAGSIEEKIYHRQIFKQFLT 763

>Scas_549.4
          Length = 1079

 Score =  261 bits (667), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 175/514 (34%), Positives = 260/514 (50%), Gaps = 74/514 (14%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---- 413
           G I+ DEMGLGKT+Q IA L +L   G    P     +IVCP++++  W NE+  W    
Sbjct: 324 GGIIGDEMGLGKTIQIIAFLASLHHSGLLNGP----VLIVCPATVMKQWCNELHHWWPPL 379

Query: 414 ----------------------LGKGTLASLPID----------GKKSSLNNGTVAQAVR 441
                                 L +  + + P +            K+SL +    Q++ 
Sbjct: 380 RTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRSKTKASLESTFNIQSLI 439

Query: 442 GWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSIN 501
              +  G      ++I +Y  LR + E L        + DEGH+++N +S        I 
Sbjct: 440 DKVINDGH-----IIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPDSDISLTCKKIK 494

Query: 502 CPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAK 561
            P R+ILSGTPIQN+L E ++L +F  PG LGT   F++ F  PI     A+AT+ ++  
Sbjct: 495 TPNRIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGGYANATNIQVQT 554

Query: 562 GNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLA 621
           G +   AL  ++S +++RR    ++K LP K E VLF  L  +Q++ Y   L   ++   
Sbjct: 555 GVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYLEFLNSNEL-TQ 613

Query: 622 VKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTW 681
           ++ G      L  I  L+K+CNHPDLL      E  E     DY N    KR        
Sbjct: 614 IRGGR--RHVLYGIDILRKICNHPDLL------EREERQYETDYGN---PKR-------- 654

Query: 682 YSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCR-----TSSYPVVRLDGTMT 736
            SGK  ++ + L     E   K ++ +   Q LD++E+  +      S    +R+DGT  
Sbjct: 655 -SGKMQVVKQLLLLWHKEG-HKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMDGTSN 712

Query: 737 INKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 796
           I+KRQ LVD+FN+ +    +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R W
Sbjct: 713 ISKRQGLVDQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQARERAW 770

Query: 797 RDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           R GQK++  IYR + +G+IEEKIY RQ  K  L+
Sbjct: 771 RIGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLT 804

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  257 bits (657), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 176/515 (34%), Positives = 255/515 (49%), Gaps = 74/515 (14%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---- 413
           G I+ DEMGLGKT+Q IA +  L   G    P     +IVCP++++  W NE   W    
Sbjct: 317 GGIIGDEMGLGKTIQVIAFIAALHHSGLLTGP----VLIVCPATVMKQWCNEFQHWWPPL 372

Query: 414 -------LGKGT-----------------LASLPIDGKKSSLNNGTVAQAVRGWALARGR 449
                  +G G                  + S P D       N T  +     +    +
Sbjct: 373 RTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRTKKALESSYHLDK 432

Query: 450 SVVKPV-----LIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPR 504
            + K V     LI +Y  LR + + L   +    + DEGH+++N +S+       +    
Sbjct: 433 LIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHN 492

Query: 505 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNE 564
           R+ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI +   A+AT+ ++  G +
Sbjct: 493 RIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGYK 552

Query: 565 KLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKD 624
              AL  ++S +++RR    ++K LP K E VLF  L  +QRS Y   L   D+   +++
Sbjct: 553 CAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLHSSDLN-QIQN 611

Query: 625 GTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSG 684
           G      L  I  L+K+CNHPDLL         +   P         KR         SG
Sbjct: 612 G--KRNVLFGIDILRKICNHPDLLDRDTKRHNPDYGDP---------KR---------SG 651

Query: 685 KFSILNRFL---HKIKTESDDKIVIISNYTQTLDVIERMCRT-----SSYPVVRLDGTMT 736
           K  ++ + L   HK       K ++ +   Q LD++E    T     S    +R+DGT  
Sbjct: 652 KMQVVKQLLLLWHK----QGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTN 707

Query: 737 INKRQKLVDRFNDVEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARV 795
           I  RQ LVDRFN+   + F +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R 
Sbjct: 708 IKGRQSLVDRFNN---ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERA 764

Query: 796 WRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
           WR GQK++  IYR +  G+IEEKIY RQ  K  L+
Sbjct: 765 WRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLT 799

>Kwal_34.16082
          Length = 726

 Score =  225 bits (573), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 154/470 (32%), Positives = 234/470 (49%), Gaps = 64/470 (13%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---- 413
           G I+ DEMGLGKT+Q IA L +L   G    P     +IVCP++++  W  E   W    
Sbjct: 283 GGIIGDEMGLGKTIQIIAFLASLHHSGKLDGP----VLIVCPATVLRQWCKEFHTWWPPF 338

Query: 414 -------LGKGT----------LASLPIDGKKSSLNNGTVAQAVRGWA-----LARGRSV 451
                  +G G           L  L ++     L+      + R  +     +AR + +
Sbjct: 339 RTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSKRTKSTLESGMARSKLI 398

Query: 452 VKPV-----LIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRV 506
            K V     LI +Y  LR + ++L N      + DEGH+++N ++        +    R+
Sbjct: 399 NKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPDADISLTCKKLKTKNRI 458

Query: 507 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKL 566
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI +   A+AT+ ++  G +  
Sbjct: 459 ILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGGYANATNIQVQTGYKCA 518

Query: 567 QALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGT 626
            AL  ++S +++RR    ++K LP K E VLF  L  FQR  Y   L   D+   +K+G 
Sbjct: 519 IALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYLQFLNSEDLT-KIKNG- 576

Query: 627 TPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKF 686
              Q L  I  L+K+CNHPDLL+  +D   +E    +  R                SGK 
Sbjct: 577 -KRQVLFGIDILRKICNHPDLLE--KDKRENESSYGDPKR----------------SGKM 617

Query: 687 SILNRFLHKIKTESDDKIVIISNYTQTLDVIERMC-----RTSSYPVVRLDGTMTINKRQ 741
            ++ + L ++      K ++ +   Q LD++E+              +R+DGT  I  RQ
Sbjct: 618 QVVKQLL-RLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRMDGTTNIGSRQ 676

Query: 742 KLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 791
            LVD FN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA
Sbjct: 677 ALVDSFNN--GLYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA 724

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  229 bits (584), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 156/484 (32%), Positives = 248/484 (51%), Gaps = 49/484 (10%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409
           VS ++     I+ADEMGLGKTLQ I+ L  L        P     +++ P S +NNW  E
Sbjct: 187 VSLDKNRIAGILADEMGLGKTLQTISFLGYLRYIKKIPGP----FLVIAPKSTLNNWLRE 242

Query: 410 IVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEH 469
           I KW  +  + +  + G K        A+ ++   +A    VV    I SYE + R    
Sbjct: 243 INKWTPE--VNAFILQGDKEER-----ARLIQDKFMACDFDVV----IASYEIIIREKAA 291

Query: 470 LNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 529
                   ++ DE HR+KN ES     L   +   R++++GTP+QN+L E +ALLNF  P
Sbjct: 292 FRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPLQNNLHELWALLNFLLP 351

Query: 530 GLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRR-TNDILSKY 588
            +     +F   F      S++ D  D E       ++ L T++  F++RR  +D+ +  
Sbjct: 352 DIFSDSQDFDEWF------SKETDEEDQEKI-----VKQLHTVLQPFLLRRIKSDVETSL 400

Query: 589 LPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKD-GTTPSQP--LKHIGALKKLCNHP 645
           LP K E  ++V + P Q+  Y  +L+ +D+     D G+  S+   L  +  L+K CNHP
Sbjct: 401 LPKK-ELNVYVGMSPMQKKWYRQILE-KDIDAVNADSGSKESKTRLLNIVMQLRKCCNHP 458

Query: 646 DLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIV 705
            L       +G+E   P  Y           E   + S K  +L++ L K+K E+  +++
Sbjct: 459 YLF------DGAEPGPP--YTTD--------EHLVYNSEKLKVLDKLLRKLK-EAGSRVL 501

Query: 706 IISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGG 765
           I S  ++ LD++E  C    Y   R+DG+     R + +D +N  + ++F+FLL+++AGG
Sbjct: 502 IFSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGG 561

Query: 766 CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSM 825
            GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF+   ++EEKI +R + 
Sbjct: 562 LGINLTTADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQ 621

Query: 826 KMSL 829
           K+ L
Sbjct: 622 KLRL 625

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  229 bits (583), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 161/487 (33%), Positives = 244/487 (50%), Gaps = 55/487 (11%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLR----QGPQGKPTIDKCIIVCPSSLVNN 405
           +S +      I+ADEMGLGKTLQ I+ L  L      +GP         +I+ P S ++N
Sbjct: 196 ISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGP--------FLIIVPKSTLDN 247

Query: 406 WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWAL-ARGRSVVKPVLIISYETLR 464
           W  E +KW     +  L + G K      T A  VR   L AR       VLI SYE + 
Sbjct: 248 WRREFLKWTP--NVNVLVLHGDKD-----TRADIVRNIILEARF-----DVLITSYEMVI 295

Query: 465 RNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALL 524
           R    L       ++ DE HR+KN +S     +       R++++GTP+QN+L E +ALL
Sbjct: 296 REKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALL 355

Query: 525 NFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDI 584
           NF  P + G    F   FE      ++    D EI      +Q L ++++ F++RR    
Sbjct: 356 NFLLPDIFGDSELFDEWFE------QNNSEQDQEIV-----IQQLHSVLNPFLLRRVKAD 404

Query: 585 LSKYLPCKYEHVLFVNLKPFQRSVYELMLK--CRDVKLAVKDGTTPSQPLKHIGALKKLC 642
           + K L  K E  ++V +   Q   Y+ +L+     V  AV      ++ L  +  L+K C
Sbjct: 405 VEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCC 464

Query: 643 NHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDD 702
           NHP L       EG+E   P  Y           E   + SGK  IL++ L ++K E   
Sbjct: 465 NHPYLF------EGAEPGPP--YTTD--------EHLIFNSGKMIILDKLLKRLK-EKGS 507

Query: 703 KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
           +++I S  ++ LD++E  C    +   R+DG+ +  +R + +D +N    ++F+FLL+++
Sbjct: 508 RVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTR 567

Query: 763 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
           AGG GINL+ A+ +IL D DWNP AD QA+ R  R GQKK   +YRF+    IEEK+ +R
Sbjct: 568 AGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIER 627

Query: 823 QSMKMSL 829
            + K+ L
Sbjct: 628 AAQKLRL 634

>Scas_662.7
          Length = 1342

 Score =  223 bits (569), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 157/475 (33%), Positives = 241/475 (50%), Gaps = 36/475 (7%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I+L+  L  +     P     +++ P S + NW  E  KW    +L
Sbjct: 483 ILADEMGLGKTIQSISLITYLFEEKKDPGP----YLVIVPLSTITNWTLEFEKW--APSL 536

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
            ++   G  +   N  +   VR             VL+ +YE + ++   L   E   ++
Sbjct: 537 NTVIYKGTPNQRRN--LQHQVRIGNF--------DVLLTTYEYIIKDRALLAKHEWTHMI 586

Query: 480 ADEGHRLKNAESQ-TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
            DEGHR+KNA+S+ ++T         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 587 IDEGHRMKNAQSKLSYTITHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTF 646

Query: 539 RRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLF 598
              F  P   +   +  +    +    ++ L  ++  F++RR    + K LP K E V+ 
Sbjct: 647 EDWFNTPFANTGTGEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVK 706

Query: 599 VNLKPFQRSVYELMLKCRDVKLAV-KDGTTPS--QPLKH-IGALKKLCNHPDLLQLPEDV 654
             L   Q+ +YE MLK   + L    +G T S  + L + I  L+K+CNHP +    ++V
Sbjct: 707 CKLSGLQQQLYEQMLKHNALFLGEGTEGATKSGIKGLNNKIMQLRKICNHPFVF---DEV 763

Query: 655 EGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTL 714
           EG   VI     NS L  R         SGKF +LNR L K K  +  ++++    TQ +
Sbjct: 764 EG---VINPTRANSNLLYR--------VSGKFELLNRVLPKFKA-AGHRVLMFFQMTQVM 811

Query: 715 DVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGAN 774
           D++E   R      +RLDG+   + R  +++ FN  +   F FLLS++AGG G+NL  A+
Sbjct: 812 DIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPDSDYFCFLLSTRAGGLGLNLQTAD 871

Query: 775 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            +I+ D DWNP  D QA  R  R GQK +  I R I T ++EE I +R   K+ +
Sbjct: 872 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDI 926

>Kwal_56.23442
          Length = 1435

 Score =  223 bits (568), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 146/470 (31%), Positives = 229/470 (48%), Gaps = 28/470 (5%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q +A +  L+    Q  P     ++V P S +  W     KW     L
Sbjct: 379 ILADEMGLGKTVQTVAFISWLIYARRQNGP----HLVVVPLSTMPAWQETFEKWAP--DL 432

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
             +   G + S +     +          +     VL+ +YE + ++   L   +   L 
Sbjct: 433 NCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTYEYILKDRAELGAIKWQFLA 492

Query: 480 ADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFR 539
            DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG      E  
Sbjct: 493 VDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQEI- 551

Query: 540 RNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLFV 599
            +FEN             + A+    ++ L + +  FI+RR    + K LP K E +L V
Sbjct: 552 -DFEN-------------QDAEQETYIRDLHSRLQPFILRRLKKDVEKSLPSKTERILRV 597

Query: 600 NLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSED 659
            L   Q   Y+ +L      L+          L  +  LKK  NHP L  +      +ED
Sbjct: 598 ELSDVQTDYYKNILTKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDM------AED 651

Query: 660 VIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIER 719
            +   + +  +S+          SGK  +L++ L ++K +   +++I S   + LD++  
Sbjct: 652 RVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDILGD 710

Query: 720 MCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILM 779
                     RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+ A+ +I+ 
Sbjct: 711 YLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIF 770

Query: 780 DPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           D DWNP AD QA+AR  R GQK    +YRF+   T+EE++ +R   KM L
Sbjct: 771 DSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820

>Scas_652.17
          Length = 1025

 Score =  221 bits (563), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 155/487 (31%), Positives = 239/487 (49%), Gaps = 55/487 (11%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTL-LRQGPQGKPTIDKCIIVCPSSLVNNWAN 408
           VS ++     I+ADEMGLGKTLQ IA L  L   +G  G       +++ P S +NNW  
Sbjct: 125 VSLHKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGING-----PFLVIAPKSTLNNWLR 179

Query: 409 EIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVE 468
           EI KW     + +  + G K        A  ++   +     +V    + SYE + R   
Sbjct: 180 EINKWT--PDVKAFVLQGDKQER-----ASLIKEKLMTCDFDIV----VASYEIIIREKA 228

Query: 469 HLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 528
                    ++ DE HR+KN ES     L       R++++GTP+QN+L E +ALLNF  
Sbjct: 229 AFKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLL 288

Query: 529 PGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRT-NDILSK 587
           P +  +  +F   F +      D D            ++ L T++  F++RR  ND+ + 
Sbjct: 289 PDIFSSSQDFDDWFSSET-TEEDQDKV----------VKQLHTVLQPFLLRRIKNDVETS 337

Query: 588 YLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQP-----LKHIGALKKLC 642
            LP K E  L+V +   Q+  Y+ +L   +  L   +G   S+      L  +  L+K C
Sbjct: 338 LLPKK-ELNLYVGMSNMQKKWYKKIL---EKDLDAVNGENSSKESKTRLLNIVMQLRKCC 393

Query: 643 NHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDD 702
           NHP L       +G+E   P  Y           E   + S K  +L++ L K+K E   
Sbjct: 394 NHPYLF------DGAEPGPP--YTTD--------EHLVYNSKKLQVLDKLLKKMK-EDGS 436

Query: 703 KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
           +++I S  ++ LD++E  C    Y   R+DG+     R K +D +N  +  +FIFLL+++
Sbjct: 437 RVLIFSQMSRVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTR 496

Query: 763 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
           AGG GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF+   ++EEKI +R
Sbjct: 497 AGGLGINLTSADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILER 556

Query: 823 QSMKMSL 829
            + K+ L
Sbjct: 557 ATQKLRL 563

>Scas_576.6
          Length = 1457

 Score =  221 bits (564), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 150/476 (31%), Positives = 233/476 (48%), Gaps = 40/476 (8%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q +A +  L+    Q  P     I+V P S +  W     KW     +
Sbjct: 404 ILADEMGLGKTVQTVAFISWLIYARRQNGP----HIVVVPLSTMPAWQETFDKWAPDLNV 459

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWAL-----ARGRSVVK-PVLIISYETLRRNVEHLNNC 473
                      + N     A+R +       A+G+  +K  VL+ +YE + ++   L + 
Sbjct: 460 ICY--------MGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSI 511

Query: 474 EIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 533
           +   L  DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 512 KWQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFT 571

Query: 534 TRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKY 593
              E   +FEN           D E     E ++ L   +  FI+RR    + K LP K 
Sbjct: 572 IDQEI--DFEN----------QDEE---QEEYIRDLHKRLQPFILRRLKKDVEKSLPSKT 616

Query: 594 EHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPED 653
           E +L V L   Q   Y+ +L      L           L  +  LKK  NHP L      
Sbjct: 617 ERILRVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLF----- 671

Query: 654 VEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQT 713
            + +E+ + + + +  +S+          SGK  +L++ L+K+K +   +++I S   + 
Sbjct: 672 -DNAEERVLKKFGDGQMSRENVLRGLIMSSGKMVLLDQLLNKLKKDGH-RVLIFSQMVRM 729

Query: 714 LDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGA 773
           LD++            RLDGT+   +R+  +D FN  +  + +FLLS++AGG GINL+ A
Sbjct: 730 LDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTA 789

Query: 774 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           + +I+ D DWNP AD QA+AR  R GQK    +YR +   T+EE++ +R   KM L
Sbjct: 790 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 845

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
           ATP-dependent nucleosome remodeling activity, member of
           the Chromodomain-Helicase-DNA-binding (CHD) family [4407
           bp, 1468 aa]
          Length = 1468

 Score =  221 bits (564), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 232/476 (48%), Gaps = 40/476 (8%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q +A +  L+    Q  P     IIV P S +  W +   KW      
Sbjct: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGP----HIIVVPLSTMPAWLDTFEKWA----- 448

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWAL-----ARGRSVVK-PVLIISYETLRRNVEHLNNC 473
              P       + N      +R +       A+G+  +K  VL+ +YE + ++   L + 
Sbjct: 449 ---PDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSI 505

Query: 474 EIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 533
           +   +  DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 506 KWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFT 565

Query: 534 TRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKY 593
              E   +FEN           D E     E +  L   +  FI+RR    + K LP K 
Sbjct: 566 IDQEI--DFEN----------QDEE---QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKT 610

Query: 594 EHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPED 653
           E +L V L   Q   Y+ +L      L           L  +  LKK  NHP L      
Sbjct: 611 ERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLF----- 665

Query: 654 VEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQT 713
            + +E+ + + + +  +++          SGK  +L++ L ++K +   +++I S   + 
Sbjct: 666 -DNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRM 723

Query: 714 LDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGA 773
           LD++            RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+ A
Sbjct: 724 LDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTA 783

Query: 774 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           + +++ D DWNP AD QA+AR  R GQK    +YR +   T+EE++ +R   KM L
Sbjct: 784 DTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 839

>Scas_665.17
          Length = 1060

 Score =  220 bits (560), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 155/485 (31%), Positives = 238/485 (49%), Gaps = 51/485 (10%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409
           +S +      I+ADEMGLGKTLQ I+ L  L        P     +IV P S ++NW  E
Sbjct: 149 ISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKKIDGP----FLIVVPKSTLDNWRRE 204

Query: 410 IVKWLGKGTLASLPIDGKKSSLNN---GTVAQAVRGWALARGRSVVKPVLIISYETLRRN 466
             KW  +  + ++ + G K   +      V +A               VLI SYE + + 
Sbjct: 205 FNKWTPE--VNAIVLHGDKEERHKILYDIVLEAKFD------------VLITSYEMVIKE 250

Query: 467 VEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNF 526
              L       ++ DE HR+KN +SQ    +       R++++GTP+QN+L E +ALLNF
Sbjct: 251 KNVLKKFAWQYIVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPLQNNLHELWALLNF 310

Query: 527 SNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILS 586
             P + G    F   FE      ++    D EI      +Q L T+++ F++RR    + 
Sbjct: 311 LLPDVFGDSGIFDEWFE------QNNSEQDQEIV-----VQQLHTVLNPFLLRRIKADVE 359

Query: 587 KYLPCKYEHVLFVNLKPFQRSVYELMLK--CRDVKLAVKDGTTPSQPLKHIGALKKLCNH 644
           K L  K E  ++V +   Q   Y+ +L+     V  AV      ++ L  +  L+K CNH
Sbjct: 360 KSLLPKIETNVYVGMTEMQVKWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNH 419

Query: 645 PDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKI 704
           P L       EG+E   P  Y           E   + +GK  +L++ L ++K E   ++
Sbjct: 420 PYLF------EGAEPGPP--YTTD--------EHLVFNAGKMIVLDKLLKRLK-EKGSRV 462

Query: 705 VIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAG 764
           +I S  ++ LD++E  C    Y   R+DG+     R + +D +N     +F+FLL+++AG
Sbjct: 463 LIFSQMSRLLDILEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAG 522

Query: 765 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQS 824
           G GINL+ A+ +IL D DWNP AD QA+ R  R GQKK   +YRF+    IEEK+ +R +
Sbjct: 523 GLGINLVTADTVILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAA 582

Query: 825 MKMSL 829
            K+ L
Sbjct: 583 QKLRL 587

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  220 bits (560), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 154/483 (31%), Positives = 242/483 (50%), Gaps = 47/483 (9%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTL-LRQGPQGKPTIDKCIIVCPSSLVNNWAN 408
           +S +      I+ADEMGLGKTLQ I+ L  L   +G +G       I++ P S ++NW  
Sbjct: 148 ISLHESKLSGILADEMGLGKTLQSISFLGYLRYIKGIEG-----PYIVIVPKSTLDNWQR 202

Query: 409 EIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVE 468
           E  KW  +  + ++ + G K         + +         +    VLI SYE + +   
Sbjct: 203 EFAKWTPE--VKTVILQGDKDFRKELIETKIL---------TCNFDVLITSYEMVLKEKL 251

Query: 469 HLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 528
            L       +L DE HR+KN +S     +       R++++GTP+QN+L E +ALLNF  
Sbjct: 252 TLKRFAWEYILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGTPLQNNLHELWALLNFLL 311

Query: 529 PGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKY 588
           P + G    F   F+      ++    D E+      +Q L +++  F++RR    + K 
Sbjct: 312 PDVFGDSEVFDEWFQ------QNGKEEDQEVV-----VQQLHSVLQPFLLRRVKSEVEKS 360

Query: 589 LPCKYEHVLFVNLKPFQRSVYELMLK--CRDVKLAVKDGTTPSQPLKHIGALKKLCNHPD 646
           L  K E  L+V +   Q   Y+ +L+     V  AV      ++ L  +  L+K CNHP 
Sbjct: 361 LLPKKEINLYVGMTDMQIEWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPY 420

Query: 647 LLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVI 706
           L       EG+E   P  Y           E   + SGK  +L++ L K K E   +++I
Sbjct: 421 LF------EGAEPGPP--YTTD--------EHLVFNSGKMIVLDK-LLKKKKEQGSRVLI 463

Query: 707 ISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGC 766
            S  ++ LD++E  C    Y   R+DG+ + ++R + +D +N    ++FIFLL+++AGG 
Sbjct: 464 FSQMSRLLDILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGL 523

Query: 767 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMK 826
           GINL+ A+ ++L D DWNP AD QA+ R  R GQKK  F+YRF+    IEEK+ +R + K
Sbjct: 524 GINLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQK 583

Query: 827 MSL 829
           + L
Sbjct: 584 LRL 586

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  219 bits (559), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 150/486 (30%), Positives = 243/486 (50%), Gaps = 53/486 (10%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLR----QGPQGKPTIDKCIIVCPSSLVNN 405
           +S +      I+ADEMGLGKTLQ I+ L  L      +GP         +++ P S ++N
Sbjct: 145 ISLHENKISGILADEMGLGKTLQTISFLGYLRYVKKIEGP--------FLVIVPKSTLDN 196

