Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.152439438912031e-165
CAGL0L09383g366941741e-13
Sklu_1042.2298891712e-13
KLLA0A03091g383911511e-10
AEL298C337881448e-10
YPR009W (SUT2)268881348e-09
YGL162W (SUT1)299891332e-08
CAGL0I04246g357991215e-07
Scas_710.10437961217e-07
CAGL0M03025g125474780.16
AFR096W85214720.78
KLLA0F14322g71714711.0
Scas_711.3193213701.3
YKR095W (MLP1)187578701.3
YJL089W (SIP4)82914701.3
Sklu_2296.691914691.5
CAGL0A00451g110717691.9
Scas_662.890620682.6
Sklu_1993.282320673.0
Kwal_23.475481220673.1
CAGL0G08844g84720673.2
Scas_625.5114115673.3
KLLA0F04609g91620673.4
YIL130W96420663.7
Kwal_14.2619116718664.2
YMR280C (CAT8)143374655.0
KLLA0F25630g100713646.7
AER370W80120647.0
KLLA0A09119g108219638.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1524
         (389 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1524                                                          468   e-165
CAGL0L09383g 1018859..1019959 some similarities with sp|P53032 S...    72   1e-13
Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement         70   2e-13
KLLA0A03091g 276333..277484 some similarities with sgd|S0006213 ...    63   1e-10
AEL298C [2207] [Homologous to ScYPR009W (SUT2) - SH; ScYGL162W (...    60   8e-10
YPR009W (SUT2) [5445] chr16 (576547..577353) Protein with simila...    56   8e-09
YGL162W (SUT1) [1827] chr7 (198142..199041) Protein that binds S...    56   2e-08
CAGL0I04246g 377568..378641 weakly similar to sp|P53032 Saccharo...    51   5e-07
Scas_710.10                                                            51   7e-07
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    35   0.16 
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    32   0.78 
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    32   1.0  
Scas_711.31                                                            32   1.3  
YKR095W (MLP1) [3345] chr11 (619445..625072) Myosin-like protein...    32   1.3  
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    32   1.3  
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       31   1.5  
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    31   1.9  
Scas_662.8                                                             31   2.6  
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         30   3.0  
Kwal_23.4754                                                           30   3.1  
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    30   3.2  
Scas_625.5                                                             30   3.3  
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    30   3.4  
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    30   3.7  
Kwal_14.2619                                                           30   4.2  
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    30   5.0  
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    29   6.7  
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    29   7.0  
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    29   8.3  

>Kwal_14.1524
          Length = 394

 Score =  468 bits (1203), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 255/389 (65%), Positives = 255/389 (65%)

Query: 1   MIPIAIQNSRHQSLPPLLLPDVSRTGPESMRSLYEGFGDPFRVNSSXXXXXXXXXXXXXX 60
           MIPIAIQNSRHQSLPPLLLPDVSRTGPESMRSLYEGFGDPFRVNSS              
Sbjct: 1   MIPIAIQNSRHQSLPPLLLPDVSRTGPESMRSLYEGFGDPFRVNSSGGGNNGAGITAAAA 60

Query: 61  XXXXXXXXXXRPLAPPSLSQHHPRTYLADPFLSDKRHLSSSCPSDRXXXXXXXXXXXXXL 120
                     RPLAPPSLSQHHPRTYLADPFLSDKRHLSSSCPSDR             L
Sbjct: 61  IAAAAAAAAARPLAPPSLSQHHPRTYLADPFLSDKRHLSSSCPSDRAADAGGAATAASGL 120

Query: 121 ESLAHLAAATDDARGPVNVHGTXXXXXXXXXXXXXXXXXERGRSHAHPVXXXXXXXXXXX 180
           ESLAHLAAATDDARGPVNVHGT                 ERGRSHAHPV           
Sbjct: 121 ESLAHLAAATDDARGPVNVHGTRAPLQPQLRQLPLAVPAERGRSHAHPVSAPVEPSPPAR 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXIGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESL 240
                                IGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESL
Sbjct: 181 RARSPCSPRSARAAPSAKRQRIGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESL 240

