Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.151325024710521e-146
AEL299W2491871061e-05
YGL161C (YIP5)3101861009e-05
KLLA0A03113g265184860.005
CAGL0I04268g334232830.013
CAGL0A01155g60924681.0
ABL095W102145618.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1513
         (247 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1513                                                          409   e-146
AEL299W [2206] [Homologous to ScYGL161C - SH] complement(80282.....    45   1e-05
YGL161C (YIP5) [1828] chr7 complement(199214..200146) Protein th...    43   9e-05
KLLA0A03113g complement(277880..278677) some similarities with c...    38   0.005
CAGL0I04268g complement(379149..380153) weakly similar to sp|P53...    37   0.013
CAGL0A01155g 114809..116638 similar to sp|P32526 Saccharomyces c...    31   1.0  
ABL095W [497] [Homologous to ScYDR028C (REG1) - SH] complement(2...    28   8.4  

>Kwal_14.1513
          Length = 250

 Score =  409 bits (1052), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 207/247 (83%), Positives = 207/247 (83%)

Query: 1   MEEPNPFADESTRHYGTTIADSIPDDVALDITPVKTSADIPSASTYADYYQVDYEKLRAR 60
           MEEPNPFADESTRHYGTTIADSIPDDVALDITPVKTSADIPSASTYADYYQVDYEKLRAR
Sbjct: 1   MEEPNPFADESTRHYGTTIADSIPDDVALDITPVKTSADIPSASTYADYYQVDYEKLRAR 60

Query: 61  IKCAIAAKSLKXXXXXXXXXXXXYAPVWVTVCAGLAGYVARGVVEFLWSLATGQAPLQEV 120
           IKCAIAAKSLK            YAPVWVTVCAGLAGYVARGVVEFLWSLATGQAPLQEV
Sbjct: 61  IKCAIAAKSLKENEGGEELEPELYAPVWVTVCAGLAGYVARGVVEFLWSLATGQAPLQEV 120

Query: 121 GQHRLAPGLLVAFFYTWGCPLVVRTVARXXXXXXXXXXXXXXXXIYGYSLVVWVPIVVLR 180
           GQHRLAPGLLVAFFYTWGCPLVVRTVAR                IYGYSLVVWVPIVVLR
Sbjct: 121 GQHRLAPGLLVAFFYTWGCPLVVRTVARVVLKLDLEGTLLTLVTIYGYSLVVWVPIVVLR 180

Query: 181 ATFSVLRAKTGSVLFMGAMLAVQAAGIAHSVVFFHRQLKAEERGKXXXXXXXXXXXXMIV 240
           ATFSVLRAKTGSVLFMGAMLAVQAAGIAHSVVFFHRQLKAEERGK            MIV
Sbjct: 181 ATFSVLRAKTGSVLFMGAMLAVQAAGIAHSVVFFHRQLKAEERGKLLACCLVLNVVLMIV 240

Query: 241 VTWAVPR 247
           VTWAVPR
Sbjct: 241 VTWAVPR 247

>AEL299W [2206] [Homologous to ScYGL161C - SH]
           complement(80282..81031) [750 bp, 249 aa]
          Length = 249

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 80/187 (42%), Gaps = 12/187 (6%)

Query: 44  STYADYYQVDYEKLRARIKCAIAAKSLKXXXXXXXXXXXXYAPVWVTVCAGLAGYVARGV 103
           +T A YY V  E+L  + + ++  + ++            Y+ VW+ + A +A YV+RG+
Sbjct: 48  NTLAPYYAVTSEQLFHKTRSSLMLQKVQTLEMGNAATEI-YSTVWIILSASIALYVSRGL 106

Query: 104 VEFLWSLATGQAPLQEVGQHRLAPGLLVAF-FYTWGCPLVVRTVARXXXXXXXXXXXXXX 162
              L  +  GQ      GQ+++   +L  F  Y    PLV + V +              
Sbjct: 107 RTVLSEILRGQEDGGSHGQYQILVHVLWLFATYVVAVPLVFKLVVQYAFSEALHGLELVQ 166

Query: 163 XXIYGYSLVVWVPIVVLRATFSVLRAKTGSVLFMGAMLAVQAAGIAHSVVFFHRQLKAE- 221
              YG+  +VW+P+  +     +L      +    A L +  AG A+S +  + QLK + 
Sbjct: 167 W--YGFGCLVWIPLTPISLVLGLLPEGWAGL----AHLILAIAGGAYSFMVIYIQLKDDL 220

Query: 222 ---ERGK 225
               RG+
Sbjct: 221 SELSRGR 227

>YGL161C (YIP5) [1828] chr7 complement(199214..200146) Protein that
           oligomerizes and associates with Ygl161p and Rab
           proteins, may be involved in vesicular transport, member
           of the YIP1 family [933 bp, 310 aa]
          Length = 310

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/186 (17%), Positives = 72/186 (38%), Gaps = 12/186 (6%)

Query: 46  YADYYQVDYEKLRARIKCAIAAKSLKXXXXXXXXXXXXYAPVWVTVCAGLAGY-VARG-- 102
           Y+ Y+Q+D  + + R+   +  ++              Y  VW+T    +  + ++RG  
Sbjct: 97  YSKYFQIDLTQFKKRLSAVLTFRN-DHNSESNEDNTDLYGAVWITATVVMINFTMSRGLN 155