Query: 406 WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRR 465
           W  E  KW     +++  + G K    +  + Q +    +   R     VLI SYE + R
Sbjct: 197 WRREFFKWTP--NVSTTVLQGTKEQRQD--ILQNI----VLEARF---DVLITSYEMVIR 245

Query: 466 NVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLN 525
              +L       ++ DE HR+KN +S     +       R++++GTP+QN+L E +ALLN
Sbjct: 246 EKGYLKRLAWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLN 305

Query: 526 FSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDIL 585
           F  P + G    F   F+      ++    D E+      +Q L  +++ F++RR    +
Sbjct: 306 FLLPDVFGDSEVFDDWFQ------QNNSDQDQEVV-----VQQLHAVLNPFLLRRIKADV 354

Query: 586 SKYLPCKYEHVLFVNLKPFQRSVYELMLK--CRDVKLAVKDGTTPSQPLKHIGALKKLCN 643
            K L  K E  ++V +   Q   Y+ +L+     V  AV      ++ L  +  L+K CN
Sbjct: 355 EKSLLPKIETNVYVGMTDMQVQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCN 414

Query: 644 HPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDK 703
           HP L       EG+E   P  Y           E   + +GK  +L++ L ++K E   +
Sbjct: 415 HPYLF------EGAEPGPP--YTTD--------EHLIFNAGKMIVLDKLLKRLK-EKGSR 457

Query: 704 IVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKA 763
           ++I S  ++ LD++E  C   +Y   R+DG+ +  +R   +D +N    ++F+FLL+++A
Sbjct: 458 VLIFSQMSRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRA 517

Query: 764 GGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQ 823
           GG GINL+ A+ ++L D DWNP AD QA+ R  R GQKK   +YRF+    IEEK+ +R 
Sbjct: 518 GGLGINLVTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERA 577

Query: 824 SMKMSL 829
           + K+ L
Sbjct: 578 AQKLRL 583

>Kwal_34.15925
          Length = 1025

 Score =  218 bits (555), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 156/477 (32%), Positives = 235/477 (49%), Gaps = 55/477 (11%)

Query: 360 IMADEMGLGKTLQCIALLWTLLR----QGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLG 415
           I+ADEMGLGKTLQ IA L  L       GP         I++ P S +NNW  E  KW  
Sbjct: 151 ILADEMGLGKTLQTIAFLGYLRYLKDIDGPH--------IVIVPKSTLNNWKREFSKWTP 202

Query: 416 KGTLASLPIDG-KKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCE 474
           +     L  D  ++  L    V +                VLI SYE + +    L    
Sbjct: 203 EVEAVVLSGDKEERQHLLKDIVLECKF------------DVLITSYEMVIKEKSTLKRFM 250

Query: 475 IGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 534
              ++ DE HR+KN +S     +   +   R++++GTP+QN+L E +ALLNF  P + G 
Sbjct: 251 WQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRLLITGTPLQNNLHELWALLNFLLPDVFGD 310

Query: 535 RSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYE 594
              F R FE      +D D            +Q L T++S F++RR    +   L  K E
Sbjct: 311 SDAFDRWFEQSD-TEKDQDVV----------VQQLHTVLSPFLLRRLKSEVETSLLPKIE 359

Query: 595 HVLFVNLKPFQRSVYELMLK--CRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPE 652
             L+V +   Q   Y+ +L+     V  A+      ++ L  +  L+K CNHP L     
Sbjct: 360 TNLYVGMTDMQVQWYKSLLEKDLDAVNGAIGKREGNTRLLNIVMQLRKCCNHPYLF---- 415

Query: 653 DVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQ 712
             EG+E   P  Y           E   + +GK  +L++ L K K E+  +++I S  ++
Sbjct: 416 --EGAEPGPP--YTTD--------EHLIFNAGKMIVLDK-LLKKKKEAGSRVLIFSQMSR 462

Query: 713 TLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIG 772
            LD++E  C    Y   R+DG+    +R + +D+FN+   ++FIFLL+++AGG GINL+ 
Sbjct: 463 LLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTRAGGLGINLVT 522

Query: 773 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           A+ +++ D DWNP AD QA+ R  R GQKK   +YRF+    IEEK+ +R + K+ L
Sbjct: 523 ADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRL 579

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
           Saccharomyces cerevisiae YER164w CHD1 transcriptional
           regulator, start by similarity
          Length = 1476

 Score =  218 bits (554), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 149/478 (31%), Positives = 230/478 (48%), Gaps = 44/478 (9%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGK--- 416
           I+ADEMGLGKT+Q +A +  L+    Q  P     ++V P S +  W     KW      
Sbjct: 413 ILADEMGLGKTVQTVAFISWLIFARRQNGP----HLVVVPLSTMPAWIETFEKWAPDIDV 468

Query: 417 ----GTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVK-PVLIISYETLRRNVEHLN 471
               G   S  I+ +    +N             +G+  +K  VL+ +YE + ++   L 
Sbjct: 469 ICYMGNQKSRDIEREYEFYSNPK----------GKGKKQIKFNVLMTTYEYILKDRAELG 518

Query: 472 NCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL 531
           + +   L  DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG 
Sbjct: 519 SIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGR 578

Query: 532 LGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPC 591
                E   +FEN           D E     + ++ L   +  FI+RR    + K LP 
Sbjct: 579 FTIDQEI--DFEN----------QDEE---QEQYIRDLHKRLQPFILRRLKKDVEKSLPS 623

Query: 592 KYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLP 651
           K E +L V L   Q   Y+ +L      L           L  +  L K  NHP L    
Sbjct: 624 KTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLF--- 680

Query: 652 EDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYT 711
              + +E+ + E +    +S+          SGK  +L++ L ++K +   +++I S   
Sbjct: 681 ---DSAEEKVLEKFGAGNMSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMV 736

Query: 712 QTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLI 771
           + LD++            RLDGT+  N+R+  +D FN     +F+FLLS++AGG GINL+
Sbjct: 737 RILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLM 796

Query: 772 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            A+ +I+ D DWNP AD QA+AR  R GQK    +YR +   T+EE++ +R   KM L
Sbjct: 797 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMIL 854

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  217 bits (553), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 152/479 (31%), Positives = 239/479 (49%), Gaps = 45/479 (9%)

Query: 360  IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
            I+ADEMGLGKT+Q I+LL  L        P     +I+ P S + NW++E  KW  K  L
Sbjct: 824  ILADEMGLGKTIQTISLLTYLYEMKNIKGP----FLIIVPLSTLPNWSSEFAKWAPK--L 877

Query: 420  ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
             ++   G  +           R    A+ +S     +I ++E + +    L+  +   ++
Sbjct: 878  RTISYKGSPNE----------RKMKQAQIKSGEFDAVITTFEYIIKERAILSKVKWVHMI 927

Query: 480  ADEGHRLKNAESQTFTALDSI-NCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
             DEGHR+KNA+S+    L++  +   R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 928  IDEGHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAKSF 987

Query: 539  RRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLF 598
               F  P   +   D  +    +    ++ L  ++  F++RR    + K LP K E V+ 
Sbjct: 988  DEWFNTPFANTGGQDKIELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIK 1047

Query: 599  VNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPL-------KHIGALKKLCNHPDLLQLP 651
              +   Q ++Y+ MLK + + +    G      L         +  LKK+CNHP +    
Sbjct: 1048 CKMSALQHAMYQQMLKHKQLFI----GDQKKNKLVGLRGFNNQLMQLKKICNHPFVF--- 1100

Query: 652  EDVEGSEDVIPEDYRNSTLSKRGHAEVQTW-YSGKFSILNRFLHKIKTESDDKIVIISNY 710
                  E+V  ED+ N T        +  W  +GKF +L R L K+K  S  +++I    
Sbjct: 1101 ------EEV--EDHINPTRD----TNMNIWRVAGKFELLERILPKLKA-SRHRVLIFFQM 1147

Query: 711  TQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINL 770
            TQ +D++E   R      +RLDG    ++R +L+  FND   + F F+LS++AGG G+NL
Sbjct: 1148 TQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLGLNL 1207

Query: 771  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I T ++EE I +R   K+ +
Sbjct: 1208 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKLDI 1266

>Kwal_14.1600
          Length = 1102

 Score =  216 bits (551), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 150/483 (31%), Positives = 240/483 (49%), Gaps = 47/483 (9%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409
           VS +R     I+ADEMGLGKTLQ I+ L  L     +  P     +++ P S +NNW  E
Sbjct: 148 VSLHRNNLAGILADEMGLGKTLQTISFLGYLRYVEKKPGP----FVVIAPKSTLNNWLRE 203

Query: 410 IVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEH 469
           I +W     + +  + G K        A+ V    +A    +V    + SYE + +    
Sbjct: 204 INRWTP--DVRAFILQGDKEER-----AKLVANKLMACDFDIV----VASYEIIIKEKAS 252

Query: 470 LNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 529
                   ++ DE HR+KN ES     L       R++++GTP+QN+L E +ALLNF  P
Sbjct: 253 FKKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLP 312

Query: 530 GLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRR-TNDILSKY 588
            +      F   F           +  SE  KG + ++ L T++  F++RR  N++ +  
Sbjct: 313 DVFSDSQAFDDWF----------SSESSEDDKG-KIVKQLHTVLQPFLLRRLKNEVETSL 361

Query: 589 LPCKYEHVLFVNLKPFQRSVYELMLK--CRDVKLAVKDGTTPSQPLKHIGALKKLCNHPD 646
           LP K E  L++ +   Q+  Y+ +L+     V  A  +  + ++ L  +  L+K CNHP 
Sbjct: 362 LPKK-ELNLYIGMSSMQKRWYKQILEKDIDAVNGANGNKESKTRLLNVMMQLRKCCNHPY 420

Query: 647 LLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVI 706
           L       +G+E   P  Y           E   + S K  +L++ L K K E   +++I
Sbjct: 421 LF------DGAEPGPP--YTTD--------EHLVYNSAKLKVLDKLLRKFKEEGS-RVLI 463

Query: 707 ISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGC 766
            S  ++ LD++E  C    Y   R+DG+     R + +D +N  + ++F+FLL+++AGG 
Sbjct: 464 FSQMSRVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRAGGL 523

Query: 767 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMK 826
           GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R +   ++EEKI +R + K
Sbjct: 524 GINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERATQK 583

Query: 827 MSL 829
           + L
Sbjct: 584 LRL 586

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
           cerevisiae YER164w CHD1 transcriptional regulator, start
           by similarity
          Length = 1525

 Score =  217 bits (552), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 150/475 (31%), Positives = 238/475 (50%), Gaps = 38/475 (8%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q ++ +  L+    Q  P     ++V P S +  W     KW     L
Sbjct: 410 ILADEMGLGKTVQTVSFISWLIYARRQNGP----HLVVVPLSTMPAWQETFDKWAP--GL 463

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWA--LARGRSVVK-PVLIISYETLRRNVEHLNNCEIG 476
             +   G ++S +   + Q    +    A+G+  +K  VL+ +YE + ++   L + +  
Sbjct: 464 NCVYYMGNQASRD---LIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTLGSIKWQ 520

Query: 477 LLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRS 536
            L  DE HRLKNAES  + +L+S     R++++GTP+QN++ E  AL+NF  PG      
Sbjct: 521 FLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTIDQ 580

Query: 537 EFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHV 596
           E   +FEN             +  +  E ++ L   +  FI+RR    + K LP K E +
Sbjct: 581 EI--DFEN-------------QDEQQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERI 625

Query: 597 LFVNLKPFQRSVYELMLKCRDVKL--AVKDGTTPSQPLKHIGALKKLCNHPDLLQLPEDV 654
           L V L   Q   Y+ +L      L   +K G      L  +  LKK  NHP L       
Sbjct: 626 LRVELSDVQTEYYKNILTKNYSALTSGIKGGHV--SLLNVMNELKKASNHPYLF------ 677

Query: 655 EGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTL 714
           + +E+ +   + +   S+          SGK  +L++ L ++K +   +++I S   + L
Sbjct: 678 DNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMVRIL 736

Query: 715 DVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGAN 774
           D++            RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+ A+
Sbjct: 737 DILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLMTAD 796

Query: 775 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            +I+ D DWNP AD QA+AR  R GQK    +YRF+   T+EE++ +R   KM L
Sbjct: 797 TVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 851

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  216 bits (550), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 150/475 (31%), Positives = 234/475 (49%), Gaps = 36/475 (7%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I+L+  L        P     +++ P S + NW  E  KW    T 
Sbjct: 479 ILADEMGLGKTIQSISLITYLYEVKKDSGP----FLVIVPLSTITNWTLEFEKWAPSLT- 533

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
                    + +  GT  Q  R     + R     VL+ +YE + ++   L   E   ++
Sbjct: 534 ---------TVIYKGTPNQ--RRSLQHQVRIGDFDVLLTTYEYIIKDRSLLAKHEWSHMI 582

Query: 480 ADEGHRLKNAESQ-TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
            DEGHR+KNA+S+ ++T         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 583 IDEGHRMKNAQSKLSYTLTHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIFNSSKTF 642

Query: 539 RRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLF 598
              F  P   +   +  +    +    ++ L  ++  F++RR    + K LP K E V+ 
Sbjct: 643 DEWFNTPFSNTGGQEKLELTEEEALLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVK 702

Query: 599 VNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLK----HIGALKKLCNHPDLLQLPEDV 654
             L   Q  +Y+ MLK   + +           +K     I  L+K+CNHP +    ++V
Sbjct: 703 CKLSGLQHQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVF---DEV 759

Query: 655 EGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTL 714
           EG   V+     NS+L  R         SGKF +L+R L K K  +  ++++    TQ +
Sbjct: 760 EG---VVNPTRTNSSLLYR--------VSGKFELLDRVLPKFKA-TGHRVLMFFQMTQVM 807

Query: 715 DVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGAN 774
           D++E   +  +   +RLDG     +R  +++ FN  +   F FLLS++AGG G+NL  A+
Sbjct: 808 DIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTAD 867

Query: 775 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            +I+ D DWNP  D QA  R  R GQK +  I R I T ++EE I +R   K+ +
Sbjct: 868 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDI 922

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  215 bits (548), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 155/479 (32%), Positives = 236/479 (49%), Gaps = 44/479 (9%)

Query: 360  IMADEMGLGKTLQCIALLWTLLR-QGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGT 418
            I+ADEMGLGKT+Q I+LL  L   +G  G       +++ P S + NW  E  KW    T
Sbjct: 583  ILADEMGLGKTIQTISLLTYLYEFKGIHGP-----FLVIVPLSTLTNWNAEFDKW--APT 635

Query: 419  LASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLL 478
            L  L   G  S        +A+ G   +    VV    + ++E + +    L+  +   +
Sbjct: 636  LRKLAFKGPPSE------RKALSGIIKSGNFDVV----LTTFEYIIKERPLLSKVKWVHM 685

Query: 479  LADEGHRLKNAESQTFTALDSI-NCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSE 537
            + DEGHR+KNA+S+    L+   +   R+IL+GTP+QN+L E +ALLNF  P +  +   
Sbjct: 686  IIDEGHRMKNAQSKLSLTLNQYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKS 745

Query: 538  FRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVL 597
            F   F  P   +   D  +    +    ++ L  ++  F++RR    + K LP K E VL
Sbjct: 746  FDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVL 805

Query: 598  FVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPL------KHIGALKKLCNHPDLLQLP 651
               +   Q+ +YE MLK R  +L V D  +  + +        I  LKK+CNHP + +  
Sbjct: 806  KCRMSALQQKLYEQMLKHR--RLFVVDDPSSKKMVGLRGFNNQIMQLKKICNHPFVFEEV 863

Query: 652  EDVEGSEDVIPEDYRNSTLSKRGHAEVQTW-YSGKFSILNRFLHKIKTESDDKIVIISNY 710
            ED      + P    N+ +          W  +GKF +L + L K K  S  +++I    
Sbjct: 864  ED-----QINPNRETNANI----------WRVAGKFELLEKILPKFKA-SGHRVLIFFQM 907

Query: 711  TQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINL 770
            TQ +D++E   R      +RLDG    + R  L+++FN      F FLLS++AGG G+NL
Sbjct: 908  TQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFNAPGSDYFCFLLSTRAGGLGLNL 967

Query: 771  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I   ++EE I +R   K+ +
Sbjct: 968  QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEVILERAHRKLDI 1026

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  215 bits (547), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 167/530 (31%), Positives = 251/530 (47%), Gaps = 86/530 (16%)

Query: 358  GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKG 417
             CI+AD+MGLGKT Q I+  +  L+Q  +  P     ++V PSS + NW  E  K+    
Sbjct: 592  SCILADDMGLGKTCQVISF-FAYLKQINEPGP----HLVVVPSSTLENWLREFQKFA--- 643

Query: 418  TLASLPIDGKKSSL------------NNGTVAQAVRGWALARGRSVVKPVLIISYETLRR 465
               +L I+    SL            N G     V  + LA G               + 
Sbjct: 644  --PALKIEPYYGSLQEREELRDILERNAGKYDVIVTTYNLAAGN--------------KY 687

Query: 466  NVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLN 525
            +V  L N    +++ DEGH LKN+ S+ F  L  I    R++L+GTP+QN+L E  +LL 
Sbjct: 688  DVSFLKNRNFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKELMSLLE 747

Query: 526  FSNPGLLGTRSE-FRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDI 584
            F  P L  ++ E F   F+     + D    +  +A+  E +    T++  FI+RR  D 
Sbjct: 748  FIMPNLFISKKESFDAIFKQRAKTTDDNKNHNPLLAQ--EAITRAKTMMKPFILRRRKDQ 805

Query: 585  LSKYLPCKYEHVLFVNLKPFQRSVYELMLK-CRDVKLAVKDGTTPSQPLKH--------- 634
            + K+LP K+ H+ +  L   Q+ +Y+  ++   + K  +KDG  P    +          
Sbjct: 806  VLKHLPPKHTHIQYCELNAIQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQSSSSK 865

Query: 635  --IGALKKLCNHPDL-----------------LQLPEDVE-GSEDVIPEDYRN------- 667
              I AL+K   HP L                 L  P   E G+++ I ED          
Sbjct: 866  NLIMALRKASLHPLLFRNIYNDKIITKMSDAILDEPAYAENGNKEYIKEDMSYMTDFELH 925

Query: 668  -------STLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERM 720
                   +TLSK      +   SGK   L + L  I  +  +K++I S +TQ LD++E +
Sbjct: 926  KLCCNFPNTLSKYQLHNDEWMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMV 985

Query: 721  CRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEF-IFLLSSKAGGCGINLIGANRLILM 779
              T  Y  +RLDG+  +N RQ L+D+F   E ++  IF+LS+KAGG GINL+ AN +I+ 
Sbjct: 986  LSTLDYKFLRLDGSTQVNDRQLLIDKF--YEDKDIPIFILSTKAGGFGINLVCANNVIIF 1043

Query: 780  DPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            D  +NP  D+QA  R  R GQ K+  I   I   +IEEKI+Q    K++L
Sbjct: 1044 DQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIHQLAKNKLAL 1093

>Kwal_26.9164
          Length = 1454

 Score =  215 bits (547), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 160/492 (32%), Positives = 243/492 (49%), Gaps = 71/492 (14%)

Query: 360  IMADEMGLGKTLQCIALLWTLLR----QGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLG 415
            I+ADEMGLGKT+Q I+LL  L      +GP         +++ P S + NW +E  KW  
Sbjct: 624  ILADEMGLGKTIQTISLLTYLYEVKNVRGP--------SLVIVPLSTLTNWDSEFDKWA- 674

Query: 416  KGTLASLPIDGK---KSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNN 472
                   P+  K   K S N     Q +        RS    V++ ++E + +    L+ 
Sbjct: 675  -------PVIRKVAYKGSPNERKSKQGI-------IRSGQFDVVLTTFEYIIKERALLSK 720

Query: 473  CEIGLLLADEGHRLKNAESQ-TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL 531
             +   ++ DEGHR+KNA+S+ + T  +  +   R+IL+GTP+QN+L E +ALLNF  P +
Sbjct: 721  IKWVHMIIDEGHRMKNAQSKLSLTLNNYYHTDYRLILTGTPLQNNLPELWALLNFVLPKI 780

Query: 532  LGTRSEFRRNFENPILLSRDADATDSEIAKGNEK----LQALSTIVSKFIIRRTNDILSK 587
              +   F   F  P   +   D    +IA   E+    ++ L  ++  F++RR    + K
Sbjct: 781  FNSVKSFDEWFNTPFANTGGQD----KIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEK 836

Query: 588  YLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIG---------AL 638
             LP K E VL   +   Q+ +YE MLK R  +L + D  +     K++G          L
Sbjct: 837  ELPDKVEKVLKCKMSALQQKLYEQMLKHR--RLFIGDLNSN----KNVGMRGFNNQIMQL 890

Query: 639  KKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTW-YSGKFSILNRFLHKIK 697
            KK+CNHP + +  ED      + P    N+ +          W  +GKF +L R L K K
Sbjct: 891  KKICNHPFVFEEVED-----QINPTRETNANI----------WRVAGKFELLERILPKFK 935

Query: 698  TESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIF 757
              +  +I+I    TQ +D++E   R S+   +RLDG    + R  L++ FN    + F F
Sbjct: 936  A-TGHRILIFFQMTQIMDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLNLFNAPNSEYFCF 994

Query: 758  LLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEE 817
            LLS++AGG G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I   ++EE
Sbjct: 995  LLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITENSVEE 1054

Query: 818  KIYQRQSMKMSL 829
             I  R   K+ +
Sbjct: 1055 VILDRAHKKLDI 1066

>Kwal_23.4777
          Length = 1301

 Score =  214 bits (545), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 148/475 (31%), Positives = 232/475 (48%), Gaps = 36/475 (7%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I+L+  L     +  P     +++ P S + NW  E  KW    +L
Sbjct: 478 ILADEMGLGKTIQSISLITYLRETKNEPGP----FLVIVPLSTITNWTLEFEKW--APSL 531

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
           A++   G  +     ++   +R             VL+ +YE + ++   L   +   ++
Sbjct: 532 ATIVYKGTPNQ--RKSMQHQIRIGNFE--------VLLTTYEYIIKDRSLLAKHDWSHMI 581

Query: 480 ADEGHRLKNAESQ-TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
            DEGHR+KNA+S+ +FT         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 582 IDEGHRMKNAQSKLSFTLTRYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTF 641

Query: 539 RRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLF 598
              F  P   +   +  +    +    ++ L  ++  F++RR    + K LP K E V+ 
Sbjct: 642 DEWFNTPFANTGGQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVVK 701

Query: 599 VNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLK----HIGALKKLCNHPDLLQLPEDV 654
             L   Q  +Y+ MLK   +             +K     I  L+K+CNHP +    ++V
Sbjct: 702 CKLSGLQHQLYQQMLKHNALFFGAGTEGATKGGIKGLNNKIMQLRKICNHPFVF---DEV 758

Query: 655 EGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTL 714
           EG   +I     NS L  R         +GKF +L+R L K K  +  ++++    TQ +
Sbjct: 759 EG---IINPSRANSPLLYR--------VAGKFELLDRILLKFKV-TGHRVLMFFQMTQVM 806

Query: 715 DVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGAN 774
           D++E   R      +RLDG      R  ++  FN    + F FLLS++AGG G+NL  A+
Sbjct: 807 DIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPNSEYFCFLLSTRAGGLGLNLQTAD 866

Query: 775 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            +I+ D DWNP  D QA  R  R GQK +  I R I T ++EE I +R   K+ +
Sbjct: 867 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERALQKLDI 921

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  214 bits (544), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 148/477 (31%), Positives = 240/477 (50%), Gaps = 41/477 (8%)

Query: 360  IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
            I+ADEMGLGKT+Q I+LL  L        P     +++ P S ++NW++E  KW    TL
Sbjct: 789  ILADEMGLGKTIQTISLLTYLYEMKNIRGP----YLVIVPLSTLSNWSSEFAKW--APTL 842

Query: 420  ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
             ++   G  +           R    A+ R+    V++ ++E + +    L+  +   ++
Sbjct: 843  RTISFKGSPNE----------RKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMI 892

Query: 480  ADEGHRLKNAESQTFTALDS-INCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
             DEGHR+KNA+S+    L++  +   R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 893  IDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSF 952

Query: 539  RRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLF 598
               F  P   +   D  +    +    ++ L  ++  F++RR    + K LP K E V+ 
Sbjct: 953  DEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVK 1012