Query: 241 HATMTYSELKAALPSHVWKNLPARVLEALESQDSRAGEVVRHVDKVVFFXXXXXXXXXXX 300
           HATMTYSELKAALPSHVWKNLPARVLEALESQDSRAGEVVRHVDKVVFF           
Sbjct: 241 HATMTYSELKAALPSHVWKNLPARVLEALESQDSRAGEVVRHVDKVVFFRACASCARRNA 300

Query: 301 XXXXXXXXXXXXXXTSAPATPAGPTGSVRXXXXXXXXXXXXXXXXXXXXXXXCCTFSKGF 360
                         TSAPATPAGPTGSVR                       CCTFSKGF
Sbjct: 301 SGSGSGKESDGESGTSAPATPAGPTGSVRAAAGVAAAAAGTTATPAAALGPACCTFSKGF 360

Query: 361 TRSDINVFTRLQKQLGPRGQLADFTVAEY 389
           TRSDINVFTRLQKQLGPRGQLADFTVAEY
Sbjct: 361 TRSDINVFTRLQKQLGPRGQLADFTVAEY 389

>CAGL0L09383g 1018859..1019959 some similarities with sp|P53032
           Saccharomyces cerevisiae YGL162w SUT1 or tr|Q12286
           Saccharomyces cerevisiae YPR009w, hypothetical start
          Length = 366

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 58/94 (61%), Gaps = 10/94 (10%)

Query: 202 IGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAALPSHVWKN- 260
           IGPSCD CR KKIKCDA + +L QDEA++   G   +SLH  +T  E++  L   V+   
Sbjct: 223 IGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFG---QSLHHELTKHEIETQLGQEVYSQS 279

Query: 261 -----LPARVLEALESQDSRAGEVVRHVDKVVFF 289
                +   ++  +ES++  A ++++H+DK+++F
Sbjct: 280 STFAYISKDLMSKIESREPDA-KIIKHLDKIIYF 312

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 354 CTFSKGFTRSDINVFTRLQKQLGPRGQLADFTVAEY 389
           C FSKGFTR+DIN+F+++  ++  +  + + T  EY
Sbjct: 327 CAFSKGFTRADINIFSKIGSRVAQK-PIYEMTYKEY 361

>Sklu_1042.2 YGL162W, Contig c1042 1296-2192 reverse complement
          Length = 298

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 63/89 (70%), Gaps = 7/89 (7%)

Query: 202 IGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAALPSHVWKNL 261
           +GPSCD CR++KIKCDA++ ++HQ E+LV+   + ++SLHA ++  +L+  LP ++   +
Sbjct: 162 VGPSCDVCRVRKIKCDATIRIVHQAESLVS---SISDSLHAVLSAQDLE-LLPKYLADRV 217

Query: 262 PARVLEALESQD-SRAGEVVRHVDKVVFF 289
           P  +L  L+ +D +   ++V+HVDK+V F
Sbjct: 218 PLDLL--LQVKDPADKTQLVKHVDKLVVF 244

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 26/36 (72%)

Query: 354 CTFSKGFTRSDINVFTRLQKQLGPRGQLADFTVAEY 389
           C FSKG TR+DIN+F RL+K+ G R  L D+T  +Y
Sbjct: 258 CQFSKGLTRADINIFNRLEKKTGKRAALKDYTYHDY 293

>KLLA0A03091g 276333..277484 some similarities with sgd|S0006213
           Saccharomyces cerevisiae YPR009w, hypothetical start
          Length = 383

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 15/91 (16%)

Query: 203 GPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYS----ELKAALPSHVW 258
           GPSCD CR KKIKCDA+V V+ QD +L+ F+  ++ESLH  ++      ++   +P+ V 
Sbjct: 247 GPSCDVCRSKKIKCDATVLVISQDPSLL-FNCKEDESLHCPLSIDTCRPDILMKIPTEVR 305

Query: 259 KNLPARVLEALESQDSRAGEVVRHVDKVVFF 289
           K L  R          +   +VRHVDK++ F
Sbjct: 306 KQLAER----------KDMSLVRHVDKLIAF 326

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/36 (63%), Positives = 28/36 (77%)