Query: 103 --VVEFLWSLATGQAPLQEVGQHRLAPGLLVAFFYTWGCPLVVRTVARXXXXXXXXXXXX 160
             + + +  + TG+   +     +L   + + + YT+G P +   V              
Sbjct: 156 FIISDVIEGVKTGEDIDRASQFKKLLHSIWLFYGYTFGVPFITMQVLNRDEHSERNRSFK 215

Query: 161 X---XXXIYGYSLVVWVPIVVLRATFSVLRAKTGSVLFMGAMLAVQAAGIAHSVVFFHRQ 217
                  +YGY+ ++W+P+ V+    ++L              A+ A G A S  F + Q
Sbjct: 216 SVPELISVYGYANLIWIPVCVI---LNILDMSKRLRTVQAIQWAIVALGWAQSSYFLNSQ 272

Query: 218 LKAEER 223
           + +   
Sbjct: 273 ISSNNN 278

>KLLA0A03113g complement(277880..278677) some similarities with
           ca|CA3594|IPF6076.3 Candida albicans unknown function,
           3-prime end, hypothetical start
          Length = 265

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 70/184 (38%), Gaps = 16/184 (8%)

Query: 5   NPFADESTRHY---GTTIADSIPDDVALDIT-----PVKTSADIPSASTYADYYQVDYEK 56
           NPF D+S       G    +    D+ L+ T     P  T+      S  + Y+QVD   
Sbjct: 16  NPFEDDSFVPQVTPGLKPFEPELQDITLETTREAPQPAITTGKASIFSKLSPYFQVDETT 75

Query: 57  LRARIKCAIAA---KSLKXXXXXXXXXXXXYAPVWVTVCAGLAGYVARGVVEFLWSLATG 113
           L+ ++  A+     KSL+            Y+ VW+T    +  +++      + SL T 
Sbjct: 76  LKQKLITALKLGELKSLRDPESQADAQLDLYSTVWITATVIMVLFLSYSGKSVIGSLITN 135

Query: 114 QAPLQEVGQHRLAPGLLVAFF-YTWGCPLVVRTVARXXXXXXXXXXXXXXXXIYGYSLVV 172
                +V   ++    L  F+ Y  G P++   + +                 YG S VV
Sbjct: 136 S--FSDVIDFQIMINCLFLFYIYVLGVPILAFLICKFVFKEPFDVITAIDT--YGVSNVV 191

Query: 173 WVPI 176
           WVPI
Sbjct: 192 WVPI 195

>CAGL0I04268g complement(379149..380153) weakly similar to sp|P53108
           Saccharomyces cerevisiae YGL161c, hypothetical start
          Length = 334

 Score = 36.6 bits (83), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 82/232 (35%), Gaps = 53/232 (22%)

Query: 1   MEEPNPF---ADESTRHYGTTIADSIPDD----------------VALDITPVKTSAD-- 39
           + EPNPF   A+ S   YG+   D+I  D                +AL+   V    D  
Sbjct: 22  ISEPNPFEEHANTSHNKYGSGTGDNIMGDESGKTVNDLPPAYDNTIALEPQRVAPDRDGS 81

Query: 40  IPSA-------STYADYYQVDYEKLRARIKCAIAA------------KSLKXXXXXXXXX 80
           IP         + Y+ Y+Q+  E L+ RI    +             +            
Sbjct: 82  IPQGKLPPGLLNYYSRYFQLSNEGLKKRIMYPRSFYQDSRDPEEQNFEIDDEDEDEASVL 141

Query: 81  XXXYAPVWVTVCAGLAGYVARGVVEFLWSLATGQAPLQ--EVGQH-----------RLAP 127
              Y PVW+T  A +A +V   +VE +        P Q  E G +            L  
Sbjct: 142 SDLYGPVWITATAVMAKFVVVTLVEIVKDGLVLGVPRQAAEDGSYLPSTFWEKQFVNLIH 201

Query: 128 GLLVAFFYTWGCPLVVRTVARXXXXXXXXXXXXXXXXIYGYSLVVWVPIVVL 179
            + + + +T+  PL++    +                IYGYS ++WV I V+
Sbjct: 202 SIWLYYAHTFISPLLIYRGFQNHYDGMKMKSRYELISIYGYSNLIWVSISVI 253

>CAGL0A01155g 114809..116638 similar to sp|P32526 Saccharomyces
           cerevisiae YPL269w KAR9, hypothetical start
          Length = 609

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 18/24 (75%)

Query: 1   MEEPNPFADESTRHYGTTIADSIP 24
           +++PNPF D+ +R+ G  + +SIP
Sbjct: 470 LDDPNPFFDKKSRNSGKLVLNSIP 493

>ABL095W [497] [Homologous to ScYDR028C (REG1) - SH]
           complement(218906..221971) [3066 bp, 1021 aa]
          Length = 1021

 Score = 28.1 bits (61), Expect = 8.4,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 7   FADESTRHYGTT-IADSIPDDVALDITPVKTSADIPSASTYADYY 50
           + DEST HYG++   +   D + +  T  KT+ ++P   T A  Y
Sbjct: 547 YDDESTDHYGSSGEEEEEEDGLFISATGRKTTENVPPIQTDASSY 591

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,874,886
Number of extensions: 177613
Number of successful extensions: 517
Number of sequences better than 10.0: 8
Number of HSP's gapped: 514
Number of HSP's successfully gapped: 8
Length of query: 247
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 148
Effective length of database: 13,168,927
Effective search space: 1949001196
Effective search space used: 1949001196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)