Query: 599  VNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQP-----LKHIGALKKLCNHPDLLQLPED 653
              +   Q+ +Y+ MLK R  +L + D               I  LKK+CNHP + +  ED
Sbjct: 1013 CKMSALQQIMYQQMLKYR--RLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEVED 1070

Query: 654  VEGSEDVIPEDYRNSTLSKRGHAEVQTW-YSGKFSILNRFLHKIKTESDDKIVIISNYTQ 712
                  + P    N  +          W  +GKF +L+R L K+K  +  +++I    TQ
Sbjct: 1071 -----QINPTRETNDDI----------WRVAGKFELLDRILPKLKA-TGHRVLIFFQMTQ 1114

Query: 713  TLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIG 772
             +D++E   R  +   +RLDG    ++R +L+  FN  + +   F+LS++AGG G+NL  
Sbjct: 1115 IMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQT 1174

Query: 773  ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I T ++EE I +R   K+ +
Sbjct: 1175 ADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDI 1231

>Scas_548.4
          Length = 1054

 Score =  212 bits (540), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 165/531 (31%), Positives = 254/531 (47%), Gaps = 88/531 (16%)

Query: 358  GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKG 417
             CI+AD+MGLGKT Q I+  +  L+Q  +  P +    +V PSS + NW  E  K+    
Sbjct: 516  SCILADDMGLGKTCQVISF-FAYLKQINEPGPHL----VVVPSSTLENWLREFQKFCP-- 568

Query: 418  TLASLPIDGKKSSLNN---------GTVAQAVRGWALARGRSVVKPVLIISYETLRRNVE 468
            TL   P  G ++   +         G     V  + LA G               + +V 
Sbjct: 569  TLKIEPYYGSQNERADLREILERTAGQYDVIVTTYNLAAGN--------------KYDVS 614

Query: 469  HLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 528
             L N +  +++ DEGH LKN+ S+ F  L  I    R++L+GTP+QN+L E  +LL F  
Sbjct: 615  FLRNRQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLRELMSLLEFIM 674

Query: 529  PGLLGTRSEFRRNFENPILLSRDADATDSEIAKGN------EKLQALSTIVSKFIIRRTN 582
            P L  ++ E   +     +  + A  TD    KG+      E ++   T++  FI+RR  
Sbjct: 675  PALFISKKESLAS-----VFKQRAKTTDDN--KGHNPLLVQEAIERAKTMMKPFILRRRK 727

Query: 583  DILSKYLPCKYEHVLFVNLKPFQRSVYELMLK-CRDVKLAVKDGTTPSQPLKH------- 634
            D + K+LP K+  + +  ++  QR +Y+  +K   + K  + DGT P  P +        
Sbjct: 728  DQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMILDGTLPDDPKERAKIQSSS 787

Query: 635  ----IGALKKLCNHPDLLQL-----------------PE-DVEGSEDVIPEDYRN----- 667
                I  L+K   HP L +                  P+  V+G+ + I ED        
Sbjct: 788  SSNLIMTLRKAALHPLLFRTIYNDALIAKMSKAIINEPQYKVDGNIEFIKEDMSVMTDFE 847

Query: 668  ---------STLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIE 718
                     +TLS+      +   SGK   L R L +I  E  +K++I S +TQ LD++E
Sbjct: 848  LHRLCLNFPNTLSRYQLKNKEWMNSGKVDTLCRLLKEIIFERKEKVLIFSLFTQVLDILE 907

Query: 719  RMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLIL 778
             +    +Y  +RLDG+  +N RQ L+D+F + +    IF+LS+KAGG GINL+ AN +I+
Sbjct: 908  LVLSELNYKFLRLDGSTQVNDRQSLIDKFYEDDTIP-IFILSTKAGGFGINLVCANNVII 966

Query: 779  MDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
             D  +NP  D+QA  R  R GQ K+  I   I   +IEEKI+Q    K++L
Sbjct: 967  FDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQLAKNKLAL 1017

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, start by similarity
          Length = 1344

 Score =  213 bits (541), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 152/479 (31%), Positives = 243/479 (50%), Gaps = 44/479 (9%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I+L+  L     + +P     +++ P S + NW  E  KW    +L
Sbjct: 535 ILADEMGLGKTIQSISLISYLYEIKNERQP----FLVIVPLSTITNWTIEFEKW--APSL 588

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
            ++   G      N    +A++   +  G      V++ +YE + ++   L   +   ++
Sbjct: 589 RTIVYKG------NPNQRKALQH-TIKMGNF---DVVLTTYEYIIKDRPLLAKHDWAHMI 638

Query: 480 ADEGHRLKNAESQ-TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
            DEGHR+KNA+S+ ++T         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 639 IDEGHRMKNAQSKLSYTLTHYYKTKNRLILTGTPLQNNLPELWALLNFVLPKIFNSSKTF 698

Query: 539 RRNFENPILLSRDADATDSEIAKGNEK----LQALSTIVSKFIIRRTNDILSKYLPCKYE 594
              F  P   +     T  ++    E+    ++ L  ++  F++RR    + K LP K E
Sbjct: 699 DEWFNTPFANT----GTQEKLEMTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVE 754

Query: 595 HVLFVNLKPFQRSVYELMLKCRDVKL-AVKDGTTPS--QPLKH-IGALKKLCNHPDLLQL 650
            V+   L   Q+ +YE MLK     + A  +G T +  + L + +  L+K+CNHP +   
Sbjct: 755 KVVKCKLSSLQQQLYEQMLKHNAFFIGAGTEGATKAGIKGLNNKVMQLRKICNHPFVF-- 812

Query: 651 PEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNY 710
               +  E+VI     NS++  R         SGKF +L+R L K K  S  ++++    
Sbjct: 813 ----DEVENVINPTRENSSILYR--------VSGKFELLDRVLPKFKA-SGHRVLMFFQM 859

Query: 711 TQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINL 770
           TQ +D++E   R      +RLDG      R  ++  FN  + + F FLLS++AGG G+NL
Sbjct: 860 TQVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGGLGLNL 919

Query: 771 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
             A+ +I+ D DWNP  D QA  R  R GQK +  I R I T ++EE I +R   K+ +
Sbjct: 920 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDI 978

>Scas_594.7
          Length = 1703

 Score =  212 bits (539), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 149/481 (30%), Positives = 238/481 (49%), Gaps = 49/481 (10%)

Query: 360  IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
            I+ADEMGLGKT+Q I+LL  L     + K      +++ P S ++NW+NE  KW      
Sbjct: 835  ILADEMGLGKTIQTISLLTYLY----ETKHIHGPYLVIVPLSTLSNWSNEFAKWAPTMRC 890

Query: 420  ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
             S      K S N      A+        +S    V++ ++E + +    L+  +   ++
Sbjct: 891  ISY-----KGSPNERKSKHAI-------IKSGEFDVVLTTFEYIIKERALLSKVKWIHMI 938

Query: 480  ADEGHRLKNAESQTFTALDSI-NCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
             DEGHR+KNA+S+    L++  +   R+IL+GTP+QN+L E +ALLNF+ P +  +   F
Sbjct: 939  IDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFALPKIFNSVKSF 998

Query: 539  RRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLF 598
               F  P   +   D  +    +    ++ L  ++  F++RR    + K LP K E V+ 
Sbjct: 999  DEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIK 1058

Query: 599  VNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIG---------ALKKLCNHPDLLQ 649
              +   Q+ +Y+ MLK R  +L + D T      K +G          LKK+CNHP + +
Sbjct: 1059 CKMSALQQIMYQQMLKYR--RLFIGDHTNK----KMVGLRGFNNQLMQLKKICNHPFVFE 1112

Query: 650  LPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTW-YSGKFSILNRFLHKIKTESDDKIVIIS 708
              ED      + P    N+ +          W  +GKF +L + L K+K  +  +++I  
Sbjct: 1113 EVED-----QINPTRETNANI----------WRVAGKFELLEKVLPKLKA-TGHRVLIFF 1156

Query: 709  NYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGI 768
              TQ +D++E   R      +RLDG    + R  L+  FN  + +   F+LS++AGG G+
Sbjct: 1157 QMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLFNAPDSEYLCFILSTRAGGLGL 1216

Query: 769  NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMS 828
            NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I   ++EE I +R   K+ 
Sbjct: 1217 NLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITEHSVEEAILERAHKKLD 1276

Query: 829  L 829
            +
Sbjct: 1277 I 1277

>Scas_597.8
          Length = 1065

 Score =  210 bits (535), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 238/485 (49%), Gaps = 51/485 (10%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409
           VS ++     I+ADEMGLGKTLQ I+ L  L        P     +++ P S +NNW  E
Sbjct: 144 VSLHKSKLAGILADEMGLGKTLQTISFLGYLRYVEKIPGP----FLVIAPKSTLNNWLRE 199

Query: 410 IVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEH 469
           I KW  +  + +  + G K        AQ V+   LA    +V    + SYE + R    
Sbjct: 200 INKWTPE--VNAFILQGDKEER-----AQLVKDKLLACDFDIV----VASYEIIIREKSA 248

Query: 470 LNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 529
               +   ++ DE HR+KN ES     L       R++++GTP+QN+L E +ALLNF  P
Sbjct: 249 FRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQNNLHELWALLNFLLP 308

Query: 530 GLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRR-TNDILSKY 588
            +     +F   F      S +    D E       ++ L T++  F++RR  ND+ +  
Sbjct: 309 DIFSDSQDFDDWF------SSETTEEDQEKV-----VKQLHTVLQPFLLRRLKNDVETSL 357

Query: 589 LPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVK----DGTTPSQPLKHIGALKKLCNH 644
           LP K E  L+V +   Q+  Y+ +L+ +D+  AV     +  + ++ L  +  L+K CNH
Sbjct: 358 LP-KQELNLYVGMSNMQKKWYKQILE-KDID-AVNGSNVNKESKTRLLNIVMQLRKCCNH 414

Query: 645 PDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKI 704
           P L       +G+E   P              +    Y+     +   L K   E   ++
Sbjct: 415 PYLF------DGAEPGPP-----------YTTDEHLVYNSAKLKVLDKLLKKMKEEGSRV 457

Query: 705 VIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAG 764
           +I S  ++ LD++E  C    Y   R+DG+     R + +D +N+   ++FIFLL+++AG
Sbjct: 458 LIFSQMSRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTRAG 517

Query: 765 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQS 824
           G GINL  AN ++L D DWNP AD QA+ R  R GQK+   ++R +   ++EEKI +R +
Sbjct: 518 GLGINLTSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILERAT 577

Query: 825 MKMSL 829
            K+ L
Sbjct: 578 QKLRL 582

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
           (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  209 bits (533), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 161/527 (30%), Positives = 247/527 (46%), Gaps = 84/527 (15%)

Query: 359 CIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGT 418
           CI+ADEMGLGKT Q I+ L  L  Q   G       ++V PSS + NW  E  K+  +  
Sbjct: 492 CILADEMGLGKTCQVISFLAYLKEQNHTGP-----HLVVVPSSTLENWLREFKKFCPQ-- 544

Query: 419 LASLPIDGKKSSL---------NNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEH 469
           L   P  G +            N+G     V  + LA G               + +V  
Sbjct: 545 LKIEPYYGSQQERAELRDILEENDGQYDAIVTTYNLASGN--------------KADVSF 590

Query: 470 LNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 529
           L N +  +++ DEGH LKN+ S+ FT L  I+   R++L+GTP+QN+L E  +LL F  P
Sbjct: 591 LKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNLRELMSLLEFIMP 650

Query: 530 GLLGTRSEFRRNFENPILLSRDADATDSEIAK----GNEKLQALSTIVSKFIIRRTNDIL 585
            L  ++ +     E   +  + A  +DS          E +    TI+  FI+RR  D +
Sbjct: 651 SLFVSKKD-----ELAAVFKQRARTSDSNKDYNPLLAQEAIDRAKTIMKPFILRRRKDQV 705

Query: 586 SKYLPCKYEHVLFVNLKPFQRSVYELMLK-CRDVKLAVKDGTTPSQPLKH---------- 634
            K+LP K+ H+ + ++ P Q+++Y   ++   + +  V+DG  P+   +           
Sbjct: 706 LKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDAGERALVAQSTSKN 765

Query: 635 -IGALKKLCNHPDLL--QLPED--VEGSEDVIPE---------DYRNSTLSKRGHAEVQ- 679
            I AL+K   HP L      +D   E SE ++ E         DY    +S     E+  
Sbjct: 766 LIMALRKAAIHPLLFRHHYSDDRIAEMSERILAEPEYADSGNRDYIREDMSYMCDLELHR 825

Query: 680 ----------------TWY-SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCR 722
                           TW  SGK   L   L +      +K ++ S +TQ LD++E +  
Sbjct: 826 LCCRFPSLASFQLSEPTWMASGKVHRLQPLL-RAAIARREKTLVFSLFTQVLDILELVLS 884

Query: 723 TSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPD 782
           +     +RLDG+  +N RQ L+DRF+  +    +FLLS+KAGG GINL+ AN +I+ D  
Sbjct: 885 SLGIAFLRLDGSTPVNDRQALIDRFH-TDTDVPVFLLSTKAGGFGINLVCANHVIIFDQS 943

Query: 783 WNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           +NP  D+QA  R  R GQ ++  +   +   T+EEKI Q    K++L
Sbjct: 944 FNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLAL 990

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  211 bits (536), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 155/486 (31%), Positives = 236/486 (48%), Gaps = 58/486 (11%)

Query: 360  IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---LGK 416
            I+ADEMGLGKT+Q I+LL  L     + K      +++ P S + NW  E  KW   L K
Sbjct: 706  ILADEMGLGKTIQTISLLTYLY----EAKGVHGPFLVIVPLSTLTNWNAEFDKWAPKLRK 761

Query: 417  GTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIG 476
                  P++ K                AL + R     V++ ++E + +    L+  +  
Sbjct: 762  IAFKGPPMERKPKQ-------------ALIKNREF--DVVLTTFEYIIKERPLLSKIKWV 806

Query: 477  LLLADEGHRLKNAESQTFTALDSI-NCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 535
              + DEGHR+KNA+S+    L++  +   R+IL+GTP+QN+L E +ALLNF  P +  + 
Sbjct: 807  HTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSV 866

Query: 536  SEFRRNFENPILLSRDADATDSEIAKGNEK----LQALSTIVSKFIIRRTNDILSKYLPC 591
              F   F  P   +   D    +IA   E+    ++ L  ++  F++RR    + K LP 
Sbjct: 867  KSFDEWFNTPFANTGGQD----KIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPD 922

Query: 592  KYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPL-------KHIGALKKLCNH 644
            K E VL   +   Q  +Y+ MLK R  +L + D ++ +Q           I  L+K+CNH
Sbjct: 923  KVEKVLKCKMSALQHKLYQQMLKHR--RLFIFDDSS-NQKFSSSRGFNNQIMQLRKICNH 979

Query: 645  PDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYS-GKFSILNRFLHKIKTESDDK 703
            P + +  ED      + P    N T+          W S GKF +L R L K K  +  +
Sbjct: 980  PFVFEEVED-----QINPARETNDTI----------WRSAGKFELLERILPKFKA-TGHR 1023

Query: 704  IVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKA 763
            ++I    TQ +D++E   R      +RLDG    + R  L++ FN      F FLLS++A
Sbjct: 1024 VLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRA 1083

Query: 764  GGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQ 823
            GG G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I   ++EE I  + 
Sbjct: 1084 GGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKA 1143

Query: 824  SMKMSL 829
              K+ +
Sbjct: 1144 HAKLDI 1149

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  209 bits (531), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 153/482 (31%), Positives = 236/482 (48%), Gaps = 45/482 (9%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409
           +S +      I+ADEMGLGKTLQ I+ L  L        P     I+V P S ++NW  E
Sbjct: 140 ISLHENKLSGILADEMGLGKTLQTISFLGYLRFIKDIDGP----FIVVVPKSTLDNWKRE 195

Query: 410 IVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEH 469
             KW  +  + ++ + G +      T  Q +      R  +    VLI SYE + +    
Sbjct: 196 FAKWTPE--VNTIVLHGDRE-----TRTQLIE----ERILTCDFDVLITSYEMVIKEKAI 244

Query: 470 LNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 529
           L       ++ DE HR+KN +S     +       R++++GTP+QN+L E +ALLNF  P
Sbjct: 245 LKKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQNNLHELWALLNFLLP 304

Query: 530 GLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYL 589
            + G    F   F+      ++  A D EI      +Q L  ++  F++RR    + K L
Sbjct: 305 DVFGESEVFDEWFQ------QNEKAQDQEIV-----VQQLHAVLQPFLLRRVKADVEKSL 353

Query: 590 PCKYEHVLFVNLKPFQRSVYELMLK--CRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDL 647
             K E  ++V +   Q   Y  +L+     V  AV      ++ L  +  L+K CNHP L
Sbjct: 354 LPKIETNVYVGMTAMQLQWYRSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYL 413

Query: 648 LQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVII 707
                  EG+E   P  Y           E   + SGK  +L++ L + K E   +++I 
Sbjct: 414 F------EGAEPGPP--YTTD--------EHLIYNSGKMIVLDKLLKRKKKEGS-RVLIF 456

Query: 708 SNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCG 767
           S  ++ LD++E  C    +   R+DG  +  +R   +D FN  + ++FIFLL+++AGG G
Sbjct: 457 SQMSRLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLG 516

Query: 768 INLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKM 827
           INL+ A+ ++L D DWNP AD QA+ R  R GQKK   +YR +    IEEK+ +R + K+
Sbjct: 517 INLVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKL 576

Query: 828 SL 829
            L
Sbjct: 577 RL 578

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  209 bits (531), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 162/518 (31%), Positives = 244/518 (47%), Gaps = 69/518 (13%)

Query: 358  GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKG 417
             CI+ADEMGLGKT Q I+ L   L+Q     P     ++V PSS + NW  E  K+    
Sbjct: 522  SCILADEMGLGKTCQVISFL-AYLKQTHHNGP----HLVVVPSSTLENWLREFNKFCPH- 575

Query: 418  TLASLPIDGKKSSL---------NNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVE 468
             L   P  G +            N G     V  + LA G               + +V 
Sbjct: 576  -LKVEPYYGSQQERAELRDILEENEGQYDVIVTTYNLAAG--------------TKYDVS 620

Query: 469  HLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 528
             L N    +++ DEGH LKN+ S+ F  L  IN   R++L+GTP+QN+L E  +LL F  
Sbjct: 621  FLRNRNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKELMSLLEFIM 680

Query: 529  PGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKY 588
            P L  ++ +           + DAD   + +      ++   T++  FI+RR  D + K+
Sbjct: 681  PNLFVSKKDDLATVFKQKTRTSDADKGYNPLL-AEHAIERAKTMMKPFILRRKKDQVLKH 739

Query: 589  LPCKYEHVLFVNLKPFQRSVYELMLK-CRDVKLAVKDGTTPSQPLKHIG-----ALKKLC 642
            LP K+ H+L   +   Q+++Y+  +K   + +  +K+G    +  +++      AL+K  
Sbjct: 740  LPRKHNHILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNVSKNLIMALRKAS 799

Query: 643  NHPDLLQL-----------------PEDVE-GSEDVIPEDYRNST---LSK--------- 672
             HP L +                  PE  E G+ + I ED    T   L K         
Sbjct: 800  IHPLLFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELHKLCCKFPSLY 859

Query: 673  RGHAEVQTWY-SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRL 731
            +   +   W  SGK   L   LHKI     +K+++ S +TQ LD++E +  T +   +RL
Sbjct: 860  KFKLQSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLSTLNIKFLRL 919

Query: 732  DGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 791
            DG   +N RQ L+DRF + +    +FLLS+KAGG GINL+ AN +I+ D  +NP  D+QA
Sbjct: 920  DGQTQVNDRQSLIDRFYEDDTIP-VFLLSTKAGGFGINLVCANNVIIFDQSFNPHDDRQA 978

Query: 792  LARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
              R  R GQ K+  +   I   TIEEKI      K++L
Sbjct: 979  ADRAHRVGQTKEVQVTTLISRDTIEEKILHLAKNKLAL 1016

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  207 bits (528), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 150/487 (30%), Positives = 238/487 (48%), Gaps = 55/487 (11%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLL----RQGPQGKPTIDKCIIVCPSSLVNN 405
           VS ++     I+ADEMGLGKTLQ I  L  L     ++GP         +++ P S +NN
Sbjct: 156 VSLHKNNLAGILADEMGLGKTLQTITFLGYLRYIEKKRGP--------FLVIAPKSTLNN 207

Query: 406 WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRR 465
           W  EI +W     + +  + G K        A+  +   LA    V     I SYE + R
Sbjct: 208 WQREINRWT--PDVDAFILQGDKEER-----ARLCQERLLACNFDVA----IASYEIIIR 256

Query: 466 NVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLN 525
                   +   ++ DE HR+KN ES     L   +   R++++GTP+QN+L E +ALLN
Sbjct: 257 EKASFKKIDWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLN 316

Query: 526 FSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRR-TNDI 584
           F  P +    + F   F         ++A+D +  K    ++ L TI+  F++RR  +D+
Sbjct: 317 FLLPDIFSDSAAFDEWF--------SSEASDDDKDK---IVKQLHTILQPFLLRRIKSDV 365

Query: 585 LSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQP--LKHIGALKKLC 642
            +  LP K E  L+V +   QR  Y+ +L+     +   +G+  S+   L  +  L+K C
Sbjct: 366 ETSLLPKK-ELNLYVGMSSMQRKWYKQILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCC 424

Query: 643 NHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDD 702
           NHP L       +G+E   P       +           Y+     +   L K   E   
Sbjct: 425 NHPYLF------DGAEPGPPYTTDEHLV-----------YNSAKLKVLDKLLKKLKEDGS 467

Query: 703 KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
           +++I S  ++ LD++E  C    Y   R+DG+     R + +D +N  + ++FIFLL+++
Sbjct: 468 RVLIFSQMSRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTR 527

Query: 763 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
           AGG GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R +   ++EEKI +R
Sbjct: 528 AGGLGINLTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILER 587

Query: 823 QSMKMSL 829
            + K+ L
Sbjct: 588 ATQKLRL 594

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  207 bits (528), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 156/487 (32%), Positives = 236/487 (48%), Gaps = 40/487 (8%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409
           VS        I+ADEMGLGKT+Q I+L+  L     +  P     +++ P S + NW  E
Sbjct: 465 VSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKQEPGP----YLVIVPLSTITNWTLE 520

Query: 410 IVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEH 469
             KW    T          + +  GT  Q  R     + RS    VL+ +YE + ++   
Sbjct: 521 FEKWAPSLT----------TIIYKGTPNQ--RHALQHKIRSGNFDVLLTTYEYIIKDKAL 568

Query: 470 LNNCEIGLLLADEGHRLKNAESQ-TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 528
           L+  E   ++ DEGHR+KNA S+ +FT         R+IL+GTP+QN+L E +ALLNF  
Sbjct: 569 LSKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTRNRLILTGTPLQNNLPELWALLNFVL 628

Query: 529 PGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKY 588
           P +  +   F   F  P   +   +  +    +    ++ L  ++  F++RR    + K 
Sbjct: 629 PKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKD 688

Query: 589 LPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQP------LKHIGALKKLC 642
           LP K E V+   L   Q+ +Y+ MLK     L V  GT  +           I  L+K+C
Sbjct: 689 LPDKVEKVVKCKLSGLQQQLYQQMLKHN--ALFVGAGTEGATKGGIKGLNNKIMQLRKIC 746

Query: 643 NHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDD 702
           NHP +    E V     V P          RG++++    +GKF +L+R L K K  +  
Sbjct: 747 NHPFVFDEVEAV-----VNP---------SRGNSDLLYRVAGKFELLDRILPKFKA-TGH 791

Query: 703 KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
           +++I    TQ +D++E   R      +RLDG+     R  ++  FN    + F FLLS++
Sbjct: 792 RVLIFFQMTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVENSEYFCFLLSTR 851

Query: 763 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
           AGG G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I T ++EE I +R
Sbjct: 852 AGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILER 911

Query: 823 QSMKMSL 829
              K+ +
Sbjct: 912 AMQKLDI 918

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  206 bits (523), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 151/475 (31%), Positives = 247/475 (52%), Gaps = 36/475 (7%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I+L+  L     + K  I   +++ P S + NW  E  KW    +L
Sbjct: 492 ILADEMGLGKTIQSISLITYLY----EVKKDIGPFLVIVPLSTITNWTLEFEKW--APSL 545