Query: 354 CTFSKGFTRSDINVFTRLQKQLGPRGQLADFTVAEY 389
           C+FSKGFTR+DI VF+ L K+LG R  L DFTV +Y
Sbjct: 340 CSFSKGFTRNDIAVFSTLNKKLGKRNSLGDFTVKDY 375

>AEL298C [2207] [Homologous to ScYPR009W (SUT2) - SH; ScYGL162W
           (SUT1) - SH] (81182..82195) [1014 bp, 337 aa]
          Length = 337

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 57/88 (64%), Gaps = 12/88 (13%)

Query: 203 GPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAALPSHVW-KNL 261
           GPSCD CR KKIKCDA++++L QD ++   +G+ NE LHA +  SEL     ++ W   +
Sbjct: 205 GPSCDICRSKKIKCDATITILFQDASV---TGSFNEMLHAPVNVSEL-----ANEWLSQI 256

Query: 262 PARVLEALESQDSRAGEVVRHVDKVVFF 289
           P  V +AL +++     +++HVDK++ F
Sbjct: 257 PDEVRQALLTKEL---TLLKHVDKLIAF 281

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 26/36 (72%)

Query: 354 CTFSKGFTRSDINVFTRLQKQLGPRGQLADFTVAEY 389
           CTFSKGFTR+DINV+T L  + G R  +  F++ +Y
Sbjct: 295 CTFSKGFTRADINVYTNLCVKFGKRSSIDQFSLNDY 330

>YPR009W (SUT2) [5445] chr16 (576547..577353) Protein with
           similarity to Sut1p, involved in sterol uptake [807 bp,
           268 aa]
          Length = 268

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 15/88 (17%)

Query: 203 GPSCDSCRLKKIKCDASVSVLHQDEALV-AFSGNKNESLHATMTYSELKAALPSHVWKNL 261
           GPSCDSCR+KKIKC+A++ +  QD  L+ + S N    LH T++  ++        ++ L
Sbjct: 137 GPSCDSCRIKKIKCNATIIIFLQDRNLISSISSN----LHYTLSQDDIN-QFRMKFFRKL 191

Query: 262 PARVLEALESQDSRAGEVVRHVDKVVFF 289
           P  V+           EV++H+DK+V F
Sbjct: 192 PD-VMGTY--------EVIKHLDKIVLF 210

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 354 CTFSKGFTRSDINVFTRLQKQLGPRGQLADFTVAEY 389
           C FS+GFT+SD+NVF ++  +L  +  + + TV +Y
Sbjct: 226 CLFSRGFTKSDMNVFPKINSKLKDKS-IFEMTVDDY 260

>YGL162W (SUT1) [1827] chr7 (198142..199041) Protein that binds
           Ssn6p and counteracts Ssn6p-Tup1p-mediated
           transcriptional repression, involved in sterol uptake
           [900 bp, 299 aa]
          Length = 299

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 11/89 (12%)

Query: 203 GPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAALPSHVWKN-- 260
           GPSCD CRLKKIKC+A + +L QD+ ++    NK   L   +T  +++      + +N  
Sbjct: 157 GPSCDKCRLKKIKCNAKIEILLQDDTIMPMISNK---LRYVLTPDDIRLYR-GTLLRNIA 212

Query: 261 LPARVLEALESQDSRAGEVVRHVDKVVFF 289
           +P  V+E   S+     ++++H+DK+V  
Sbjct: 213 IPDDVIEGTGSR-----KLIKHIDKLVLL 236

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 354 CTFSKGFTRSDINVFTRLQKQLGPRGQLADFTVAEY 389
           CTFSKGFTR+DIN+ +++  +   +  + D T  +Y
Sbjct: 260 CTFSKGFTRADINISSKISLKFKDK-TIYDITYDDY 294

>CAGL0I04246g 377568..378641 weakly similar to sp|P53032
           Saccharomyces cerevisiae YGL162w SUT1 hypoxic protein
           involved in sterol uptake, start by similarity
          Length = 357

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 15/99 (15%)

Query: 202 IGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNK-----------NESLHATMTYSELK 250
           +GPSCD CR+KKIKC+A+ ++L QD  +V+    K           NE+      Y   K
Sbjct: 169 VGPSCDKCRVKKIKCNATSNILVQDLDIVSLFSTKLHYEFSPEEILNENSEVNQ-YMRRK 227