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
            ++   G  +  +  ++   +R             VL+ +YE + ++   L+  +   ++
Sbjct: 546 NTIIYKGTPNQRH--SLQHQIRVGNF--------DVLLTTYEYIIKDKSLLSKHDWAHMI 595

Query: 480 ADEGHRLKNAESQ-TFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
            DEGHR+KNA+S+ +FT         R+IL+GTP+QN+L E +ALLNF  P +  +   F
Sbjct: 596 IDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTF 655

Query: 539 RRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYEHVLF 598
              F  P   +   +  +    +    ++ L  ++  F++RR    + K LP K E V+ 
Sbjct: 656 EDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIK 715

Query: 599 VNLKPFQRSVYELMLKCRDVKL-AVKDGTTPS--QPLKH-IGALKKLCNHPDLLQLPEDV 654
             L   Q+ +Y+ MLK   + + A  +G T    + L + I  L+K+CNHP +    ++V
Sbjct: 716 CKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVF---DEV 772

Query: 655 EGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTL 714
           EG   V P          RG++++    +GKF +L+R L K K  S  ++++    TQ +
Sbjct: 773 EGV--VNP---------SRGNSDLLFRVAGKFELLDRVLPKFKA-SGHRVLMFFQMTQVM 820

Query: 715 DVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGAN 774
           D++E   R      +RLDG+    +R ++++ FN  +   F FLLS++AGG G+NL  A+
Sbjct: 821 DIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTAD 880

Query: 775 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            +I+ D DWNP  D QA  R  R GQK +  I R I T ++EE I +R   K+ +
Sbjct: 881 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDI 935

>Scas_520.5
          Length = 863

 Score =  203 bits (516), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 152/520 (29%), Positives = 250/520 (48%), Gaps = 67/520 (12%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+AD+MGLGKT+Q IALL  +     +G       +I  P S V+NW NE  K+     +
Sbjct: 293 ILADDMGLGKTIQSIALLAFIYEMDTKGP-----FLIAAPLSTVDNWMNEFEKFAPDLPV 347

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
                 G K+  N     + +R +     ++    +++ SYE + R+ +++ + +   L+
Sbjct: 348 LKYYHPGGKNERN-----KLMRNFF---KKTNGTGIVVTSYEIIIRDADYIMSKQWKFLI 399

Query: 480 ADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFR 539
            DEGHRLKN   +    L  IN   R++L+GTP+QN+L+E ++LLNF  P +      F 
Sbjct: 400 VDEGHRLKNVNCRLIQELKRINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFTDFEIFN 459

Query: 540 RNFENPILLSRDADATDSEIAKG-NEKLQA-----LSTIVSKFIIRR-TNDILSKYLPCK 592
           + F+   L   + ++  S++ K  NE+LQ      L TI+  F++RR    +L+  LP K
Sbjct: 460 KWFDFKDL---EMESNSSKLNKVINEELQKNLISNLHTILKPFLLRRLKKTVLANILPPK 516

Query: 593 YEHVLFVNLKPFQRSVYELMLKCRDVKLAVKD-------------GTTPSQPLKHIGALK 639
            E+V+   L P Q+  Y+  L+ +  K   K+             G+  ++ ++     K
Sbjct: 517 REYVVNCPLTPIQKKFYKRGLEGKLKKTIFKEYVKAFFTLNSDYIGSVSNKSIREFIDYK 576

Query: 640 KLCNHPD---LLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQ----------TWY---- 682
                 D    +QL + ++  + +  E       +KR    +            +Y    
Sbjct: 577 LHEGETDSDGQIQLNDTLQKMDTLFMEYIHKEIANKRLQNMMMQLRQIVDSTLIFYFPYL 636

Query: 683 -------------SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVV 729
                        SGK   L R +  +  +   KI+I S +   LD++E  C  +S    
Sbjct: 637 RPEDLTLQELLESSGKLKTLQRLVIPLIAKG-HKILIFSQFVNMLDLLEDWCDLNSLAAF 695

Query: 730 RLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQ 789
           R+DGT+    R++ + +FND + +  +FLLS++A G G+NL+GA+ ++L D DWNP  D 
Sbjct: 696 RIDGTIDNESRKEQLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDL 755

Query: 790 QALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           QA+ R  R GQ K   +YRF C  T+E  I  R + K  L
Sbjct: 756 QAMDRCHRIGQTKPVIVYRFCCDNTLEHVILTRAANKRKL 795

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  204 bits (520), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 143/485 (29%), Positives = 230/485 (47%), Gaps = 51/485 (10%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409
           V+ ++     I+ADEMGLGKTLQ IA L  L     +  P     +++ P S +NNW  E
Sbjct: 153 VALHKNQLAGILADEMGLGKTLQTIAFLGYLRYIEKKNGP----FLVIAPKSTLNNWLRE 208

Query: 410 IVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVV--KPVLIISYETLRRNV 467
           I +W  + +   L  D ++ S              L   + +     + + SYE + R  
Sbjct: 209 INRWTPEVSAFILQGDKEERS-------------KLCHDKLLACDFDICVASYEIIIREK 255

Query: 468 EHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFS 527
                 +   ++ DE HR+KN ES     L   +   R++++GTP+QN+L E +ALLNF 
Sbjct: 256 ASFKKIDWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFL 315

Query: 528 NPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRR-TNDILS 586
            P +    + F   F +                     ++ L T++S F++RR  ND+  
Sbjct: 316 LPDIFADSATFDEWFSSESSEEDKEKV-----------VKQLHTVLSPFLLRRIKNDVEG 364

Query: 587 KYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQP--LKHIGALKKLCNH 644
             LP K E  ++V +   Q+  Y+ +L+     +   +G   S+   L  +  L+K CNH
Sbjct: 365 SLLPKK-ELNVYVGMSSMQKKWYKQILEKDIDAVNGSNGQKESKTRLLNIVMQLRKCCNH 423

Query: 645 PDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKI 704
           P L       +G+E   P              +    Y+     +   L K   E   ++
Sbjct: 424 PYLF------DGAEPGPP-----------YTTDEHLVYNSAKLKVLDKLLKKFKEQGSRV 466

Query: 705 VIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAG 764
           +I S  ++ LD++E  C    Y   R+DG+     R   +D +N  + ++FIFLL+++AG
Sbjct: 467 LIFSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTRAG 526

Query: 765 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQS 824
           G GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF+   ++EEKI +R +
Sbjct: 527 GLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERAT 586

Query: 825 MKMSL 829
            K+ L
Sbjct: 587 QKLKL 591

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH]
           (980963..985231) [4269 bp, 1422 aa]
          Length = 1422

 Score =  204 bits (520), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 145/476 (30%), Positives = 228/476 (47%), Gaps = 40/476 (8%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q ++ +  L+    Q  P     ++V P S +  W     KW  +   
Sbjct: 378 ILADEMGLGKTVQTVSFISWLIFARRQNGP----HLVVVPLSTMPAWQETFEKWAPELNC 433

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWAL-----ARGRSVVK-PVLIISYETLRRNVEHLNNC 473
                      + N      +R +        +G+  +K  VL+ +YE + ++   L   
Sbjct: 434 VYY--------MGNQKSRDVIREYEFYTNPHTKGKKNIKFNVLLTTYEYILKDRLELGAI 485

Query: 474 EIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 533
           +   L  DE HRLKNAES  + +L S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 486 KWQFLAVDEAHRLKNAESSLYESLSSFKVANRMLITGTPLQNNIKELAALVNFLMPGKFT 545

Query: 534 TRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKY 593
              E   +FEN             +  K    ++ L   +  +I+RR    + K LP K 
Sbjct: 546 IDQEI--DFEN-------------QDEKQENYIRDLHKRLQPYILRRLKKDVEKSLPSKT 590

Query: 594 EHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPED 653
           E +L V L   Q   Y+ +L      L      T    L  +  LKK  NHP L      
Sbjct: 591 ERILRVELSDVQTEYYKNILTKNYNALTAGTKGTHFSLLNIMNELKKASNHPYLFG---- 646

Query: 654 VEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQT 713
              +E+ +   + +   S+          SGK  +L++ L ++K +   +++I S   + 
Sbjct: 647 --NAENRVLAKFGDGNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMVRM 703

Query: 714 LDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGA 773
           LD++            RLDGT+  ++R+  +D FN  +  +F+FLLS++AGG GINL+ A
Sbjct: 704 LDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTA 763

Query: 774 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           + +I+ D DWNP AD QA+AR  R GQK    +YRF+   T+EE++ +R   KM L
Sbjct: 764 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 819

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  204 bits (520), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 157/511 (30%), Positives = 248/511 (48%), Gaps = 55/511 (10%)

Query: 353  NRGAYGCIMADEMGLGKTLQCIALLWT--LLRQGPQGKPTIDKC-----IIVCPSSLVNN 405
            N+     I+ D+MGLGKTLQ I ++ +   LR     K   +K      +I+CP SL  +
Sbjct: 1302 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYKKTQSEKTRPLPSLIICPPSLTGH 1361

Query: 406  WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRR 465
            W  E  ++    TL  L   G  S          VR + L +G+     +++ SY+  R 
Sbjct: 1362 WEQEFQQY--SPTLNVLVYAGGPS----------VR-YPL-QGQVPTADIVVTSYDVARN 1407

Query: 466  NVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLN 525
            +V+ L   +    + DEGH +KN++S+   A+  IN   R++L+GTPIQN++ E ++L +
Sbjct: 1408 DVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNHRLVLTGTPIQNNVVELWSLFD 1467

Query: 526  FSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDIL 585
            F  PG LGT   F+  F  PI  SR++  +  E   G   L+AL   V  F++RR  + +
Sbjct: 1468 FLMPGFLGTEKMFQERFAKPIASSRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEEV 1527

Query: 586  SKYLPCKYEHVLFVNLKPFQRSVY-ELMLKCRDVKLAVKDGTTPSQPLKHI----GALKK 640
               LP K     +  L   Q+ +Y + + K ++V     + T   +  +HI      ++K
Sbjct: 1528 LSDLPPKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDIENTAEVENKQHIFQALQYMRK 1587

Query: 641  LCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFL------- 693
            LCNHP L+     +  S     +    S LS+ G       ++ K   L   L       
Sbjct: 1588 LCNHPSLV-----LNSSHPQFQQ--VQSYLSQTGMDLHDIGHAPKLEALKTLLLECGIGI 1640

Query: 694  HKIKTESD-----------DKIVIISNYTQTLDVIERMCRTSSYPVV---RLDGTMTINK 739
              ++ +S+            +++I       LD++E        P V   RLDG++    
Sbjct: 1641 QDVEKKSNKNPSIDNVISQHRVLIFCQLKDMLDMVENDLLKKHLPSVTFMRLDGSVDSRD 1700

Query: 740  RQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG 799
            RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R G
Sbjct: 1701 RQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLG 1759

Query: 800  QKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
            QKK   +YR I  GT+EEKI   Q  KM+++
Sbjct: 1760 QKKVVNVYRIITKGTLEEKIMGLQKFKMNIA 1790

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  203 bits (517), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 145/483 (30%), Positives = 236/483 (48%), Gaps = 47/483 (9%)

Query: 350 VSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANE 409
           VS ++     I+ADEMGLGKTLQ I+ L  L        P     +++ P S +NNW  E
Sbjct: 208 VSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGP----FLVIAPKSTLNNWLRE 263

Query: 410 IVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEH 469
           I +W     + +  + G K        A+ ++   L     VV    I SYE + R    
Sbjct: 264 INRWTP--DVNAFILQGDKEER-----AELIQKKLLGCDFDVV----IASYEIIIREKSP 312

Query: 470 LNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 529
           L       ++ DE HR+KN ES     L       R++++GTP+QN+L E +ALLNF  P
Sbjct: 313 LKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLP 372

Query: 530 GLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRR-TNDILSKY 588
            +     +F   F           +++S     ++ ++ L T++  F++RR  +D+ +  
Sbjct: 373 DIFSDAQDFDDWF-----------SSESTEEDQDKIVKQLHTVLQPFLLRRIKSDVETSL 421

Query: 589 LPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQP--LKHIGALKKLCNHPD 646
           LP K E  L+V +   Q+  Y+ +L+     +   +G+  S+   L  +  L+K CNHP 
Sbjct: 422 LPKK-ELNLYVGMSSMQKKWYKKILEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPY 480

Query: 647 LLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVI 706
           L       +G+E   P              +    Y+     +   L K   E   +++I
Sbjct: 481 LF------DGAEPGPP-----------YTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLI 523

Query: 707 ISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGC 766
            S  ++ LD++E  C   +Y   R+DG+     R + +D +N  + ++F+FLL+++AGG 
Sbjct: 524 FSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGL 583

Query: 767 GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMK 826
           GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R +   ++EEKI +R + K
Sbjct: 584 GINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQK 643

Query: 827 MSL 829
           + L
Sbjct: 644 LRL 646

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  203 bits (516), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 160/528 (30%), Positives = 249/528 (47%), Gaps = 82/528 (15%)

Query: 358  GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKG 417
             CI+AD+MGLGKT Q I+ L   L+Q  Q  P     +IV PSS + NW  E  K+    
Sbjct: 592  SCILADDMGLGKTCQVISFL-AYLKQIGQPSP----HLIVVPSSTLENWLREFQKFCP-- 644

Query: 418  TLASLPIDGKKSSL---------NNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVE 468
            +L   P  G +            N+G     V  + LA G               + +V 
Sbjct: 645  SLKIEPYYGTQQERADLREILERNDGKYDVIVTTYNLAAGN--------------KYDVS 690

Query: 469  HLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 528
             L      +++ DEGH LKN+ S+ F  L  I+   R++L+GTP+QN+L E  +LL F  
Sbjct: 691  FLKTRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKELMSLLEFIM 750

Query: 529  PGLLGTRSE-FRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSK 587
            P L  ++ E     F+     S D    +  +A+  + +    T++  FI+RR  D + K
Sbjct: 751  PNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQ--QAITRAKTMMKPFILRRRKDQVLK 808

Query: 588  YLPCKYEHVLFVNLKPFQRSVYELMLK-CRDVKLAVKDGTTPS----------------- 629
            +LP K+    +  +   QR +Y   +K   + K  ++DGT P                  
Sbjct: 809  HLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKERSKIENNSSKNLI 868

Query: 630  --------QPL--KHI---GALKKLCNHPDLLQLPEDVE-GSEDVIPEDYRN-------- 667
                     PL  +HI     + K+C+   +L  P   E G+++ I ED           
Sbjct: 869  MSLRKASIHPLLFRHIYDDAKIDKMCDA--ILDEPAYAENGNKEYIREDMSFMTDFELHR 926

Query: 668  ------STLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMC 721
                  +TL        +   SGK   L + L  I  +  +K++I + +TQ LD++E++ 
Sbjct: 927  LCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIFTLFTQVLDILEKVL 986

Query: 722  RTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDP 781
             T +Y  +RLDG+  +N RQ ++D+F D +    IF+LS++AGG GINL+ AN +I+ D 
Sbjct: 987  STLNYKFLRLDGSTQVNDRQTMIDKFYD-DNTIPIFMLSTRAGGFGINLVCANHVIIFDQ 1045

Query: 782  DWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
             +NP  D+QA  R  R GQ K+  +   I   +IEEKI+Q    K++L
Sbjct: 1046 SFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAKTKLAL 1093

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  202 bits (515), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 160/524 (30%), Positives = 259/524 (49%), Gaps = 80/524 (15%)

Query: 353  NRGAYGCIMADEMGLGKTLQCIALLWT--LLRQGPQGKPTIDKC-----IIVCPSSLVNN 405
            N+     I+ D+MGLGKTLQ I ++ +   LRQ         +C     +IVCP SL  +
Sbjct: 1328 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYKLSGNIECRPLPSLIVCPPSLTGH 1387

Query: 406  WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKP---------VL 456
            W NE  ++                       +  ++    A G SV +P         ++
Sbjct: 1388 WENEFEQY-----------------------SPFLKIVVYAGGPSVRQPLRKQLSSADII 1424

Query: 457  IISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQND 516
            I SY+  R +++ +++ +    + DEGH +KNA+S+   A+  I    R+IL+GTPIQN+
Sbjct: 1425 ITSYDVARNDLDTISSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHRLILTGTPIQNN 1484

Query: 517  LSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKF 576
            + E ++L +F  PG LGT   F+  F  PI  SR++  +  E   G   L+AL   V  F
Sbjct: 1485 VVELWSLFDFLMPGFLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPF 1544

Query: 577  IIRR-TNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKC------RDVKLAVKDGTTPS 629
            ++RR   D+LS  LP K     +  L   Q+ +YE   K       +D++    D  +  
Sbjct: 1545 MLRRLKEDVLSD-LPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQ-NTADVDSKQ 1602

Query: 630  QPLKHIGALKKLCNHPDLLQLPED---VEGSEDVIPE------DYRNS-------TLSKR 673
               + +  ++KLCNHP L+ L  D   ++  ++ + +      D RN+       TL   
Sbjct: 1603 HIFQALQYMRKLCNHPALV-LSNDHPQLKQIQNYLKQTGCDLHDIRNAPKLTALRTLLFE 1661

Query: 674  ---GHAEVQTWYSGK----FSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSY 726
               G A++    +G+     S++++    I  +  D + +I N     D+ +R   + SY
Sbjct: 1662 CGIGEADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLDMIEN-----DLFKRYMPSVSY 1716

Query: 727  PVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPA 786
              +RLDG++    RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP 
Sbjct: 1717 --MRLDGSVDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPM 1773

Query: 787  ADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
             D QA+ R  R GQKK   +YR +  GT+EEKI   Q  KM+++
Sbjct: 1774 NDLQAMDRAHRLGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIA 1817

>Scas_664.9
          Length = 1859

 Score =  202 bits (514), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 158/516 (30%), Positives = 244/516 (47%), Gaps = 63/516 (12%)

Query: 353  NRGAYGCIMADEMGLGKTLQCIALLWT--LLRQGPQGKPTIDKC-----IIVCPSSLVNN 405
            N+     I+ D+MGLGKTLQ I ++ +   LR     K    +      +IVCP SL  +
Sbjct: 1282 NKYRLHGILCDDMGLGKTLQTICIIASDQYLRAEDYKKTNSVETRKLPSLIVCPPSLTGH 1341

Query: 406  WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKP---------VL 456
            W NE  ++                       A  ++    A G S+  P         ++
Sbjct: 1342 WENEFEQY-----------------------APFLKIIVYAGGPSMRIPLRDELGSADIV 1378

Query: 457  IISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQND 516
            I SY+  R ++  +   +    + DEGH +KNA+S+   A+  I+   R+IL+GTPIQN+
Sbjct: 1379 ITSYDVARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANHRLILTGTPIQNN 1438

Query: 517  LSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKF 576
            + E ++L +F  PG LGT   F+  F  PI  SR++  +  E   G   L+AL   V  F
Sbjct: 1439 VVELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPF 1498

Query: 577  IIRR-TNDILSKYLPCKYEHVLFVNLKPFQRSVYE-LMLKCRDVKLAVKDGTTPSQPLKH 634
            ++RR   D+LS  LP K     +  L   Q+ +Y+    K ++V     + TT +   +H
Sbjct: 1499 MLRRLKEDVLSD-LPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDIENTTDTDNSQH 1557

Query: 635  I----GALKKLCNHPDLLQLPEDVEGSE-------------DVIPEDYRNSTLSKRGHAE 677
            I      ++KLCNHP L+  P   + ++             DVI     N+  +      
Sbjct: 1558 IFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGIDLHDVINAPKLNALRTLLFECG 1617

Query: 678  VQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVV---RLDGT 734
            +      + S  N++L      S  + +I       LD++E        P V   RLDG+
Sbjct: 1618 IGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKRYMPSVTYMRLDGS 1677

Query: 735  MTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 794
            +    RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R
Sbjct: 1678 VDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDR 1736

Query: 795  VWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
              R GQKK   +YR I  GT+EEKI   Q  KM+++
Sbjct: 1737 AHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIA 1772

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  199 bits (506), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 156/513 (30%), Positives = 250/513 (48%), Gaps = 59/513 (11%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q IALL  +     +G       ++  P S+V+NW  E  K+      
Sbjct: 209 ILADEMGLGKTIQSIALLAFIYEMDTRGP-----FLVTAPLSVVDNWITEFEKFA----- 258

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
            S+P+    S+   G     ++ +     ++  + V++ SYE + R++  + + +   L+
Sbjct: 259 PSIPVLKYYSADGPGKRHAILKEFF---RKNSGEGVVVTSYEIVMRDMNVILSHQWKFLI 315

Query: 480 ADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFR 539
            DEGHRLKN   +    L  IN   R++L+GTP+QN+L+E ++LLNF  P +      F 
Sbjct: 316 VDEGHRLKNINCKLIRELKRINTFNRLLLTGTPLQNNLAELWSLLNFILPDVFADFEIFS 375

Query: 540 RNFENPIL-LSRDADATDSEIAKGNEK--LQALSTIVSKFIIRRTND-ILSKYLPCKYEH 595
           + F+   L L   +   D  I +  EK  +  L TI+  F++RR    +L+  LP K E+
Sbjct: 376 KWFDFSDLDLKTSSQRWDKIIGEELEKNLVTNLHTILKPFLLRRLKRVVLADALPPKREY 435

Query: 596 VLFVNLKPFQRSVYELM----LKCRDVKLAVKDGTTPSQPLKHIGAL--KKLCNHPDLLQ 649
           ++   L P Q   Y++     LK      A+K+  T ++  +HIG++  K +    D   
Sbjct: 436 IINCPLTPLQTRFYKMALAGKLKRTVFTQAIKEFFTLNR--EHIGSVSNKTIREFIDYKT 493

Query: 650 LPEDVEGS----------EDVIPEDYRNSTLSKRGHAEVQT------WY----------- 682
             E+++ S          E  I ++ RN  L        Q       +Y           
Sbjct: 494 SDEEIQASKVITDMEKLYEQHIHKELRNKRLQNLMMQLRQIVDSTFLFYFPYLKAEDLQL 553

Query: 683 ------SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMT 736
                 SGK  IL + L ++   +  K++I S +   LD+IE  C  ++Y   R+DG+M 
Sbjct: 554 PVLLQTSGKLQILQQLLPRL-LAAKHKVLIFSQFVSMLDLIEDWCELNNYSACRIDGSMD 612

Query: 737 INKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 796
              R++ ++ F++      +FLLS++AGG GINL  A+ +IL D DWNP  D QA+ R  
Sbjct: 613 NETRREQINSFSEKGSPHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQVDLQAMDRSH 672

Query: 797 RDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           R GQ+    +YR  C  T+E  I  R + K  L
Sbjct: 673 RIGQQHPVIVYRLYCDKTVESVILARATNKRKL 705

>Kwal_26.7123
          Length = 1081

 Score =  201 bits (511), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 166/539 (30%), Positives = 251/539 (46%), Gaps = 92/539 (17%)

Query: 354  RGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW 413
            R    CI+ADEMGLGKT Q IA L + L+Q  +  P     ++V PSS + NW  E  K+
Sbjct: 540  RNNLSCILADEMGLGKTCQVIAFL-SYLKQNNEPGP----HLVVVPSSTLENWLREFNKF 594

Query: 414  LGKGTLASLPIDGKKSSL---------NNGTVAQAVRGWALARGRSVVKPVLIISYETLR 464
                 L   P  G +            N+G     V  + LA G               +
Sbjct: 595  CP--DLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGN--------------K 638

Query: 465  RNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALL 524
             +V  L N    +++ DEGH LKN+ S+ FT L  I    R++L+GTP+QN+L E  +LL
Sbjct: 639  YDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLL 698

Query: 525  NFSNPGLLGTRSE-----FRRNFENPILLSRDADAT-DSEIAKGNEKLQALSTIVSKFII 578
             F  P L  ++       FR+        +R +D+  D       E +    T++  FI+
Sbjct: 699  EFIMPNLFISKKNDLSAVFRQR-------ARTSDSNKDYNPLLAQEAIARAKTMMKPFIL 751

Query: 579  RRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLK-CRDVKLAVKDGTTPS-----QPL 632
            RR  D + K+LP K+  + +  +   QR++Y   ++   D K  +++          +P 
Sbjct: 752  RRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLREREEEGSAEEPRPT 811

Query: 633  KHIG----------ALKKLCNHPDL-----------------LQLPEDVE-GSEDVIPED 664
            K  G          +L+K   HP L                 L+ PE  E G+++ I ED
Sbjct: 812  KKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQED 871

Query: 665  --YRNS------------TLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNY 710
              Y N             +L+K      +   SGK + L + L  I     +K+++ S +
Sbjct: 872  MSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLF 931

Query: 711  TQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINL 770
            TQ LD++E    T +   +RLDG+  +N RQ L+D+F+D +    +F+LS+KAGG GINL
Sbjct: 932  TQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINL 990

Query: 771  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            + AN +I+ D  +NP  D+QA  R  R GQ K   I   I   +IEEKI Q    K++L
Sbjct: 991  VCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLAL 1049

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  199 bits (506), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 157/515 (30%), Positives = 238/515 (46%), Gaps = 61/515 (11%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q IALL  +     +G       +I  P S V+NW NE  K+      
Sbjct: 241 ILADEMGLGKTIQSIALLSFIYEMDTKGP-----FLIAAPLSTVDNWMNEFAKFA----- 290

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
             +PI    S        + ++ +     R   + V++ SYE + R+   +   +   L+
Sbjct: 291 PEIPILKYYSQNGQDARQKLLKKFFKNNNR---EGVIVTSYEMIIRDANIIMGEQWKFLI 347

Query: 480 ADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFR 539
            DEGHRLKN   +    L  IN   R++L+GTP+QN+LSE ++LLNF  P +      F 
Sbjct: 348 VDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQNNLSELWSLLNFILPDIFADFEIFN 407

Query: 540 RNFENPIL-LSRDADATDSEIAKGNEK--LQALSTIVSKFIIRRTND-ILSKYLPCKYEH 595
           + F+   L L  ++   +  I    EK  +  L TI+  F++RR    +L   LP K E+
Sbjct: 408 KWFDFKDLDLQSNSAKLNKLINDELEKNLISNLHTILKPFLLRRLKSVVLKDVLPPKREY 467

Query: 596 VLFVNLKPFQRSVYELM----LKCRDVKLAVKDGTTPSQPLKHIGALK----------KL 641
           ++   L P Q   Y +     LK    K  VK   T +Q  ++IG +           KL
Sbjct: 468 IVNCPLSPIQTKFYRMALSGKLKVTVFKELVKAFFTLNQ--EYIGTVSNKSIRDFIDYKL 525

Query: 642 CNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGH-----------------------AEV 678
              PD  ++   ++  +D+  E     T ++R                          ++
Sbjct: 526 SEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRLQNMMMQLRQVVDSTLLFFFPYMEPEDI 585

Query: 679 QTWY----SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGT 734
              Y    SGK  +L +    +  +   KI+I S +   LD++E     +S+  +R+DG 
Sbjct: 586 TLDYLLASSGKLQMLQKLAIPL-IKKGHKILIFSQFVGMLDLLEDWSELNSFNSLRIDGG 644

Query: 735 MTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 794
           +    R++ +D FN       IFLLS++A G GINL+ A+ +I+ D DWNP  D QA+ R
Sbjct: 645 VDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGINLVAADTVIIFDSDWNPQVDLQAMDR 704

Query: 795 VWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
             R GQ K   +YRF C  TIE  I  R   K  L
Sbjct: 705 CHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKL 739

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  201 bits (512), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 161/510 (31%), Positives = 250/510 (49%), Gaps = 67/510 (13%)

Query: 360  IMADEMGLGKTLQCIALLWT--LLRQ-------GPQGKPTIDKCIIVCPSSLVNNWANEI 410
            I+ D+MGLGKTLQ I ++ +   LRQ         + +P     +IVCP SL  +W  E 
Sbjct: 1301 ILCDDMGLGKTLQTICIIASDQYLRQEDYKTTKSVETRPL--PSLIVCPPSLTGHWEQEF 1358

Query: 411  VKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHL 470
             ++     L  L   G  S+            + L RG+     +++ SY+  R +++ +
Sbjct: 1359 EQY--APFLTVLVYAGGPST-----------RYPL-RGKLGDADIVVTSYDVARNDIDII 1404

Query: 471  NNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 530
            +  +    + DEGH +KN++S+   A+ SI    R+IL+GTPIQN++ E ++L +F  PG
Sbjct: 1405 SKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHRLILTGTPIQNNVVELWSLFDFLMPG 1464

Query: 531  LLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRR-TNDILSKYL 589
             LG+   F+  F  PI  SR++  +  E   G   L+AL   V  F++RR   D+LS  L
Sbjct: 1465 FLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEDVLSD-L 1523

Query: 590  PCKYEHVLFVNLKPFQRSVYELMLKC------RDVK--LAVKDGTTPSQPLKHIGALKKL 641
            P K     +  L   QR +Y+   K       RD++  + ++      Q L++   ++KL
Sbjct: 1524 PPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIENTMELESKNHIFQALQY---MRKL 1580

Query: 642  CNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFL-------- 693
            CNHP L+ L +D      V  +DY    LS+ G       ++ K   L   L        
Sbjct: 1581 CNHPSLV-LSKDHPQYNQV--QDY----LSQTGMDIHDIAHAPKLGALRNLLLECGIGVQ 1633

Query: 694  ----HKIKTESDDKIV------IISNYTQTLDVIERMCRTSSYPVV---RLDGTMTINKR 740
                + I   S + ++      I       LD+IE        P V   RLDG++    R
Sbjct: 1634 DVDQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYLPSVTYMRLDGSVESRDR 1693

Query: 741  QKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 800
            QK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R GQ
Sbjct: 1694 QKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFIEHDWNPMNDLQAMDRAHRLGQ 1752

Query: 801  KKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
            KK   +YR I  G++EEKI   Q  KM+++
Sbjct: 1753 KKVVNVYRIITKGSLEEKIMGLQKFKMNIA 1782

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  197 bits (501), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 159/522 (30%), Positives = 247/522 (47%), Gaps = 76/522 (14%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q IALL  +     +G       +I  P S V NW NE  ++      
Sbjct: 219 ILADEMGLGKTIQSIALLAFIYEMDTKGP-----FLIAAPLSTVENWMNEFARFA----- 268

Query: 420 ASLPIDGKKSSLNNGTVA-QAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLL 478
             +P+    +S   G  A  A+ G      +   + V+I SYE + R++E + + +   L
Sbjct: 269 PDIPVLKYYNS--EGQAARHAMMGKFFKNNKG--EGVIITSYEIIIRDIELILSYQWKFL 324

Query: 479 LADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEF 538
           + DEGHRLKN   +    L  IN   R++L+GTP+QN+L E ++LLNF  P +      F
Sbjct: 325 IVDEGHRLKNINCKLIRELKRINTSNRLLLTGTPLQNNLGELWSLLNFILPNIFSDFEIF 384

Query: 539 RRNFENPIL-LSRDADATDSEIAKGNEK--LQALSTIVSKFIIRR-TNDILSKYLPCKYE 594
            + F+   L L   ++     I    EK  +  L TI+  F++RR   ++L+  LP K E
Sbjct: 385 NKWFDFSDLNLESSSEKLTKIINDELEKNLISNLHTILKPFLLRRLKKNVLAGSLPPKRE 444

Query: 595 HVLFVNLKPFQRSVYELMLKCR----DVKLAVKD---------GTTPSQPLK-------- 633
           +++   + P Q+  Y+  LK        K A+KD         GT  ++ ++        
Sbjct: 445 YIITCPVTPLQKKYYKQALKGNLKQTIQKQAIKDFFTLNAEYIGTVSNKSIRDFIEWKLS 504

Query: 634 ---------HIGALKKLCN---HPDLL---------QLPEDVEGSEDVI-----PEDYRN 667
                    +IG ++KL +   H +LL         QL + V  +         P D   
Sbjct: 505 ADSQDIPNDNIGKMEKLYDMHIHKELLNKRLQNMMIQLRQIVNSTYLFYFPLLEPTDLTL 564

Query: 668 STLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYP 727
             L K          SGK  +L + + ++  +   K++I S +   LD+IE     +++ 
Sbjct: 565 ENLLKT---------SGKLQVLQKLVPEL-IKKKHKVLIFSQFVSMLDLIEDWSELNNFI 614

Query: 728 VVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 787
             R+DG+M  N R++ ++ F+    +  +FLLS++A G GINL  A+ +I+ D DWNP  
Sbjct: 615 SCRIDGSMQNNSRKEQIEEFSKKGSKANLFLLSTRAAGLGINLTAADSVIIFDSDWNPQV 674

Query: 788 DQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           D QA+ R  R GQ K   +YR  C  TIE  I  R   K  L
Sbjct: 675 DLQAMDRAHRIGQTKPVIVYRLYCDNTIENVIMTRAVNKRKL 716

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  198 bits (503), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 158/523 (30%), Positives = 248/523 (47%), Gaps = 77/523 (14%)

Query: 353  NRGAYGCIMADEMGLGKTLQCIALLWT---LLRQGPQGKPTIDK----CIIVCPSSLVNN 405
            N+     I+ D+MGLGKTLQ I ++ +   L ++  +   +++      +I+CP SL  +
Sbjct: 1287 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVESRALPSLIICPPSLTGH 1346

Query: 406  WANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARG---RSVVKP------VL 456
            W NE  ++                       A  ++    A G   R  ++P      ++
Sbjct: 1347 WENEFDQY-----------------------APFLKVVVYAGGPTVRLTLRPQLSDADII 1383

Query: 457  IISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQND 516
            + SY+  R ++  LN  E    + DEGH +KN++S+   A+  I    R+IL+GTPIQN+
Sbjct: 1384 VTSYDVARNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNN 1443

Query: 517  LSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKF 576
            + E ++L +F  PG LGT   F+  F  PI  SR++  +  E   G   L+AL   V  F
Sbjct: 1444 VLELWSLFDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPF 1503

Query: 577  IIRR-TNDILSKYLPCKYEHVLFVNLKPFQRSVY-ELMLKCRDVKLAVKDGTTPSQPLKH 634
            ++RR   D+LS  LP K     +  L   Q+ +Y +   K ++V     + +  +   +H
Sbjct: 1504 MLRRLKEDVLSD-LPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIENSEIADGKQH 1562

Query: 635  I----GALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILN 690
            I      ++KLCNHP L+  P   + ++    +DY    L + G        + K S L 
Sbjct: 1563 IFQALQYMRKLCNHPALVLSPNHPQLAQ---VQDY----LKQTGLDLHDIINAPKLSALR 1615

Query: 691  RFLHK--IKTESDDK------------------IVIISNYTQTLDVIERMCRTSSYPVV- 729
              L +  I  E  DK                   +I       LD++E        P V 
Sbjct: 1616 TLLFECGIGEEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVT 1675

Query: 730  --RLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 787
              RLDG++    RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  
Sbjct: 1676 YMRLDGSIDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMN 1734

Query: 788  DQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSLS 830
            D QA+ R  R GQKK   +YR I  GT+EEKI   Q  KM+++
Sbjct: 1735 DLQAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIA 1777

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  194 bits (494), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 151/527 (28%), Positives = 245/527 (46%), Gaps = 80/527 (15%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q IALL  +     +G       ++  P S ++NW NE  K+      
Sbjct: 244 ILADEMGLGKTVQSIALLAFIYEMDTKGP-----FLVTAPLSTLDNWMNEFAKFA----- 293

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
             LP+     +      +  ++ +    G +    ++I SYE + R+ + + +     L+
Sbjct: 294 PDLPVLKYYGTNGYKERSAKLKNFFKQHGGT---GIVITSYEIILRDTDLIMSQNWKFLI 350

Query: 480 ADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFR 539
            DEGHRLKN   +    L  IN   R++L+GTP+QN+L+E ++LLNF  P +      F 
Sbjct: 351 VDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFADFEIFN 410

Query: 540 RNFENPILLSRDADATDSEIAKGNEKLQA-----LSTIVSKFIIRRTNDI-LSKYLPCKY 593
           + F+   L       +++     N++LQ      L TI+  F++RR   + L+  LP K 
Sbjct: 411 KWFDFDSLNLGSGSNSEALNKLINDELQKNLISNLHTILKPFLLRRLKKVVLANILPPKR 470

Query: 594 EHVLFVNLKPFQRSVYELMLKCRDVKLAVKD-----GTTPSQPLKHIG--ALKKLCNH-- 644
           E+++   +   Q   Y+  L  +  K   K+      T   + + H+   +++   N+  
Sbjct: 471 EYIINCPMTSAQEKFYKAGLNGKLKKTMFKELIKDFFTLNDEYIGHVSNRSIRDFINYKL 530

Query: 645 -------------PDLLQLPE------DVEGSEDVI-----------------------P 662
                        P LLQ+ +       +E S   +                       P
Sbjct: 531 SGNETSNTDNKINPTLLQMDKLYKKNLQMEISNKKLQNMMMQLRQIIDSTFLFYFPYLHP 590

Query: 663 EDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCR 722
           ED    TL K          SGK  IL + +  + +E   K++I S +   LD+IE  C 
Sbjct: 591 EDLTLETLLKT---------SGKLQILQKLIPPLISEGH-KVLIYSQFVNMLDLIEDWCD 640

Query: 723 TSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPD 782
            +S+   R+DG++    R+  +++FN  + +  IFLLS++A G GINL+GA+ ++L D D
Sbjct: 641 LNSFATFRIDGSVNNETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSD 700

Query: 783 WNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           WNP  D QA+ R  R GQ+    +YR  C  TIE  I  R + K +L
Sbjct: 701 WNPQVDLQAMDRCHRIGQESPVIVYRLCCDNTIEHVILTRAANKRNL 747

>Kwal_47.18077
          Length = 809

 Score =  187 bits (475), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 152/514 (29%), Positives = 242/514 (47%), Gaps = 60/514 (11%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKTLQ IALL   + +   G P     +I  P S ++ W NE  ++     +
Sbjct: 202 ILADEMGLGKTLQSIALL-AFITEMDTGGP----FLIAAPLSTLDTWVNEFSRFAPDIQV 256

Query: 420 ASLPIDGKKSSLNNGTVAQAV--RGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGL 477
                  K  S    +  Q++  + +   +G+ VV    I SYE + R++E + + +   
Sbjct: 257 L------KYYSTQGQSYRQSLLKKFFKSTKGQGVV----ITSYEIIIRDIELILSYQWKF 306

Query: 478 LLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSE 537
           L+ DEGHR+KN   +    L  IN   R++++GT +QN+LSE ++LLNF  P +      
Sbjct: 307 LIVDEGHRIKNINCKLIRELKRINTLNRLLITGTALQNNLSELWSLLNFIMPDIFADFEI 366

Query: 538 FRRNFE-NPILLSRDADATDSEIAKGNEK--LQALSTIVSKFIIRRTNDI-LSKYLPCKY 593
           F + F+ + + L   +   +  I    EK  +  L  I+  F++RR   + L+  LP K 
Sbjct: 367 FHKWFDFSDLELKSSSQGLNRLINDELEKNLISNLHAILKPFLLRRLKKVVLAGSLPPKR 426

Query: 594 EHVLFVNLKPFQRSVYELML----KCRDVKLAVKD---------GTTPSQPLKHIGALKK 640
           E+++   L   Q+ +Y+  L    K    K A+KD         G   ++ ++     K 
Sbjct: 427 EYIVNCPLTSVQKKLYKSALNGKLKQAIFKQAIKDFFVLNSDQIGQVSNKSIRDFMEWKL 486

Query: 641 LCNHPD----LLQLPEDVEGSE---DVIPEDYRNSTLSKRGHAEVQTWY----------- 682
             N  D    +LQ  + +        ++ +  +N  +  R   +    +           
Sbjct: 487 NANDEDPDTEILQQMDKLYKQHIHRALLNKRLQNPMVQLRQVVDSTLLFFFPFINPEKLT 546

Query: 683 -------SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTM 735
                  SGK  IL + +  +  +   K++I + +   LD+IE  C  +   V R+DG+M
Sbjct: 547 LDFLLQSSGKLQILQQLVPPL-IKKGHKVLIFTQFVGMLDLIEDWCELNDVRVCRIDGSM 605

Query: 736 TINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARV 795
               RQ+ ++RFND +     FL+S++AGG GINL  A+ +IL D DWNP  D QA  R 
Sbjct: 606 GNETRQEHIERFNDPDDSFDAFLISTRAGGLGINLTAADSVILFDSDWNPQVDLQATDRT 665

Query: 796 WRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            R GQ K   +YR  C  TIE  I  R + K  L
Sbjct: 666 HRIGQTKPVIVYRLCCDNTIEHVILTRAASKRKL 699

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 107/377 (28%), Positives = 190/377 (50%), Gaps = 41/377 (10%)

Query: 353  NRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVK 412
            ++G  G I+ADEMGLGKT+Q I++L  L  +     P     I+V P+S ++NW NEI +
Sbjct: 762  DQGING-ILADEMGLGKTVQSISVLAHLADRYNIWGP----FIVVTPASTLHNWVNEISR 816

Query: 413  WLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNN 472
            ++ +  +  LP  G  +  +  T+ +      L  GR     V++ SY+ +  +  +L  
Sbjct: 817  FVPQFKI--LPYWGNAN--DRKTLRKFWDRKHLRYGRDAPFHVMVTSYQMVVSDASYLQK 872

Query: 473  CEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 532
             +   ++ DE   +K+++S  +  L S +C  R++L+GTPIQN++ E +ALL+F  P L 
Sbjct: 873  MKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLF 932

Query: 533  GTRSEFRRNFENPILLSRDADA-TDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPC 591
             +  EF   F      S+D ++  +S      E+L+ L  ++  F++RR    +   L  
Sbjct: 933  DSHDEFSDWF------SKDIESHAESNTELNQEQLRRLHMVLKPFMLRRIKKNVQSELGD 986

Query: 592  KYEHVLFVNLKPFQRSVYELMLKCR-----DV--KLAVKDGTTPSQPLKH-IGALKKLCN 643
            K E  +  +L   Q  +Y++ LK +     D     A  D  T  Q L + +   +K+CN
Sbjct: 987  KIEIDVLCDLTFRQAKLYQV-LKSQVSGGYDAIENAAGNDDVTSDQKLVNLVMEFRKVCN 1045

Query: 644  HPDLLQLPEDVEGSEDVIPEDY----RNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTE 699
            HPDL       E ++ + P  +     +++LS+ G   V+  YS K +++N  L ++  +
Sbjct: 1046 HPDLF------ERADVMSPFSFVSFGESASLSREGDF-VEVNYSAK-NLINYNLPRLIYD 1097

Query: 700  SDDKIVIISNYTQTLDV 716
                 +++ NY   +DV
Sbjct: 1098 E----LVVPNYNNDVDV 1110

 Score =  105 bits (263), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 82/144 (56%), Gaps = 2/144 (1%)

Query: 683  SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQK 742
            S K   L+  L K+K E D +++I    T+ +D++E       Y  +RLDG+  ++ R+ 
Sbjct: 1318 SAKLKKLDELLVKLK-EEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRD 1376

Query: 743  LVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 802
            LV  +   +   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ +
Sbjct: 1377 LVHDWQ-TKPDIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTR 1435

Query: 803  DCFIYRFICTGTIEEKIYQRQSMK 826
               +YR +  GTIEE++  R   K
Sbjct: 1436 QVTVYRLLIRGTIEERMRDRAKQK 1459

>Scas_669.20
          Length = 1397

 Score =  120 bits (301), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 88/306 (28%), Positives = 153/306 (50%), Gaps = 27/306 (8%)

Query: 353 NRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVK 412
           ++G  G I+ADEMGLGKT+Q I++L  L  +     P     ++V P+S ++NW NEI K
Sbjct: 661 DQGING-ILADEMGLGKTVQSISVLAHLAEKHNIWGP----YLVVTPASTLHNWVNEITK 715

Query: 413 WLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKP----VLIISYETLRRNVE 468
           ++ +  +  LP  G      N    + +R +   +     K     V+I SY+ +  +V 
Sbjct: 716 FVPQFKI--LPYWG------NAADRKVLRKFWDRKNLRYTKDSPFHVMITSYQMVVSDVT 767

Query: 469 HLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 528
           +L   +   ++ DE   +K+++S  +  L S +C  R++L+GTPIQN++ E +ALL+F  
Sbjct: 768 YLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIM 827

Query: 529 PGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKY 588
           P L  +  EF   F   I    +A+         +++L+ L  I+  F++RR    +   
Sbjct: 828 PSLFDSHDEFSEWFAKDIESHAEANT-----QLNHQQLRRLHMILKPFMLRRVKKNVQSE 882

Query: 589 LPCKYEHVLFVNLKPFQRSVYELMLKCRDV----KLAVKDGTTPSQPLKH-IGALKKLCN 643
           L  K E  +  +L   Q  +Y+++    +       A  D  +  Q L + +   +K+CN
Sbjct: 883 LGDKIEIDVLCDLTQRQAKLYQVLKSTSNYDAIENAAGSDEFSSDQNLVNTVMQFRKVCN 942

Query: 644 HPDLLQ 649
           HPDL +
Sbjct: 943 HPDLFE 948

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 81/144 (56%), Gaps = 2/144 (1%)

Query: 683  SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQK 742
            S K   L+  L ++K E   +++I    T+ +D++E       Y  +RLDG+  +  R+ 
Sbjct: 1219 SAKLKKLDELLVQLKREGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1277

Query: 743  LVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 802
            LV  +   + + F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ +
Sbjct: 1278 LVHDWQ-TKPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTR 1336

Query: 803  DCFIYRFICTGTIEEKIYQRQSMK 826
               +YR +  GTIEE++  R   K
Sbjct: 1337 QVTVYRLLIRGTIEERMRDRAKQK 1360

>Kwal_27.11388
          Length = 1334

 Score =  120 bits (300), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 93/307 (30%), Positives = 152/307 (49%), Gaps = 31/307 (10%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I++L  L        P     I+V P+S ++NW NEI K+L    +
Sbjct: 616 ILADEMGLGKTVQSISVLAHLAENYNIWGP----FIVVTPASTLHNWVNEISKFLPDFKI 671

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGW----ALARGRSVVKPVLIISYETLRRNVEHLNNCEI 475
             LP  G      NG   + +R +        G+     V++ SY+ +  +  +L   + 
Sbjct: 672 --LPYWG------NGNDRKILRRFWDRKQFRYGKDAPFHVMVTSYQMVVSDAAYLQKMKW 723

Query: 476 GLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 535
             ++ DE   +K+++S  +  L S +C  R++L+GTPIQN++ E +ALL+F  P L  + 
Sbjct: 724 QYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSH 783

Query: 536 SEFRRNFENPILLSRDADATDSEIAKGN-EKLQALSTIVSKFIIRRTNDILSKYLPCKYE 594
            EF   F      S+D ++      K N ++L+ L  I+  F++RR    +   L  K E
Sbjct: 784 DEFSDWF------SKDIESHAQSNTKLNQQQLRRLHMILKPFMLRRIKKNVQSELGEKIE 837

Query: 595 HVLFVNLKPFQRSVYEL----MLKCRDV--KLAVKDGTTPSQPLKH-IGALKKLCNHPDL 647
             +  +L   Q  +Y++    M    D     A  D  +  Q + + +   +K+CNHPDL
Sbjct: 838 IDVMCDLTRRQHKLYQVLKSQMSAAYDAIENAAGSDEASSDQNIVNTVMQFRKVCNHPDL 897

Query: 648 LQLPEDV 654
            +  EDV
Sbjct: 898 FE-REDV 903

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 82/144 (56%), Gaps = 2/144 (1%)

Query: 683  SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQK 742
            S K   L+  L  +K ++D +++I    T+ +D++E       Y  +RLDG+  +  R+ 
Sbjct: 1169 STKLKKLDELLVNLK-KNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRD 1227

Query: 743  LVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 802
            LV  +   + + FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ +
Sbjct: 1228 LVHDWQ-TKPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTR 1286

Query: 803  DCFIYRFICTGTIEEKIYQRQSMK 826
               +YR +  GTIEE++  R   K
Sbjct: 1287 QVTVYRLLIRGTIEERMRDRAKQK 1310

>Kwal_55.20143
          Length = 1494

 Score =  119 bits (299), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 146/306 (47%), Gaps = 37/306 (12%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I+LL  L  +     P +    I+ P+S++ NW  E  ++      
Sbjct: 693 ILADEMGLGKTIQTISLLAYLACEKHNWGPHL----IIVPTSVLLNWEMEFKRFAP---- 744