Query: 251 AALPSHVWKNLPARVLEALESQDSRAGEVVRHVDKVVFF 289
             + +   +NL   +    ++Q+ +   +V+H+DK++ F
Sbjct: 228 HIIDAPSIQNLKECI---RKNQNPQNKTLVKHIDKLIIF 263

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 18/18 (100%)

Query: 354 CTFSKGFTRSDINVFTRL 371
           CTFSKGFTRSDI+++T++
Sbjct: 306 CTFSKGFTRSDISIYTKI 323

>Scas_710.10
          Length = 437

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 12/96 (12%)

Query: 202 IGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAALPSHVWKN- 260
           +GPSCD CR KKIKCD+ + V+ +   ++    NK   +H      E++  L + + KN 
Sbjct: 287 VGPSCDHCRFKKIKCDSQIKVVLESNHILNLISNK---IHYVFNADEIE-LLKTTLLKNT 342

Query: 261 -LPARVLEALESQDSRAGE------VVRHVDKVVFF 289
            LP ++            E      +++H DK++ F
Sbjct: 343 TLPEKLANTTTINKRNIAEGSVYPILLKHFDKIILF 378

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 205 SCDSCRLKKIKCDASVSVLHQDEALVA 231
           SCD CR +KIKCD++ +++     L+ 
Sbjct: 139 SCDYCRQRKIKCDSNFNIIRTSNQLIG 165

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
           Saccharomyces cerevisiae YMR280c CAT8 transcription
           factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 34.7 bits (78), Expect = 0.16,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 36/74 (48%), Gaps = 10/74 (13%)

Query: 202 IGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAALPSHVWKNL 261
           +  +CD CRLKK KCD  +    Q  ALV F    ++ L+        + + P    + L
Sbjct: 56  VAQACDRCRLKKTKCDGKIPQCSQC-ALVGFECKISDRLN--------RKSFPRGYTETL 106

Query: 262 PARVLEALESQDSR 275
             RV E LE+++ R
Sbjct: 107 EERVRE-LETENKR 119

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
           complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 12/14 (85%)

Query: 205 SCDSCRLKKIKCDA 218
           +CD CRLKKIKCD 
Sbjct: 28  ACDRCRLKKIKCDG 41

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 12/14 (85%)

Query: 205 SCDSCRLKKIKCDA 218
           +CD CRLKKIKCD 
Sbjct: 62  ACDRCRLKKIKCDG 75

>Scas_711.31
          Length = 932

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/13 (84%), Positives = 12/13 (92%)

Query: 205 SCDSCRLKKIKCD 217
           +CD CRLKKIKCD
Sbjct: 44  ACDRCRLKKIKCD 56

>YKR095W (MLP1) [3345] chr11 (619445..625072) Myosin-like protein
           that associates with Nab2p and may function as a
           checkpoint at the nuclear pore by interacting with
           ribonucleoprotein complexes, has a probable coiled-coil
           structure [5628 bp, 1875 aa]
          Length = 1875

 Score = 31.6 bits (70), Expect = 1.3,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 12/78 (15%)

Query: 209 CRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAALPSHVWKNLPARVLEA 268
           C L+++K      V H ++ L+ F+  K+E+L  T+++ ELKA+             L+ 
Sbjct: 30  CSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKAS------------SLKK 77

Query: 269 LESQDSRAGEVVRHVDKV 286
           ++   +    V+R  DK+
Sbjct: 78  IDGLKTEMENVIRENDKI 95

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
           activator of gluconeogenic genes through CSRE elements,
           activated by Snf1p kinase, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 12/14 (85%)

Query: 205 SCDSCRLKKIKCDA 218
           +CD CRLKKIKCD 
Sbjct: 45  ACDRCRLKKIKCDG 58

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 12/14 (85%)

Query: 205 SCDSCRLKKIKCDA 218
           +CD CRLKKIKCD 
Sbjct: 28  ACDRCRLKKIKCDG 41

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
           cerevisiae YGL013c PDR1 transcription factor,
           hypothetical start
          Length = 1107