Query: 420 ASLPIDGKKSSLNNGTVAQ---AVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIG 476
                 G K     G+  Q     +GW     R     V I SY+ +  +       +  
Sbjct: 745 ------GFKVLTYYGSPQQRKEKRKGW----NRPDAFHVCITSYQLVVHDQHSFKRKKWQ 794

Query: 477 LLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR- 535
            ++ DE H +KN  S  + AL + N  RR++L+GTP+QN+L+E ++LL F  P   GT  
Sbjct: 795 YMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTAGTNG 854

Query: 536 --------SEFRRNFENP---ILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDI 584
                     F++ F  P   I+ + +  A D E  K   KL     ++  +++RR    
Sbjct: 855 GIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEETRKTVTKLHQ---VLRPYLLRRLKAD 911

Query: 585 LSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNH 644
           + K +P K+EHV++  L   QR +Y+  +     K  +  G   S  +  +  L+K+CNH
Sbjct: 912 VEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETLSSGNFMS-IINCLMQLRKVCNH 970

Query: 645 PDLLQL 650
           PDL ++
Sbjct: 971 PDLFEV 976

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 82/146 (56%), Gaps = 2/146 (1%)

Query: 684  GKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKL 743
            GK   L   L  +K     + +I +  T+ LDV+E+      Y  +RLDG   I +RQ L
Sbjct: 1217 GKLQKLATLLRDLKN-GGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQIL 1275

Query: 744  VDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 803
             +RFN  + +   F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1276 TERFN-TDNRITAFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 804  CFIYRFICTGTIEEKIYQRQSMKMSL 829
              IYRF+   TIE  I ++ + K  L
Sbjct: 1335 VHIYRFVSEHTIESNILKKANQKRQL 1360

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  118 bits (296), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 85/303 (28%), Positives = 146/303 (48%), Gaps = 32/303 (10%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWL-GKGT 418
           I+ADEMGLGKT+Q IALL  L  +     P +    I+ P+S++ NW  E  ++  G   
Sbjct: 693 ILADEMGLGKTIQTIALLAYLACEKENWGPHL----IIVPTSVLLNWEMEFKRFAPGFKV 748

Query: 419 LASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLL 478
           L+      ++         +  RGW     +     V I SY+ +  +       +   +
Sbjct: 749 LSYYGSPQQRK--------EKRRGW----NKLDAFHVCITSYQLVVHDQHSFKRKKWQYM 796

Query: 479 LADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL------- 531
           + DE H +KN +S  + AL + N  RR++L+GTP+QN+++E ++LL F  P         
Sbjct: 797 ILDEAHNIKNFKSTRWQALLNFNTRRRLLLTGTPLQNNIAELWSLLYFLMPQTALENGKI 856

Query: 532 --LGTRSEFRRNFENPI--LLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSK 587
                   F++ F  P+  +++ +    D E  +   KL     ++  +++RR    + K
Sbjct: 857 SGFADLDAFQQWFGKPVDKIIAANDSEHDDETRRTVSKLHQ---VLRPYLLRRLKADVEK 913

Query: 588 YLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDL 647
            +P KYEH+L+  L   QR +Y+  +     K  +  G   S  +  +  L+K+CNHPDL
Sbjct: 914 QMPAKYEHILYCRLSKRQRFLYDDFMSRAQTKATLASGNFMS-IINCLMQLRKVCNHPDL 972

Query: 648 LQL 650
            ++
Sbjct: 973 FEV 975

 Score =  111 bits (278), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 83/146 (56%), Gaps = 2/146 (1%)

Query: 684  GKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKL 743
            GK   L   L ++K E   + +I +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1217 GKLQSLAVLLRRLKEEGH-RALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1275

Query: 744  VDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 803
             +RFN  + +  +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1276 TERFN-TDPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 804  CFIYRFICTGTIEEKIYQRQSMKMSL 829
              IYRF    TIE  I ++ + K  L
Sbjct: 1335 VHIYRFASEHTIESNILKKANQKRQL 1360

>Scas_646.3*
          Length = 1456

 Score =  117 bits (293), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 145/303 (47%), Gaps = 31/303 (10%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW---LGK 416
           I+ADEMGLGKT+Q I+LL  L  +     P     +IV P+S++ NW  E  ++   L  
Sbjct: 666 ILADEMGLGKTIQTISLLAYLACEKQNWGP----HLIVVPTSVLLNWEMEFKRFCPGLKV 721

Query: 417 GTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIG 476
            T    P   K+            +GW     +     V I+SY+ + ++       +  
Sbjct: 722 LTYYGSPQQRKEKR----------KGW----NKPDAFHVCIVSYQLVVQDQHSFKRKKWQ 767

Query: 477 LLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL----- 531
            ++ DE H +KN  S  + AL + N  RR++++GTP+QN+L+E ++LL F  P       
Sbjct: 768 YMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSLLYFLMPQTVIDGK 827

Query: 532 ----LGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSK 587
                     F++ F  P+    +  A   + A+  + +  L  ++  +++RR    + K
Sbjct: 828 KVSGFADLDAFQQWFGRPVDKLIETGAGYQQDAETKKTVSKLHQVLRPYLLRRLKADVEK 887

Query: 588 YLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDL 647
            +P KYEH+++  L   QR +Y+  +     K  +  G   S  +  +  L+K+CNHPDL
Sbjct: 888 QMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATLASGNFMS-IVNCLMQLRKVCNHPDL 946

Query: 648 LQL 650
            ++
Sbjct: 947 FEM 949

 Score =  115 bits (287), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 86/146 (58%), Gaps = 2/146 (1%)

Query: 684  GKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKL 743
            GK   L + L  +K ++  + +I +  T+ LDV+ER      Y  +RLDG   +  RQ L
Sbjct: 1189 GKLQKLAKLLQDLK-DNGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQIL 1247

Query: 744  VDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 803
             +RFN+ + +  +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1248 TERFNN-DPRVTVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1306

Query: 804  CFIYRFICTGTIEEKIYQRQSMKMSL 829
              IYRF+   TIE  I ++ + K  L
Sbjct: 1307 VHIYRFVSEHTIESNILKKANQKRQL 1332

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 159/317 (50%), Gaps = 42/317 (13%)

Query: 353  NRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVK 412
            ++G  G I+ADEMGLGKT+Q I++L  L        P     ++V P+S ++NW NEI K
Sbjct: 738  DQGING-ILADEMGLGKTVQSISVLAHLAEHHNIWGP----FLVVTPASTLHNWVNEISK 792

Query: 413  WLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKP---VLIISYETLRRNVEH 469
            ++ +  +  LP  G   S N+  V +  + W     R   K    V+I SY+ +  +  +
Sbjct: 793  FVPQFKI--LPYWG---SANDRKVLR--KFWDRKNLRYSEKSPFHVMITSYQMVVADASY 845

Query: 470  LNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 529
            L   +   ++ DE   +K+++S  +  L S +C  R++L+GTPIQN++ E +ALL+F  P
Sbjct: 846  LQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMP 905

Query: 530  GLLGTRSEFRRNFENPILLSRDADATDSEIAKGN-----EKLQALSTIVSKFIIRRTNDI 584
             L  +  EF   F      SRD ++     A+GN     ++L+ L  I+  F++RR    
Sbjct: 906  SLFDSHDEFNEWF------SRDIESH----AEGNSSLNQQQLRRLHMILKPFMLRRIKKN 955

Query: 585  LSKYLPCKYEHVLFVNLKPFQRSVYEL----MLKCRD-VKLAVKDGT-------TPSQPL 632
            +   L  K E  +  +L   Q  +Y++    M    D ++ A  +G+       +    +
Sbjct: 956  VQSELGDKIEIDVMCDLTQRQTKLYQVLKSQMSSNYDAIENAAAEGSDIAGGGNSDQSII 1015

Query: 633  KHIGALKKLCNHPDLLQ 649
              +   +K+CNHPDL +
Sbjct: 1016 NAVMQFRKVCNHPDLFE 1032

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 82/144 (56%), Gaps = 2/144 (1%)

Query: 683  SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQK 742
            S K   L+  L ++K ++D +++I    T+ +D++E       Y  +RLDG+  +  R+ 
Sbjct: 1294 SAKLKKLDELLVELK-KNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1352

Query: 743  LVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 802
            LV  +     + FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ K
Sbjct: 1353 LVHDWQ-TNPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTK 1411

Query: 803  DCFIYRFICTGTIEEKIYQRQSMK 826
               +YR +  GTIEE++  R   K
Sbjct: 1412 QVTVYRLLVRGTIEERMRDRAKQK 1435

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  108 bits (270), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 83/151 (54%), Gaps = 6/151 (3%)

Query: 683 SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQK 742
           SGK  IL + + K+  E   K++I S +   LD+IE  C  + +   R+DG+M    RQ+
Sbjct: 33  SGKLQILQQLVPKLINEGH-KVLIFSQFVNMLDLIEDWCELNDFQACRIDGSMDNEVRQE 91

Query: 743 LVDRFN----DVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRD 798
            + +FN    D    + +FLLS++AGG GINL  A+ +++ D DWNP  D QA+ R  R 
Sbjct: 92  QIGKFNSKTTDSHAND-VFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQAMDRTHRI 150

Query: 799 GQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           GQ +   +YR  C  T+E  I  R   K  L
Sbjct: 151 GQDRPVIVYRLCCDNTVEHVILTRAVSKRKL 181

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
           Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  115 bits (288), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 143/300 (47%), Gaps = 25/300 (8%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I+LL  L  +     P +    IV P+S++ NW  E  K    G  
Sbjct: 650 ILADEMGLGKTIQTISLLSYLACEKHNWGPHL----IVVPTSVLLNWEMEF-KRFAPG-F 703

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGLLL 479
             L   G     N     +  +GW     +     V I+SY+ + ++       +   ++
Sbjct: 704 KVLTYYG-----NPQQRKEKRKGW----NKPDAFHVCIVSYQLIVQDQHSFKRKKWQYMV 754

Query: 480 ADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL-------- 531
            DE H +KN  S  + AL + N  RR++L+GTP+QN+++E ++LL F  P          
Sbjct: 755 LDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTVIDGQKVS 814

Query: 532 -LGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLP 590
                  F++ F  P+    +   T  +  +    ++ L  ++  +++RR    + K +P
Sbjct: 815 GFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLHQVLRPYLLRRLKADVEKQIP 874

Query: 591 CKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQL 650
            KYEH+++  L   QR +Y+  +     K  +  G   S  +  +  L+K+CNHPDL ++
Sbjct: 875 GKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMS-IVNCLMQLRKVCNHPDLFEV 933

 Score =  109 bits (273), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 84/146 (57%), Gaps = 2/146 (1%)

Query: 684  GKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKL 743
            GK   L   L ++K +   + +I +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1178 GKLQKLAILLQQLK-DGGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1236

Query: 744  VDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 803
             +RFN  + +  +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1237 TERFNS-DPKITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1295

Query: 804  CFIYRFICTGTIEEKIYQRQSMKMSL 829
              IYRF+   TIE  I ++ + K  L
Sbjct: 1296 VHIYRFVSEHTIESNILKKANQKRQL 1321

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  115 bits (287), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 87/309 (28%), Positives = 148/309 (47%), Gaps = 37/309 (11%)

Query: 360  IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
            I+ADEMGLGKT+Q I++L  L        P     ++V P+S ++NW NEI K+L +  +
Sbjct: 728  ILADEMGLGKTVQSISVLAHLAENHNIWGP----FLVVTPASTLHNWVNEISKFLPQFKI 783

Query: 420  ASLPIDGKKSSLNNGTVAQAVRGW----ALARGRSVVKPVLIISYETLRRNVEHLNNCEI 475
              LP  G      N    + +R +     L   ++    V++ SY+ +  +  +L   + 
Sbjct: 784  --LPYWG------NANDRKVLRKFWDRKNLRYNKNAPFHVMVTSYQMVVTDANYLQKMKW 835

Query: 476  GLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 535
              ++ DE   +K+++S  +  L S +C  R++L+GTPIQN + E +ALL+F  P L  + 
Sbjct: 836  QYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSH 895

Query: 536  SEFRRNFENPILLSRDADATDSEIAKGN-EKLQALSTIVSKFIIRRTNDILSKYLPCKYE 594
             EF   F      S+D ++      K N ++L+ L  I+  F++RR    +   L  K E
Sbjct: 896  DEFNEWF------SKDIESHAEANTKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDKIE 949

Query: 595  HVLFVNLKPFQRSVYELMLKCRDVKL------AVKDGTTPSQP--------LKHIGALKK 640
              +  +L   Q  +Y+++              A  D T+ S          +  +   +K
Sbjct: 950  IDVLCDLTQRQAKLYQVLKSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQFRK 1009

Query: 641  LCNHPDLLQ 649
            +CNHPDL +
Sbjct: 1010 VCNHPDLFE 1018

 Score =  102 bits (254), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 81/144 (56%), Gaps = 2/144 (1%)

Query: 683  SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQK 742
            S K   L+  L K+K+E   +++I    T+ +D++E       Y  +RLDG+  +  R+ 
Sbjct: 1298 SAKLRKLDELLVKLKSEGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1356

Query: 743  LVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 802
            LV  +     + F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ +
Sbjct: 1357 LVHDW-QTNPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTR 1415

Query: 803  DCFIYRFICTGTIEEKIYQRQSMK 826
               +YR +  GTIEE++  R   K
Sbjct: 1416 QVTVYRLLVRGTIEERMRDRAKQK 1439

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 86/309 (27%), Positives = 149/309 (48%), Gaps = 37/309 (11%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
           I+ADEMGLGKT+Q I++L  L  +     P     I+V P+S ++NW NEI K++    +
Sbjct: 677 ILADEMGLGKTVQSISVLAHLAERYNIWGP----FIVVTPASTLHNWVNEIQKFVPDFKI 732

Query: 420 ASLPIDGKKSSLNNGTVAQAVRGW----ALARGRSVVKPVLIISYETLRRNVEHLNNCEI 475
             LP  G      NG   + +R +     L   +     V+I SY+ +  +  +L   + 
Sbjct: 733 --LPYWG------NGNDRKILRRFWDRKHLRYSKDAPFHVMITSYQMIVSDAAYLQKMKW 784

Query: 476 GLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 535
             ++ DE   +K+++S  +  L S +C  R++L+GTPIQN + E +ALL+F  P L  + 
Sbjct: 785 QYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSH 844

Query: 536 SEFRRNFENPILLSRDADA-TDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKYE 594
            EF   F      S+D ++   S      ++L+ L  I+  F++RR    +   L  K E
Sbjct: 845 DEFNDWF------SKDIESHAQSNTQLNQQQLRRLHMILKPFMLRRIKKNVQSELGDKIE 898

Query: 595 HVLFVNLKPFQRSVYELMLKCRDVKL-AVKDGT-------------TPSQPLKHIGALKK 640
             +  +L   Q  +Y+++         A+++               + S+ +  +   +K
Sbjct: 899 IDVMCDLTHRQAKLYQVLKSQVSASYDAIENAASNSSGDDSGNMSLSDSKIMNTVMEFRK 958

Query: 641 LCNHPDLLQ 649
           +CNHPDL +
Sbjct: 959 VCNHPDLFE 967

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 80/144 (55%), Gaps = 2/144 (1%)

Query: 683  SGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQK 742
            S K   L+  L ++K   + +++I    T+ +D+IE       Y  +RLDG+  +  R+ 
Sbjct: 1239 SAKLKKLDELLVRLKA-GEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRRD 1297

Query: 743  LVDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 802
            LV  +   +   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ K
Sbjct: 1298 LVHDWQ-TKSDIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTK 1356

Query: 803  DCFIYRFICTGTIEEKIYQRQSMK 826
               +YR +  GTIEE++  R   K
Sbjct: 1357 QVTVYRLLIKGTIEERMRDRAKQK 1380

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  112 bits (280), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 85/146 (58%), Gaps = 2/146 (1%)

Query: 684  GKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKL 743
            GK   L   L ++K ++  + +I +  T+ LDV+E+      Y  +RLDG   I  RQ L
Sbjct: 1246 GKLQKLAILLQQLK-DNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQIL 1304

Query: 744  VDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 803
             +RFN  + +  +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1305 TERFN-TDSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1363

Query: 804  CFIYRFICTGTIEEKIYQRQSMKMSL 829
              IYRF+   TIE  I ++ + K  L
Sbjct: 1364 VHIYRFVSEHTIESNILKKANQKRQL 1389

 Score =  112 bits (279), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 87/306 (28%), Positives = 143/306 (46%), Gaps = 37/306 (12%)

Query: 360  IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
            I+ADEMGLGKT+Q I+LL  L  +     P +    IV P+S++ NW  E  ++      
Sbjct: 718  ILADEMGLGKTIQTISLLAYLACEKENWGPHL----IVVPTSVLLNWEMEFKRFAP---- 769

Query: 420  ASLPIDGKKSSLNNGTVAQ---AVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIG 476
                  G K     G+  Q     +GW     +     V I+SY+ + ++          
Sbjct: 770  ------GFKVLTYYGSPQQRKEKRKGW----NKPDAFHVCIVSYQLVVQDQHSFKRKRWQ 819

Query: 477  LLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL----- 531
             ++ DE H +KN  S  + AL + N  RR++L+GTP+QN+L+E ++LL F  P       
Sbjct: 820  YMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVIDGK 879

Query: 532  ----LGTRSEFRRNFENP---ILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDI 584
                      F++ F  P   I+ +      D E  K   KL     ++  +++RR    
Sbjct: 880  KVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLHQ---VLRPYLLRRLKAD 936

Query: 585  LSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNH 644
            + K +P KYEH+++  L   QR +Y+  +     K  +  G   S  +  +  L+K+CNH
Sbjct: 937  VEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMS-IVNCLMQLRKVCNH 995

Query: 645  PDLLQL 650
            P+L ++
Sbjct: 996  PNLFEV 1001

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  112 bits (280), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 88/306 (28%), Positives = 143/306 (46%), Gaps = 37/306 (12%)

Query: 360  IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTL 419
            I+ADEMGLGKT+Q I+LL  L  +     P +    IV P+S++ NW  E  ++      
Sbjct: 787  ILADEMGLGKTIQTISLLAYLACEKENWGPHL----IVVPTSVLLNWEMEFKRFAP---- 838

Query: 420  ASLPIDGKKSSLNNGTVAQ---AVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIG 476
                  G K     G+  Q     +GW     +     V I SY+ +  +       +  
Sbjct: 839  ------GFKVLTYYGSPQQRREKRKGW----NKPDAFHVCITSYQLVVHDQHSFKRKKWQ 888

Query: 477  LLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL----- 531
             ++ DE H +KN  S  + AL + N  RR++L+GTP+QN+L+E ++LL F  P       
Sbjct: 889  YMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTALENG 948

Query: 532  ----LGTRSEFRRNFENP---ILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDI 584
                      F++ F  P   I+ + +    D E  K   KL     ++  +++RR    
Sbjct: 949  KVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKKTVSKLHQ---VLRPYLLRRLKAD 1005

Query: 585  LSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNH 644
            + K +P KYEH+++  L   QR +Y+  +     K  +  G   S  +  +  L+K+CNH
Sbjct: 1006 VEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLASGNFMS-IINCLMQLRKVCNH 1064

Query: 645  PDLLQL 650
            PDL ++
Sbjct: 1065 PDLFEV 1070

 Score =  111 bits (277), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 85/146 (58%), Gaps = 2/146 (1%)

Query: 684  GKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKL 743
            GK   L + L  +K ++  + +I +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1310 GKLQKLAQLLQNLK-DNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQIL 1368

Query: 744  VDRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 803
             +RFN  + +  +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1369 TERFNS-DPRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1427

Query: 804  CFIYRFICTGTIEEKIYQRQSMKMSL 829
              IYRF+   TIE  I ++ + K  L
Sbjct: 1428 VHIYRFVSDHTIESNILKKANQKRHL 1453

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 99.0 bits (245), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 105/184 (57%), Gaps = 14/184 (7%)

Query: 657  SEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNR------FLHKIKT----ESDDKIVI 706
            S D + E+Y N  ++KR H +++  Y   F  L++       L  IKT     +D+K+++
Sbjct: 1366 STDELREEYENE-MTKRRH-KLKYDYQLNFENLHQSKKVQQCLGIIKTVLDNSTDEKLIV 1423

Query: 707  ISNYTQTLDVIERMCRTS-SYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGG 765
             S +T   D+++   +   +   +R DGTM  N R  +++RF   E  E + L+S KAG 
Sbjct: 1424 FSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYR-EKNERLLLISMKAGN 1482

Query: 766  CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSM 825
             G+ L  AN +IL+DP WNP  ++QA+ R +R  Q+++ +I+R +   TIE++I + Q+ 
Sbjct: 1483 SGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDRIVELQNR 1542

Query: 826  KMSL 829
            K +L
Sbjct: 1543 KRTL 1546

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 84/344 (24%), Positives = 151/344 (43%), Gaps = 73/344 (21%)

Query: 358  GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKG 417
            G ++AD+MGLGKT+Q IAL+            T    ++V P +++  W +EI   + K 
Sbjct: 917  GGLLADDMGLGKTVQAIALMLA----NRSADSTCKTNLVVGPVAVLRVWHDEINTKVKKQ 972

Query: 418  TLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLR------------- 464
               S+ I G       G   + V  +       VV    ++SY+TL              
Sbjct: 973  AQFSVMIYG-------GFGGKKVENFKAMHNYDVV----LVSYQTLAVEFKKHWPARLQG 1021

Query: 465  -----------RNVEHLNNCEIG---------------LLLADEGHRLKNAESQTFTALD 498
                        +++ +N+ ++                 ++ DE   +KN ++Q   A  
Sbjct: 1022 TSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQNIKNKQTQAAKACC 1081

Query: 499  SINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSR--DADATD 556
            ++N   R  LSGTPIQN++ E ++LL F          +F+ +  N  LLSR  D D+ D
Sbjct: 1082 TLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGNA-LLSRGGDFDSMD 1140

Query: 557  SEIAKGNEKLQALSTIVSKFIIRR--TNDILSK---YLPCKY----EHVLFVNLKPFQRS 607
            ++ A     L+ +  ++   ++RR  T+ I  +    LP K+    E +L      F +S
Sbjct: 1141 TKRA-----LKKVRVLLRAIMLRRAKTSQINGQPILELPAKHIRKKEDILDGQDLEFYKS 1195

Query: 608  V-YELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQL 650
            + +E  ++ R + L  +  ++ S  L  +  L++ C H +L++L
Sbjct: 1196 LEHETAIQARAL-LNERKASSSSNILTLLLRLRQACCHQELVKL 1238

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 98/188 (52%), Gaps = 19/188 (10%)

Query: 647  LLQLPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVI 706
            LL+L ED+ G  + +P  Y N+  S +  A           ++    H   T +++++V+
Sbjct: 888  LLKL-EDINGKLEPVP--YSNTKKSSKIVA-----------LIRHLKHLQDTSANEQVVV 933

Query: 707  ISNYTQTLDVIERMCRTSSYP----VVRLDGTMTINKRQKLVDRFNDVEGQEF-IFLLSS 761
             S ++  LD++E   R S       + + DG + + +R  ++ +F +    +  + LLS 
Sbjct: 934  FSQFSSYLDILENELRQSFASDICEIYKFDGRLDLKERSNVLAKFTEKSLVKMKVLLLSL 993

Query: 762  KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQ 821
            KAGG G+NL  A+   +MDP W+P  + QA+ R+ R GQ     IYRFI   +IEEK+ +
Sbjct: 994  KAGGVGLNLTCASHAFIMDPWWSPGMEDQAMDRIHRIGQSNTVKIYRFIVENSIEEKMLR 1053

Query: 822  RQSMKMSL 829
             Q  K SL
Sbjct: 1054 IQEKKRSL 1061

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 91/352 (25%), Positives = 147/352 (41%), Gaps = 60/352 (17%)

Query: 358 GCIMADEMGLGKTLQCIALLWTL------LRQGPQGKP-----------------TIDKC 394
           G I+ADEMGLGKT+  +AL+  +      L    Q KP                 T    
Sbjct: 455 GGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTT 514

Query: 395 IIVCPSSLVNNWANEIVKWL-GKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVK 453
           +IV P SL+  W NE V+   G G    +   G  S+L    V Q      +     VV+
Sbjct: 515 LIVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLLVKQKSPPSVVLTTYGVVQ 574

Query: 454 P----VLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILS 509
                +    YE    + E L + E   ++ DEGH ++N  ++T  A+ ++   R+ +L+
Sbjct: 575 TEWSKLQQFDYEA---SNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMALTSRRKWVLT 631

Query: 510 GTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQAL 569
           GTPI N L + F+L+ F N         +R+   +P            E    +  L+ +
Sbjct: 632 GTPIMNRLDDLFSLIKFMNFEPWCKIDYWRQFVSDPF-----------EKKDYSSALEVI 680

Query: 570 STIVSKFIIRRTNDILSK------YLPCKYEHVLFVNLKPFQRSVYELMLKCRD--VKLA 621
             ++   ++RRT ++  +       LP K   +  +     +  +Y+  L   +  VK +
Sbjct: 681 QAVMGPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLYKYFLSKAEHSVKES 740

Query: 622 VKDG---TTPSQPLKHIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNSTL 670
           +  G      S  L HI  L+++C H  LL       GS+D   ED +N  L
Sbjct: 741 LARGDLLKKYSTILLHILRLRQVCCHFKLL-------GSQDENDEDLKNMKL 785

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 90/161 (55%), Gaps = 9/161 (5%)

Query: 675  HAEVQTWYSGKFSILNRFLHKIK-TESDDKIVIISNYTQTLDVIERMCRT----SSYPVV 729
            H+  Q   S K   L R L +I+ T   ++I++ S ++  LD++E   R+        + 
Sbjct: 933  HSHFQ---STKIKALLRHLKQIQETSPGEQIIVFSQFSSFLDILEIELRSHLPRDQVIIY 989

Query: 730  RLDGTMTINKRQKLVDRFNDVEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAAD 788
            + DG + + +R +++++F+D +     + LLS K GG G+NL  A+R  +MDP W+P  +
Sbjct: 990  KFDGRLDMKERTRILEQFHDKDLSCIKLLLLSLKTGGVGLNLTCASRAFMMDPWWSPGME 1049

Query: 789  QQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
             QA+ R+ R GQ++   + RFI   ++EEK+ + Q  K  L
Sbjct: 1050 DQAIDRIHRIGQQQTVKVVRFIIDNSVEEKMLRIQERKRML 1090

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 151/358 (42%), Gaps = 70/358 (19%)

Query: 358 GCIMADEMGLGKTLQCIALLWTL-----------------------------LRQGPQGK 388
           G I+ADEMGLGKT+  +AL+ T                              LR      
Sbjct: 479 GGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHKH 538

Query: 389 PTID--KCIIVCPSSLVNNWANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALA 446
            T      +IV P SL+N W +E  K      L       K+  +  G   + +R + L 
Sbjct: 539 DTYAYRTTLIVVPMSLLNQWQSEFEK--ANKDLK------KRCEIYYGNNIKDLRAYVLG 590

Query: 447 RG--RSVVKPVLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPR 504
                 ++    II  E  R +   L N     ++ DEGH ++N  ++T  A+ ++   R
Sbjct: 591 PNAPSVIITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIALRSSR 650

Query: 505 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNE 564
           + IL+GTPI N L + F+L+ F N       + ++R    P      A A D        
Sbjct: 651 KWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYAQAFD-------- 702

Query: 565 KLQALSTIVSKFIIRRT---NDILSK---YLPCKYEHVLFVNLKPFQRSVYELMLKCRDV 618
               ++ ++   ++RRT    D+  K    LP K   V  + L   ++ VY+ ML+  D 
Sbjct: 703 ---VINAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVYQSMLE--DA 757

Query: 619 KLAVKDGTTPSQPLK-------HIGALKKLCNHPDLLQLPEDVEGSEDVIPEDYRNST 669
           + +VK+G      LK       HI  L+++C H DLL+   D+ G  D+  ED  NST
Sbjct: 758 ENSVKEGLAKGDLLKNYTNILVHILRLRQVCCHLDLLKKTPDL-GDPDL--EDLENST 812

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 88/153 (57%), Gaps = 8/153 (5%)

Query: 684  GKFSILNRFLHKIKTES-DDKIVIISNYTQTLDVIE----RMCRTSSYPVVRLDGTMTIN 738
             K + L R L +++  S  +++V+ S ++  LD++E     +  ++   V + DG +++ 
Sbjct: 975  AKLNALIRHLQQLQDSSAGEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLK 1034

Query: 739  KRQKLVDRFN--DVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 796
            +R  +++ F   D   Q+ + LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ 
Sbjct: 1035 ERTAVLEDFKVKDYAVQK-VLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIH 1093

Query: 797  RDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            R GQ     + RF+  G+IEEK+ + Q  K +L
Sbjct: 1094 RIGQTNSVKVIRFVIDGSIEEKMLRIQDRKRTL 1126

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 88/220 (40%), Gaps = 57/220 (25%)

Query: 351 SQNRGAYGCIMADEMGLGKTLQCIALLW-----------TLLRQG--------------P 385
           + N    G I++DEMGLGKT+  ++L+            +L  Q               P
Sbjct: 501 TMNSFKNGGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEP 560

Query: 386 QGKPTIDKCIIVCPSSLVNNWANEIVKWLGK-GTLASLPIDGKKSSL--------NNGTV 436
           +        +I+ P SL+  W +E  K     G    L   G  SSL        N  TV
Sbjct: 561 ERSYAYKTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLLIKRKNPPTV 620

Query: 437 AQAVRG-----WA-LARG----RSVVKPVLIISYETLRRNVEHLNNCEIGLLLADEGHRL 486
                G     W  L++     RS+ +   I S E  R             ++ DEGH +
Sbjct: 621 VLTTYGIVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFR-------------IILDEGHTI 667

Query: 487 KNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNF 526
           +N  + T  A+  ++   R IL+GTPI N L + ++L+ F
Sbjct: 668 RNKSTITSKAVLELSSKYRWILTGTPIINRLDDLYSLVKF 707

>Kwal_47.17771
          Length = 972

 Score = 85.9 bits (211), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 78/133 (58%), Gaps = 5/133 (3%)

Query: 702 DKIVIISNYTQTLDVIERMCRT----SSYPVVRLDGTMTINKRQKLVDRFNDVEGQEF-I 756
           ++IV+ S ++  LD+IE    +    S+  V + DG +++ +R K++  F   +     I
Sbjct: 816 EQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERSKVLQDFAVKDMTRLKI 875

Query: 757 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIE 816
            LLS KAGG G+NL  A+R  +MDP W+P+ + QA+ R+ R GQ  +  + RFI   +IE
Sbjct: 876 LLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNNVKVVRFIIEHSIE 935

Query: 817 EKIYQRQSMKMSL 829
           EK+ + Q  K +L
Sbjct: 936 EKMLRIQERKRTL 948

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 143/362 (39%), Gaps = 86/362 (23%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKC----------------------- 394
           G I+ADEMGLGKT+  +A++ T+      GK  + +                        
Sbjct: 335 GGILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYA 394

Query: 395 ----IIVCPSSLVNNWANEIVKW-LGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGR 449
               ++V P SL++ W  E  K    K     +   G  SSL +           L + +
Sbjct: 395 SGTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLKS----------LLTKTK 444

Query: 450 SVVKPVLIISYETLRR--------------NVEHLNNCEIGLLLADEGHRLKNAESQTFT 495
           S    VLI +Y T++               +V  L + E   ++ DEGH ++N  ++T  
Sbjct: 445 S-PPTVLITTYGTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSR 503

Query: 496 ALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADAT 555
           +L  +   R  IL+GTPI N L + ++L+ F           ++    +P          
Sbjct: 504 SLMDLKSTRSWILTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPF--------- 554

Query: 556 DSEIAKGNEKLQALSTIVSKFIIRRTN---DILSK---YLPCKYEHVLFVNLKPFQRSVY 609
             E          +S+I+   I+RRT    D+  K    LP K   +  V     + ++Y
Sbjct: 555 --EKKNYKAAFDIVSSILEPVILRRTKGMRDVDGKRLVELPPKEVIIEKVAFNKNEDALY 612

Query: 610 ELMLKCRDVKLAVKDGTTPSQPLK-------HIGALKKLCNHPDLLQLPEDVEGSEDVIP 662
           +  L     + +VK+G      LK       HI  L+++C H DLL       GS+D   
Sbjct: 613 KYFLN--KAESSVKEGLDRGDLLKKYSTILVHILRLRQVCCHADLL-------GSQDEND 663

Query: 663 ED 664
           ED
Sbjct: 664 ED 665

>Kwal_23.3660
          Length = 768

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 74/127 (58%), Gaps = 1/127 (0%)

Query: 703 KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
           K ++ S +T  LD++E   + + +  V+L G+MT  +R + +  F D    E +FL+S K
Sbjct: 617 KSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMDNTHCE-VFLVSLK 675

Query: 763 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
           AGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I RF    +IE +I + 
Sbjct: 676 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIESRIIEL 735

Query: 823 QSMKMSL 829
           Q  K ++
Sbjct: 736 QEKKANM 742

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 89/186 (47%), Gaps = 19/186 (10%)

Query: 350 VSQNRGAY-GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWAN 408
           +SQ    Y G ++ADEMG+GKT+Q IALL   + + P         ++V P+  +  W N
Sbjct: 174 ISQEHSVYNGGVLADEMGMGKTIQTIALLMNDVTKKPS--------LVVAPTVALMQWKN 225

Query: 409 EIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNV- 467
           EI +  G G L +    G   + N G          L    +V++ V        +R   
Sbjct: 226 EIEQHTG-GKLKTHIFHGANRTSNVGEFKDVD---VLLTTYAVLESVFRKQNYGFKRKSG 281

Query: 468 -----EHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFA 522
                  L+N     ++ DE H +K+ +S T  A++S+   ++  L+GTP+QN + E ++
Sbjct: 282 VYKEPSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLLTEKKWCLTGTPLQNRIGEMYS 341

Query: 523 LLNFSN 528
           L+ F N
Sbjct: 342 LIRFLN 347

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 87/153 (56%), Gaps = 5/153 (3%)

Query: 680 TWYSG-KFSILNRFLHKIKTESDD-KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTI 737
           TW S  K   L   L+K+++     K ++ S +T  LD++E   + + +  V+L G+M+ 
Sbjct: 654 TWRSSTKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSP 713

Query: 738 NKRQKLVDRFND-VEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 796
            +R + +  F D +E +  +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV 
Sbjct: 714 TQRDQTIKYFMDNIECE--VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVH 771

Query: 797 RDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           R GQ +   I RF    +IE +I + Q  K ++
Sbjct: 772 RIGQYRPVKITRFCIEDSIEARIIELQEKKANM 804

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 87/184 (47%), Gaps = 19/184 (10%)

Query: 350 VSQNRGAY-GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWAN 408
           +SQ    Y G ++ADEMG+GKT+Q IALL     + P         ++V P+  +  W N
Sbjct: 237 LSQEDSIYNGGVLADEMGMGKTIQTIALLMNDRSKKPS--------LVVAPTVALMQWKN 288

Query: 409 EIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRR--- 465
           EI +    G L++    G   ++N   +        +    SV++ V        RR   
Sbjct: 289 EIEQHTN-GALSTYIYHGASRTINIHDLKDID---VILTTYSVLESVFRKQNYGFRRKNG 344

Query: 466 ---NVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFA 522
                  L+N +    + DE H +K+  S T  A++++   +R  LSGTP+QN + E ++
Sbjct: 345 LVKEKSLLHNIDFYRAILDEAHNIKDRTSNTSRAVNALKTQKRWCLSGTPLQNRIGEMYS 404

Query: 523 LLNF 526
           L+ F
Sbjct: 405 LIRF 408

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 74/127 (58%), Gaps = 1/127 (0%)

Query: 703 KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
           K ++ S +T  LD++E   + + +   +L G+MT  +R + ++ F D    E +FL+S K
Sbjct: 595 KSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQRAETINYFMDNVHCE-VFLVSLK 653

Query: 763 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
           AGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I RF    +IE +I + 
Sbjct: 654 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQHRPVKITRFCIEDSIESRIIEL 713

Query: 823 QSMKMSL 829
           Q  K ++
Sbjct: 714 QEKKANM 720

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 88/175 (50%), Gaps = 19/175 (10%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKG 417
           G ++ADEMG+GKT+Q I+LL     +GP         ++V P+  +  W NEI K+ G G
Sbjct: 164 GGVLADEMGMGKTVQMISLLLHA-NKGPT--------LVVAPTVALIQWKNEIDKYTG-G 213

Query: 418 TLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNV------EHLN 471
            L SL   G   S  +  +A A     +    +V++ V     +  RR          L+
Sbjct: 214 ALRSLVFHGPGRSAVSEELAAAD---VVLTTYAVLESVYRKQTQGFRRKAGVVREQSPLH 270

Query: 472 NCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNF 526
             +   ++ DE H +K+  S T  +++++   RR  L+GTP+QN + E ++L+ F
Sbjct: 271 AVDFYRVVLDEAHNIKDRSSGTARSVNALRAVRRWCLTGTPLQNRIGEMYSLIRF 325

>Scas_591.10
          Length = 772

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 88/153 (57%), Gaps = 5/153 (3%)

Query: 680 TWYSG-KFSILNRFLHKIKTESDD-KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTI 737
           TW S  K   L   L+K+++     K ++ S +T  LD++E   + + +  V+L G+M+ 
Sbjct: 596 TWQSSTKIEALVEELYKLRSPVRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSP 655

Query: 738 NKRQKLVDRF-NDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 796
            +R + +  F N++E +  +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV 
Sbjct: 656 TQRDETIKYFMNNIECE--VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVH 713

Query: 797 RDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
           R GQ +   I RF    +IE +I + Q  K ++
Sbjct: 714 RIGQFRPVKITRFCIEDSIESRIIELQEKKANM 746

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 96/196 (48%), Gaps = 39/196 (19%)

Query: 350 VSQNRGAY-GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWAN 408
           + Q  G + G ++ADEMG+GKT+Q IALL   L + P         ++V P+  +  W N
Sbjct: 178 IQQEEGIFKGGVLADEMGMGKTIQTIALLMNDLTKRPS--------LVVAPTVALMQWKN 229

Query: 409 EIVK--------WLGKGTLASLPIDGKKSS-----LNNGTVAQAV---RGWALARGRSVV 452
           EI +        ++  GT  S  ID K  S     L    V ++V   + +   R   VV
Sbjct: 230 EINQHTDGKLKVYMFHGT--SKNIDIKTLSEYDVVLTTYAVLESVFRKQNYGFKRKHGVV 287

Query: 453 KPVLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTP 512
           K + +            L+N E   ++ DE H +K+ +S T  A++++   +R  L+GTP
Sbjct: 288 KELSV------------LHNIEFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLTGTP 335

Query: 513 IQNDLSEYFALLNFSN 528
           +QN + E ++L+ F N
Sbjct: 336 LQNRIGEMYSLIRFLN 351

>Scas_721.100
          Length = 1137

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 86/153 (56%), Gaps = 8/153 (5%)

Query: 684  GKFSILNRFLHKIKTES-DDKIVIISNYTQTLDVIERMCR----TSSYPVVRLDGTMTIN 738
             K S L + L  ++  S  +++VI S ++  LD++E   +    T    + + DG +++ 
Sbjct: 962  AKLSALLKHLQLLQDSSAGEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLK 1021

Query: 739  KRQKLVDRFN--DVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 796
            +R  ++  F   D+  Q+ I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ 
Sbjct: 1022 ERSTVLQDFQIKDLSRQK-ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIH 1080

Query: 797  RDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            R GQ  +  + RFI   +IEEK+ + Q  K ++
Sbjct: 1081 RIGQTNNVKVVRFIIENSIEEKMLRIQERKRTI 1113

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 87/198 (43%), Gaps = 32/198 (16%)

Query: 358 GCIMADEMGLGKTLQCIALLWTL----------LRQG---------PQGKPTIDKC-IIV 397
           G I++DEMGLGKT+  +AL+ +           L +G         P  KP   K  +IV
Sbjct: 501 GGILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIV 560

Query: 398 CPSSLVNNWANEIVKWLGKGTLAS-LPIDGKKSSL--------NNGTVAQAVRGWALARG 448
            P SL+N W  E  K      + S +   G  SSL        N  TV     G   +  
Sbjct: 561 VPMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSSLKKLLTKTHNPPTVVITTYGIVQSEW 620

Query: 449 RSVVKPVLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVIL 508
             + K   I +     ++   L + +   ++ DEGH ++N  + T  A+  +    + +L
Sbjct: 621 SKIFKKQNIGAE---IQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLTSKCKWVL 677

Query: 509 SGTPIQNDLSEYFALLNF 526
           +GTPI N L + ++L+ F
Sbjct: 678 TGTPIINRLDDLYSLVRF 695

>Kwal_14.1868
          Length = 1357

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (52%), Gaps = 7/146 (4%)

Query: 686  FSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTS-SYPVVRLDGTMTINKRQKLV 744
              I+     K KTE   KI++ S +T   D+++   R       +R DG+M    R   +
Sbjct: 1182 LDIIRDVFLKSKTE---KIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATI 1238

Query: 745  DRF-NDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 803
            + F   +E +  I L+S KAG  G+ L  AN +IL+DP WNP  ++QA+ R +R  Q +D
Sbjct: 1239 EEFYRSLERR--ILLISMKAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRD 1296

Query: 804  CFIYRFICTGTIEEKIYQRQSMKMSL 829
              ++R +   ++E++I + Q  K  L
Sbjct: 1297 VQVHRLLVKNSVEDRILELQKKKREL 1322

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 117/269 (43%), Gaps = 67/269 (24%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKC---IIVCPSSLVNNWANEIVKWL 414
           G ++AD+MGLGKT+Q IAL+          K  ++ C   +IV P +++  W  E+   +
Sbjct: 696 GGLLADDMGLGKTVQAIALMLA-------NKSGVENCKTNLIVAPVAVLRVWQAEVKTKV 748

Query: 415 GKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVK-PVLIISYETLRRNVE----- 468
            K +       G K  +  G     V  +     RS+++  V+++SY+TL   ++     
Sbjct: 749 KKTS-------GLKVLIYGGGNGAKVENY-----RSLLRHDVVLVSYQTLASELKKHWPA 796

Query: 469 ---------------------------------HLNNCEIGLLLADEGHRLKNAESQTFT 495
                                            + N  +   ++ DE   +KN ++Q+  
Sbjct: 797 RLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRIILDEAQNIKNKKTQSAK 856

Query: 496 ALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPI-LLSRDADA 554
           A  +++   R  LSGTP+QN++ E ++L+ F          +F+ +  NP+   + D D+
Sbjct: 857 ACCTLDATYRWALSGTPMQNNIMELYSLIRFLKISPYKREQKFKLDIGNPLGKATNDYDS 916

Query: 555 TDSEIAKGNEKLQALSTIVSKFIIRRTND 583
            D + A     ++ +  ++   ++RRT D
Sbjct: 917 HDRQQA-----IKKVQVLLRAIMLRRTKD 940

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 82.8 bits (203), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 78/133 (58%), Gaps = 2/133 (1%)

Query: 698  TESDDKIVIISNYTQTLDVIERMCRTS-SYPVVRLDGTMTINKRQKLVDRFNDVEGQEFI 756
            + +D+K+VI S +T   +++    + +     +R DG+M+ ++R   ++ F   +    +
Sbjct: 1443 SNTDEKLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESFYQ-DNNYRV 1501

Query: 757  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIE 816
             L+S KAG  G+ L  AN +IL DP WNP  ++QA+ R  R  Q+++ +++R +   ++E
Sbjct: 1502 MLISMKAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVE 1561

Query: 817  EKIYQRQSMKMSL 829
            ++I + Q+ K +L
Sbjct: 1562 DRIVELQNKKKTL 1574

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 117/272 (43%), Gaps = 55/272 (20%)

Query: 347  SSEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNW 406
            S E S  RG    ++AD+MGLGKT+Q +ALL   +   P+ K  I   ++V P +++  W
Sbjct: 932  SMEKSSKRGG---LLADDMGLGKTVQSLALL---MANKPEPKSAIKTTLVVAPVAVLRVW 985

Query: 407  ANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLR-- 464
             +E+   + K     + I G     NN +     R W       +V    ++SY+TL   
Sbjct: 986  KDEVAVKIKKDVNVKVVIFG--GGENNSS---KFRSWKDLAEYDIV----LVSYQTLASE 1036

Query: 465  ---------RNVEHL--------------------------NNCEIGLLLADEGHRLKNA 489
                     +N EH                           N+ E   ++ DE   +KN 
Sbjct: 1037 FKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRVILDEAQNIKNK 1096

Query: 490  ESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLS 549
            ++Q   A  +I+   R  LSGTPIQN++ E ++L+ F         ++F  +    +   
Sbjct: 1097 KTQAAKACCTISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKFHSDIGAVLNTK 1156

Query: 550  RDADATDSEIAKGNEKLQALSTIVSKFIIRRT 581
            +  D  DSE  +  +K+Q L   +   ++RRT
Sbjct: 1157 KPYDYNDSERQRAMKKVQVL---LRAIMLRRT 1185

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 82.4 bits (202), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 86/149 (57%), Gaps = 4/149 (2%)

Query: 683 SGKFSILNRFLHKIKTESDD-KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQ 741
           S K   L   L+K+++     K ++ S +T  LD++E   + + +  V+L G+M+  +R 
Sbjct: 618 STKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 677

Query: 742 KLVDRF-NDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 800
           + +  F N+++ +  +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ
Sbjct: 678 ETIKYFMNNIQCE--VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQ 735

Query: 801 KKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
            +   I RF    +IE +I + Q  K ++
Sbjct: 736 YRPVKITRFCIEDSIEARIIELQEKKANM 764

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 93/187 (49%), Gaps = 21/187 (11%)

Query: 350 VSQNRGAY-GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWAN 408
           +SQ    Y G ++ADEMG+GKT+Q IALL   L + P         ++V P+  +  W N
Sbjct: 196 ISQEESIYAGGVLADEMGMGKTIQTIALLMNDLTKSPS--------LVVAPTVALMQWKN 247

Query: 409 EIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGW-ALARGRSVVKPVLIISYETLRRNV 467
           EI +   KG L      G   +    T  + ++G+  +    +V++ V        RR  
Sbjct: 248 EIEQH-TKGQLKIYIYHGASRT----TDIKDLQGYDVVLTTYAVLESVFRKQNYGFRRKN 302

Query: 468 ------EHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYF 521
                   L+N +   ++ DE H +K+ +S T  A++++   +R  LSGTP+QN + E +
Sbjct: 303 GLFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCLSGTPLQNRIGEMY 362

Query: 522 ALLNFSN 528
           +L+ F N
Sbjct: 363 SLIRFLN 369

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 74/127 (58%), Gaps = 1/127 (0%)

Query: 703 KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
           K ++ S +T  LD++E   + + +  V+L G+MT  +R + +  F +    E +FL+S K
Sbjct: 649 KSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMENIHCE-VFLVSLK 707

Query: 763 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
           AGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I RF    +IE +I + 
Sbjct: 708 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIEL 767

Query: 823 QSMKMSL 829
           Q  K S+
Sbjct: 768 QEKKASM 774

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 84/177 (47%), Gaps = 18/177 (10%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKG 417
           G ++ADEMG+GKT+Q IALL + + + P         ++V P+  +  W NEI +   K 
Sbjct: 215 GGVLADEMGMGKTIQTIALLMSDITRKPS--------LVVAPTVALMQWKNEIEQHTNK- 265

Query: 418 TLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNV------EHLN 471
            L+     G   + N G          +    +V++ V        +R          L+
Sbjct: 266 KLSVYMYHGANRTNNLGDFKDVD---VILTTYAVLESVYRKQVYGFKRKAGTVKEKSLLH 322

Query: 472 NCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 528
           +     ++ DE H +K+  S T  A++S+   +R  LSGTP+QN + E ++L+ F N
Sbjct: 323 SINFYRVILDEAHNIKDRTSNTAKAVNSLQTKKRWCLSGTPLQNRIGEMYSLIRFLN 379

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 78/145 (53%), Gaps = 5/145 (3%)

Query: 686  FSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTS-SYPVVRLDGTMTINKRQKLV 744
              ++N+   K  +E   KI+I S +T  LD++E +  T      ++  G M    R +++
Sbjct: 1238 MDVINKVFEKSDSE---KIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEII 1294

Query: 745  DRFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDC 804
             RF   E +  + L+S KAG  G+ L  AN ++++DP WNP  ++QA  R +R  Q ++ 
Sbjct: 1295 SRFYSEEDKR-VLLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREV 1353