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 10/17 (58%), Positives = 14/17 (82%)

Query: 202 IGPSCDSCRLKKIKCDA 218
           +G +CDSCR +KIKC+ 
Sbjct: 27  VGKACDSCRRRKIKCNG 43

>Scas_662.8
          Length = 906

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 13/20 (65%)

Query: 205 SCDSCRLKKIKCDASVSVLH 224
           +CD CR KK+KCD     +H
Sbjct: 36  ACDECRKKKVKCDGQQPCIH 55

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 13/20 (65%)

Query: 205 SCDSCRLKKIKCDASVSVLH 224
           +CD CR KK+KCD     +H
Sbjct: 14  ACDECRKKKVKCDGQQPCIH 33

>Kwal_23.4754
          Length = 812

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 13/20 (65%)

Query: 205 SCDSCRLKKIKCDASVSVLH 224
           +CD CR KK+KCD     +H
Sbjct: 14  ACDECRKKKVKCDGQQPCIH 33

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 205 SCDSCRLKKIKCDASVSVLH 224
           +CD CR KK+KCD +   +H
Sbjct: 19  ACDDCRKKKVKCDGNQPCIH 38

>Scas_625.5
          Length = 1141

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 12/15 (80%)

Query: 205 SCDSCRLKKIKCDAS 219
           +CD CR KKIKCD S
Sbjct: 74  ACDQCRKKKIKCDFS 88

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
           Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 13/20 (65%)

Query: 205 SCDSCRLKKIKCDASVSVLH 224
           +CD CR KK+KCD     +H
Sbjct: 13  ACDECRKKKVKCDGKQPCIH 32

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region, putative transcription
           factor [2895 bp, 964 aa]
          Length = 964

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 13/20 (65%)

Query: 205 SCDSCRLKKIKCDASVSVLH 224
           +CD CR KK+KCD     +H
Sbjct: 20  ACDECRKKKVKCDGQQPCIH 39

>Kwal_14.2619
          Length = 1167

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 202 IGPSCDSCRLKKIKCDAS 219
           IG SC +CR +K+KCD S
Sbjct: 8   IGTSCLTCRRRKVKCDRS 25

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
           Transcription factor required for derepression of
           gluconeogenic enzymes, contains an N-terminal
           Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
           bp, 1433 aa]
          Length = 1433

 Score = 29.6 bits (65), Expect = 5.0,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 10/74 (13%)

Query: 202 IGPSCDSCRLKKIKCDASVSVLHQDEALVAFSGNKNESLHATMTYSELKAALPSHVWKNL 261
           I  +CD CR KK +CD       Q  A V F    ++ L        L+ A P    ++L
Sbjct: 66  IAQACDRCRSKKTRCDGKRPQCSQCAA-VGFECRISDKL--------LRKAYPKGYTESL 116

Query: 262 PARVLEALESQDSR 275
             RV E LE+++ R
Sbjct: 117 EERVRE-LEAENKR 129

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 10/13 (76%), Positives = 11/13 (84%)

Query: 205 SCDSCRLKKIKCD 217
           +CD CR KKIKCD
Sbjct: 116 ACDQCRKKKIKCD 128

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
           complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 29.3 bits (64), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 14/20 (70%)

Query: 205 SCDSCRLKKIKCDASVSVLH 224
           +CD CR KK+KCD+    +H
Sbjct: 17  ACDECRKKKVKCDSRHPCIH 36

>KLLA0A09119g complement(797533..800781) weakly similar to sp|P12383
           Saccharomyces cerevisiae YGL013c PDR1 transcription
           factor, start by similarity
          Length = 1082

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 10/19 (52%), Positives = 14/19 (73%)

Query: 202 IGPSCDSCRLKKIKCDASV 220
           +  +CDSCR KKIKC  ++
Sbjct: 51  VSRACDSCRKKKIKCSGTL 69

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,764,011
Number of extensions: 202152
Number of successful extensions: 686
Number of sequences better than 10.0: 31
Number of HSP's gapped: 677
Number of HSP's successfully gapped: 39
Length of query: 389
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 285
Effective length of database: 12,995,837
Effective search space: 3703813545
Effective search space used: 3703813545
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)