Query: 805  FIYRFICTGTIEEKIYQRQSMKMSL 829
             ++R     ++E++I + Q +K  +
Sbjct: 1354 TVHRLFIKNSVEDRILELQKLKRDM 1378

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 94/216 (43%), Gaps = 54/216 (25%)

Query: 347 SSEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNW 406
           ++E S+ +G    ++AD+MGLGKT+Q IAL+    R   + K T    +IV P S++  W
Sbjct: 746 NAETSKRKGG---LLADDMGLGKTVQAIALMLAN-RSSNESKKT---NLIVAPVSVLRVW 798

Query: 407 ANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRN 466
             EI   + + +  +  I G       G      R W       V+    ++SY+TL   
Sbjct: 799 KGEIETKIKESSDFNSAIYG-------GVNGIKFRSWDKLSNFDVI----LVSYQTLANE 847

Query: 467 VE------------------------------------HLNNCEIGLLLADEGHRLKNAE 490
           ++                                    + ++     ++ DEG  +KN +
Sbjct: 848 LKKHWPERLKTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEGQNIKNMK 907

Query: 491 SQTFTALDSINCPRRVILSGTPIQNDLSEYFALLNF 526
           +Q   A  ++N   R ILSGTPIQN++ E ++L+ F
Sbjct: 908 TQAAKACCTVNSVYRWILSGTPIQNNMEELYSLIRF 943

>Scas_674.12d
          Length = 1323

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 75/139 (53%), Gaps = 3/139 (2%)

Query: 693  LHKIKTESD-DKIVIISNYTQTLDVIERMC-RTSSYPVVRLDGTMTINKRQKLVDRFNDV 750
            + K+   SD +KI+I S +T   D+ +    +    P ++  G MT  +R  ++ +F   
Sbjct: 1156 IKKVFENSDTEKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITKFYR- 1214

Query: 751  EGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI 810
            +  E I L+S KAG  G+ L  AN +I++DP WNP  ++QA  R +R  Q ++  ++R  
Sbjct: 1215 QANERILLISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLF 1274

Query: 811  CTGTIEEKIYQRQSMKMSL 829
               ++E++I + Q  K  +
Sbjct: 1275 IKDSVEDRIAELQEKKREM 1293

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 111/247 (44%), Gaps = 31/247 (12%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKG 417
           G ++AD+MGLGKT+Q IAL+    R   Q   T    +IV P +++  W  E+   + K 
Sbjct: 671 GGLLADDMGLGKTVQGIALMLAN-RSKDQACKT---NLIVAPVAVLRVWGGELETKIKKE 726

Query: 418 TLASLPIDGKKSSLNNG--------------TVA-QAVRGWALARGRSVVK-PVL--IIS 459
              S  I G    L                 T+A +  + W  + G+   + P +  + +
Sbjct: 727 ANFSAFIYGGGDKLATWKELSEYDAIMVSYPTLAIEFKKHWPASLGKDQKQLPAIPQLAA 786

Query: 460 YETLRRNVEHL-----NNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQ 514
             +L++  E+      N      ++ DEG  +KN +++   A  S++   R + SGTPIQ
Sbjct: 787 MNSLKKKDEYFSPFFCNESTFYRIILDEGQNIKNKKTRAAKACCSLDATYRWVFSGTPIQ 846

Query: 515 NDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKLQALSTIVS 574
           N + E ++L+ F           F  +   P  L ++ +  D +  +  +K+Q L   +S
Sbjct: 847 NSMDELYSLIRFLRIPPYHREERFMADIGRP-FLRKNGNYDDFDRKQAIKKVQVL---LS 902

Query: 575 KFIIRRT 581
             ++RR+
Sbjct: 903 AIMLRRS 909

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 79/134 (58%), Gaps = 7/134 (5%)

Query: 702  DKIVIISNYTQTLDVIER-MCRTSSYPVVRL---DGTMTINKRQKLVDRF--NDVEGQEF 755
            +++VI S ++  LD++E+ +  T S  V ++   DG +++ +R  ++  F   D   Q+ 
Sbjct: 1013 EQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYSRQK- 1071

Query: 756  IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTI 815
            I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R GQ     + RFI   +I
Sbjct: 1072 ILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTNSVKVMRFIIQDSI 1131

Query: 816  EEKIYQRQSMKMSL 829
            EEK+ + Q  K ++
Sbjct: 1132 EEKMLRIQEKKRTI 1145

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 83/365 (22%), Positives = 143/365 (39%), Gaps = 92/365 (25%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDK------------------------ 393
           G I++DEMGLGKT+      ++L+   P     +DK                        
Sbjct: 527 GGILSDEMGLGKTVAA----YSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKP 582

Query: 394 -----CIIVCPSSLVNNWANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARG 448
                 +IV P SL+  W+NE  K       A+   D        G V+         + 
Sbjct: 583 YASKTTLIVVPMSLLTQWSNEFTK-------ANNSPDMYHEVYYGGNVSSLKTLLTKTKT 635

Query: 449 RS--VVKPVLIISYETLRRNVEHLNNCEIGL-----------LLADEGHRLKNAESQTFT 495
               V+    I+  E  + +   + + ++ +           ++ DEGH ++N  + T  
Sbjct: 636 PPTVVLTTYGIVQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSK 695

Query: 496 ALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADAT 555
           A+ ++    + +L+GTPI N L + ++L+ F     L      + N+    +      +T
Sbjct: 696 AVMALQGKCKWVLTGTPIINRLDDLYSLVKF-----LELDPWRQINYWKTFV------ST 744

Query: 556 DSEIAKGNEKLQALSTIVSKFIIRRTNDILSK------YLPCKYEHVLFVNLKPFQRS-- 607
             E     +    ++ I+   ++RRT  +  K       LP K   V+   L PF +S  
Sbjct: 745 PFESKNYKQAFDVVNAILEPVLLRRTKQMKDKDGKPLVELPPK--EVVIKRL-PFSKSQD 801

Query: 608 -VYELMLKCRDVKLAVKDGTTPSQPLK-------HIGALKKLCNHPDLLQLPEDVEGSED 659
            +Y+ +L   +V  +VK G      LK       HI  L+++C HP L+       GS+D
Sbjct: 802 LLYKFLLDKAEV--SVKSGIARGDLLKKYSTILVHILRLRQVCCHPGLI-------GSQD 852

Query: 660 VIPED 664
              ED
Sbjct: 853 ENDED 857

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 92/173 (53%), Gaps = 13/173 (7%)

Query: 669  TLSKRG------HAEVQTWYSGKFSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCR 722
            TL +RG      H +  +  S   S+L       +T   +++V+ S ++  LD++E    
Sbjct: 932  TLKERGGEVSVVHYDTSSKSSKICSLLKHLKQLQETCPGEQVVVFSQFSSYLDILENEL- 990

Query: 723  TSSYP-----VVRLDGTMTINKRQKLVDRF-NDVEGQEFIFLLSSKAGGCGINLIGANRL 776
            TSS+      + + DG + +  R +++D F      +  I LLS KAGG G+NL  A+R 
Sbjct: 991  TSSFSKADAKIYKFDGRLNLKDRSRVLDTFATKDLSKLKILLLSLKAGGVGLNLTCASRA 1050

Query: 777  ILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMSL 829
             +MDP W+P+ + QA+ RV R GQ+ +  I RFI   +IEEK+   Q  K +L
Sbjct: 1051 YMMDPWWSPSLEDQAIDRVHRIGQESNVKIIRFIMENSIEEKMLSIQDRKRTL 1103

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 88/371 (23%), Positives = 139/371 (37%), Gaps = 108/371 (29%)

Query: 358 GCIMADEMGLGKTLQCIALLWTL-----------LRQGPQG---------KPTIDKC-II 396
           G ++ADEMGLGKT+  +A++  +            R+   G         KP   K  +I
Sbjct: 495 GGLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLI 554

Query: 397 VCPSSLVNNWANEIVKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVV---- 452
           V P SL+  W  E  K                   NN   A     +    G  +     
Sbjct: 555 VVPMSLLFQWQKEFEK------------------ANNNPNAHCEIYYGGRAGNLITLLTK 596

Query: 453 ----KPVLIISYETLRRNVEHLNNCE---------IGL-------LLADEGHRLKNAESQ 492
                 +++ SY  ++     L  C          IGL       ++ DEGH ++N  ++
Sbjct: 597 TKNPPTIILTSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTR 656

Query: 493 TFTALDSINCPRRVILSGTPIQNDLSEYFALLNF------SNPGLLGT-------RSEFR 539
           T  A+  ++  R+ +L+GTPI N L + F+L+ F      S  G   +       +  ++
Sbjct: 657 TSKAVMDLSSSRKWVLTGTPIINRLDDLFSLVKFMKLEPWSQIGYWKSFVSGPFEKKNYK 716

Query: 540 RNFE------NPILLSRDADATDSEIAKGNEKLQALSTIVSKFIIRRTNDILSKYLPCKY 593
           + F+       P+LL R     D    K    L     ++ K     + DIL K+   K 
Sbjct: 717 QAFDVVSSVLEPVLLRRTKQMKDIN-GKPLVTLPLKEIVIEKVKFNTSEDILYKFFLNKA 775

Query: 594 EHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGTTPSQPLKHIGALKKLCNHPDLLQLPED 653
           E+           SV E + +   +K         S  L HI  L+++C H +LL     
Sbjct: 776 EN-----------SVKESLARGDLLK-------KYSTILVHILRLRQVCCHIELL----- 812

Query: 654 VEGSEDVIPED 664
             GS D   ED
Sbjct: 813 --GSRDENDED 821

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 78/144 (54%), Gaps = 7/144 (4%)

Query: 688  ILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTS-SYPVVRLDGTMTINKRQKLVDR 746
            ++ R   +  TE   KI+I S +T   +++E   +   ++P ++  G+M   +R  +++ 
Sbjct: 1451 VIQRVFDESATE---KIIIFSQFTTFFEILEHFLKNKLNFPYLKYIGSMNAQRRSDVINE 1507

Query: 747  F-NDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCF 805
            F  D E +  I L+S KAG  G+ L  AN ++++DP WNP  ++QA  R +R  Q K   
Sbjct: 1508 FYRDPEKR--ILLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKVQ 1565

Query: 806  IYRFICTGTIEEKIYQRQSMKMSL 829
            +++     ++E++I + Q  K  +
Sbjct: 1566 VHKLFIKDSVEDRISELQKRKKEM 1589

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 93/212 (43%), Gaps = 53/212 (25%)

Query: 352  QNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIV 411
            +N    G ++AD+MGLGKT+Q IAL+  L  +  + K   +  +IV P S++  W  E+ 
Sbjct: 958  ENSAKKGGLLADDMGLGKTIQAIALM--LANRSEESKCKTN--LIVAPVSVLRVWKGELE 1013

Query: 412  KWLGKGTLASLPIDGKKSSLNNGTVAQAVRGW-ALARGRSVVKPVLIISYETLRRN---- 466
              + K    +  I G       G+    V+ W  LAR  +V     ++SY+TL       
Sbjct: 1014 TKVKKRAKFTTFIFG-------GSGNGKVKHWRDLARYDAV-----LVSYQTLANEFKKH 1061

Query: 467  --------------VEHL------------------NNCEIGLLLADEGHRLKNAESQTF 494
                          V H+                  N+     +L DEG  +KN  ++  
Sbjct: 1062 WPKKLDGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDSTFYRILLDEGQNIKNKNTRAS 1121

Query: 495  TALDSINCPRRVILSGTPIQNDLSEYFALLNF 526
             A  +IN   R +LSGTPIQN + E ++L+ F
Sbjct: 1122 KACCTINGMYRWVLSGTPIQNSMDELYSLIRF 1153

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 65/123 (52%), Gaps = 3/123 (2%)

Query: 703  KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
            +IVI S Y + L+++  + + +S  +  L  T  +    K+V+ F   + +    LL +K
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQNS--IKFLTTTKNVRNFAKVVETFK-ADPEITCLLLDTK 1415

Query: 763  AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
                G+ LI A  + L++P  N + + QA+ R+ R GQ  + +++ F+   T+E  I + 
Sbjct: 1416 RQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSILRY 1475

Query: 823  QSM 825
            +S+
Sbjct: 1476 KSI 1478

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 26/127 (20%)

Query: 360 IMADEMGLGKTLQCIAL--------------LWTLLRQGPQGKPTIDKCIIVCPSSLVNN 405
           ++++EMGLGKT++ +AL              ++ ++  G + +  +   +IVCP  +V  
Sbjct: 381 MLSEEMGLGKTVEVLALLLLRPRAMDPVEEQVYEVVSTGKRMR-RVKTNLIVCPQVIVQQ 439

Query: 406 WANEIVKWLGKGTLASLPIDGK---KSSLNNGTVAQAVRGWALARGRSVVKPVLIISYET 462
           W +EI K +  G+L +    G    K   N   +++ V   +          V+I SY T
Sbjct: 440 WLDEIAKHVD-GSLKAYHYRGFANIKEEFNTENISELVATLS-------EYDVIITSYAT 491

Query: 463 LRRNVEH 469
           +   V +
Sbjct: 492 VSAEVHY 498

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 70/131 (53%), Gaps = 11/131 (8%)

Query: 695  KIKTESDD----KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDV 750
            ++K+E ++    ++++ S  T+ L VI ++ +     +  ++    ++    + +  N+ 
Sbjct: 1369 RLKSEQENADPPQVILYSQKTEYLKVIGKVLK-----LYHIEHLACLSNTANVGETINNF 1423

Query: 751  EGQEFI--FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYR 808
            + Q  +   LL+ K  G G+NLI A  + L+DP  N + + QA+ R  R GQ ++ F++ 
Sbjct: 1424 KRQPSVTCLLLNVKTLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWN 1483

Query: 809  FICTGTIEEKI 819
            F+   T+EE I
Sbjct: 1484 FMIRNTVEENI 1494

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 31/127 (24%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPT-ID----------KCIIVCPSSLVNNWAN 408
           ++A+EMGLGKT++ ++L+    R+    + T ID            +I+CP++++  W  
Sbjct: 388 VLAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWLE 447

Query: 409 EI------VKWLGKGTLASLPIDGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYET 462
           EI      +KW        +  D K       TV +AV+             +++ SY  
Sbjct: 448 EIELHANSLKWYTYRGYNEIMKDCK-------TVDEAVQQLCQY-------DIIVTSYNI 493

Query: 463 LRRNVEH 469
           +   V H
Sbjct: 494 IATEVHH 500

>Kwal_14.1287
          Length = 1518

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 4/117 (3%)

Query: 703  KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
            +I+I S Y++ L ++ ++ +  S       G+    K  K+V++F     +    LL+  
Sbjct: 1332 QIIIYSQYSEFLGLLSKVLKQHSIQHCNTAGS---GKFSKIVEKFKK-NPEVTCLLLNVT 1387

Query: 763  AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKI 819
                G+ L+ A  + +MDP  N + + QA+ R  R GQ ++ +++ F+   T+E+ I
Sbjct: 1388 RQATGLTLVNATHVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNI 1444

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 10/61 (16%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQ---GP----QGKPTIDKC---IIVCPSSLVNNWANE 409
           ++++EMGLGKTL+ +AL+    R     P      K TI K    +IVCP S++  W +E
Sbjct: 356 VLSEEMGLGKTLEILALMLVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSILQQWIDE 415

Query: 410 I 410
           +
Sbjct: 416 V 416

>Scas_573.9
          Length = 1502

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%)

Query: 757  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIE 816
             LL+ K  G G+NL+ A  + L+DP  N + + QA+ R  R GQK + +++  I   ++E
Sbjct: 1384 LLLNVKTLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVE 1443

Query: 817  EKIYQ 821
            E I++
Sbjct: 1444 ENIFK 1448

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 10/60 (16%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDK----------CIIVCPSSLVNNWANE 409
           ++++EMGLGKT++ +AL+    R   +    ID            +IVCP++++  W NE
Sbjct: 372 LLSEEMGLGKTIEVLALIMLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQWINE 431

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 40/63 (63%)

Query: 757  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIE 816
             LL+ ++ G G+NL+ A  + L+DP  N   + QA++R  R GQ+++ +++ F+   T+E
Sbjct: 1350 LLLNIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVE 1409

Query: 817  EKI 819
            E I
Sbjct: 1410 ESI 1412

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 13/68 (19%)

Query: 355 GAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKP---------TIDKC---IIVCPSSL 402
           GA G ++A+EMGLGKTL+ +AL+    R+    +P          I KC   +IVCP S+
Sbjct: 349 GAKG-VLAEEMGLGKTLEILALICINKRKYKADEPLDFVSESGKVISKCSTTLIVCPGSI 407

Query: 403 VNNWANEI 410
           +  W +E+
Sbjct: 408 LKQWIDEM 415

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 703  KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSK 762
            +IVI S+++  L ++  +    +    R    +   K  K VD F   +      LL+  
Sbjct: 1353 QIVIFSSHSAFLSILSTLLTAHNVTHAR---PLRNTKFAKAVDTFRK-DPNCTCLLLNVH 1408

Query: 763  AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQR 822
            +   G+ L+ A  LIL++P  + + + QA++R+ R GQK   +++ F+   T+EE I + 
Sbjct: 1409 SQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYVWNFMVRNTVEESIMKY 1468

Query: 823  QSM 825
            +++
Sbjct: 1469 KAV 1471

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 13/79 (16%)

Query: 344 DESSSEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQ---------GPQGKPTIDKC 394
           +E  S+ S  + A G ++ADEMGLGKT++ + L+ T +R           P  +  + + 
Sbjct: 339 EEWFSDPSSGKKARG-VLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRV 397

Query: 395 ---IIVCPSSLVNNWANEI 410
              +IVCP S++  W +EI
Sbjct: 398 KTNLIVCPESILQQWIDEI 416

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%)

Query: 757  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIE 816
             L++ K    G+ L  A  +ILM+P       +QA+ R+ R GQ KD F++  +   T E
Sbjct: 1352 LLMNPKWCSRGLKLTNATHVILMEPMSEGRIQEQAVERIHRIGQGKDTFVWHLMTRNTAE 1411

Query: 817  E 817
            E
Sbjct: 1412 E 1412

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 12/62 (19%)

Query: 360 IMADEMGLGKTLQCIALLWTLLRQG----------PQGKPTIDK--CIIVCPSSLVNNWA 407
           I++D+ GLGKT++ +AL+    R+           P+G+  +     +I CP  ++  W 
Sbjct: 353 ILSDDTGLGKTVETLALVCLHRRKFRPDEPRSYTLPEGREILKAKTTLICCPGPILQQWL 412

Query: 408 NE 409
           +E
Sbjct: 413 DE 414

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 10/63 (15%)

Query: 358 GCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKC---IIVCPSSLVNNWANEIVKWL 414
           G ++AD+MGLGKT+Q IAL+          +  ++ C   +IV P +++  W  EI   +
Sbjct: 906 GGLLADDMGLGKTVQAIALMIA-------NRSELESCKTNLIVAPVAVLRVWQAEIQTKI 958

Query: 415 GKG 417
            K 
Sbjct: 959 KKN 961

>KLLA0F23716g join(complement(2216857..2218129), some similarities
           with ca|CA1415|CaDBP2.exon2 Candida albicans
           ATP-dependent RNA helicase of DEAD box family, exon 2
           (by homology), hypothetical start
          Length = 554

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 52/112 (46%), Gaps = 6/112 (5%)

Query: 689 LNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFN 748
           L + L     + D KI+I ++  +T D I    RT  +P + + G    N+R  ++  F 
Sbjct: 348 LAKHLETASQDQDSKIIIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFR 407

Query: 749 DVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQ 800
              G+  I ++++     GI++ G N +I  D    P   +  + R+ R G+
Sbjct: 408 --SGRSPI-MVATDVAARGIDVKGINYVINYD---MPGNIEDYVHRIGRTGR 453

>Kwal_26.8470
          Length = 425

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 690 NRFLHKIKTESDDK---IVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDR 746
           +R L  ++T S+DK   I+I ++  +T D + R+ R   +P + + G    N+R  ++  
Sbjct: 345 DRLLKHLETASEDKDSKILIFASTKRTCDEVTRVLRQDGWPALAIHGDKAQNERDWVLQE 404

Query: 747 F 747
           F
Sbjct: 405 F 405

>KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces
           cerevisiae YPL237w SUI3 translation initiation factor
           eIF2 beta subunit singleton, start by similarity
          Length = 278

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 13/100 (13%)

Query: 510 GTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADAT-DSEIAKGNEKLQA 568
           G P Q+ LS +F +LN +NP L G RS  +     PI   RD   T  + I + +EKLQ 
Sbjct: 121 GLPYQDLLSRFFKILNTNNPELAGDRSGPKFKIPPPI-CQRDGKKTIFANIQEISEKLQR 179

Query: 569 LSTIVSKFIIRRTND-----------ILSKYLPCKYEHVL 597
               V +++                 I  K+LP + E++L
Sbjct: 180 SPEHVIQYLFAELGTSGSVDGQKRLVIKGKFLPKQMENLL 219

>KLLA0C01210g complement(93918..95408) some similarities with
           sp|P25567 Saccharomyces cerevisiae YCL037c SRO9 La
           motif-containing proteins that modulate mRNA
           translation, hypothetical start
          Length = 496

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%)

Query: 138 SLGTKPKIVLGPRPLHDPTEEFAIVLYDP 166
           S G KPK+VL P P   P EE  +  Y P
Sbjct: 50  SEGEKPKLVLAPLPKKSPWEETGVTEYKP 78

>CAGL0C03399g 341755..343191 similar to sp|P39008 Saccharomyces
           cerevisiae YNR052c POP2, start by similarity
          Length = 478

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 460 YETLRRNVEHLNNCEIGLLLADE-GHRLKNAES 491
           Y+T+R NV+ LN  ++GL L+DE G++  N  S
Sbjct: 264 YQTMRANVDFLNPIQLGLSLSDENGNKPDNGPS 296

>YNR038W (DBP6) [4622] chr14 (695594..697483) Putative RNA helicase
           required for ribosomal RNA processing and biogenesis of
           the 60S ribosomal subunit, interacts with Dbp9p [1890
           bp, 629 aa]
          Length = 629

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 64/145 (44%), Gaps = 30/145 (20%)

Query: 366 GLGKTLQ-CIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKWLGKGTLASLPI 424
           G GKTL   I ++ TL ++         +CII+ P+ L+ N     +  L +GT   + I
Sbjct: 237 GSGKTLAYSIPIVQTLFKRQINRL----RCIIIVPTKLLINQVYTTLTKLTQGTSLIVSI 292

Query: 425 DGKKSSLNNGTVAQAVRGWALARGRSVVKPVLIISYETLRRNVEHLNNCEIGL-----LL 479
              ++SL +             +  S ++P ++I+  T  R V+HLN   I L     L+
Sbjct: 293 AKLENSLKDE-----------HKKLSNLEPDILIT--TPGRLVDHLNMKSINLKNLKFLI 339

Query: 480 ADEGHRLKNAESQTFTALDSINCPR 504
            DE  RL N   Q +       CP+
Sbjct: 340 IDEADRLLNQSFQGW-------CPK 357

>Scas_588.16
          Length = 693

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 683 SGKFSILNRFLHKI----KTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGT 734
           SGKF +  + L K+    K E   K+++IS+  + LD++E         + R+ GT
Sbjct: 126 SGKFKVFQQLLFKLLDKEKDEVSKKVLLISHSIKELDILEGFLLGQKVRIKRISGT 181

>AAL069C [118] [Homologous to ScYDR295C (PLO2) - SH]
           (226816..228813) [1998 bp, 665 aa]
          Length = 665

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 683 SGKFSILNRFLHKIKTESDD----KIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTIN 738
           S KF +LN+ +  I +        ++V++S+  + LD+IE         + RL GT   +
Sbjct: 115 SEKFRVLNQMMEAILSRRRRQRPLQLVLVSHSVKELDLIEGFMLGKMVKIKRLSGTSLFD 174

Query: 739 KRQKLVDR 746
           ++ +  +R
Sbjct: 175 EKHQYTER 182

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,902,283
Number of extensions: 1034637
Number of successful extensions: 3233
Number of sequences better than 10.0: 124
Number of HSP's gapped: 2920
Number of HSP's successfully gapped: 209
Length of query: 830
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 720
Effective length of database: 12,788,129
Effective search space: 9207452880
Effective search space used: 9207452880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)