Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_14.150440139620850.0
YGL169W (SUA5)42641214050.0
KLLA0A03135g40439913480.0
AEL300C41839913400.0
CAGL0I04290g42240713001e-179
Scas_707.4944139912481e-171
KLLA0B04334g13342661.6
AFR420W246224682.5
Kwal_56.2390977672663.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_14.1504
         (396 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_14.1504                                                          807   0.0  
YGL169W (SUA5) [1821] chr7 (186063..187343) Protein involved in ...   545   0.0  
KLLA0A03135g 279951..281165 similar to sp|P32579 Saccharomyces c...   523   0.0  
AEL300C [2205] [Homologous to ScYGL169W (SUA5) - SH] (78172..794...   520   0.0  
CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces c...   505   e-179
Scas_707.49                                                           485   e-171
KLLA0B04334g 388079..388480 similar to sp|P38877 Saccharomyces c...    30   1.6  
AFR420W [3612] [Homologous to ScYKL203C (TOR2) - SH; ScYJR066W (...    31   2.5  
Kwal_56.23909                                                          30   3.7  

>Kwal_14.1504
          Length = 401

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MLKTLISKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNT 60
           MLKTLISKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNT
Sbjct: 1   MLKTLISKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNT 60

Query: 61  VGFPTETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSHATSIL 120
           VGFPTETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSHATSIL
Sbjct: 61  VGFPTETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSHATSIL 120

Query: 121 HNIPEIYRPLIEKLWPGPLTILLSVPPKSTLSKLTTADQPTFAVRIPSNPVARALIALSD 180
           HNIPEIYRPLIEKLWPGPLTILLSVPPKSTLSKLTTADQPTFAVRIPSNPVARALIALSD
Sbjct: 121 HNIPEIYRPLIEKLWPGPLTILLSVPPKSTLSKLTTADQPTFAVRIPSNPVARALIALSD 180

Query: 181 TPIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRP 240
           TPIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRP
Sbjct: 181 TPIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRP 240

Query: 241 GGFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQENELA 300
           GGFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQENELA
Sbjct: 241 GGFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQENELA 300

Query: 301 IEQRLETVSRIIKESTKDIKRFAVLSTLTFPQDLLVDSRGIYKSLGHTNIEIQANLFALL 360
           IEQRLETVSRIIKESTKDIKRFAVLSTLTFPQDLLVDSRGIYKSLGHTNIEIQANLFALL
Sbjct: 301 IEQRLETVSRIIKESTKDIKRFAVLSTLTFPQDLLVDSRGIYKSLGHTNIEIQANLFALL 360

Query: 361 REVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAASD 396
           REVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAASD
Sbjct: 361 REVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAASD 396

>YGL169W (SUA5) [1821] chr7 (186063..187343) Protein involved in
           translation initiation, mutation suppresses the effect
           of an aberrant upstream ATG in CYC1 [1281 bp, 426 aa]
          Length = 426

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/412 (67%), Positives = 321/412 (77%), Gaps = 20/412 (4%)

Query: 5   LISKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNTVGFP 64
           + SK  F T+ILKV+P SI+FS  AHIDGSLPTITD ETE  L+EAARIIRDTD TV FP
Sbjct: 10  MTSKALFDTKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFP 69

Query: 65  TETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSH--ATSILHN 122
           TETVYGLGGS+LNDNSVL+IY+AKNRPSDNPLI+HVSSIDQLNR++F Q H   TS+  N
Sbjct: 70  TETVYGLGGSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDN 129

Query: 123 IPEIYRPLIEKLWPGPLTILLSVPPK--STLSKLTTADQPTFAVRIPSNPVARALIALSD 180
           IP IYRPLI  LWPGPLTILL VP    S LSKLTTADQPTFAVRIP+NPVARALIALSD
Sbjct: 130 IPSIYRPLISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPVARALIALSD 189

Query: 181 TPIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRP 240
           TPIAAPSAN STRPSPTLASHV+HDL+ +IP+ILDGGAC VGVESTVVDGL +PP LLRP
Sbjct: 190 TPIAAPSANASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRP 249

Query: 241 GGFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQ---EN 297
           GGFT+E++  +GG  W+ CKVENKKTV  GEKVRTPGMKYRHYSP AKV L VP    + 
Sbjct: 250 GGFTYEEIVKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVLLVPHCEGDG 309

Query: 298 ELAIEQRLETVSRIIKESTK---DIKRFAVLSTLT----------FPQDLLVDSRGIYKS 344
            L    R+E + R+I+   K   +IK+ A+L++L           F +        I + 
Sbjct: 310 ILKGVDRMERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDFSSKTFIIER 369

Query: 345 LGHTNIEIQANLFALLREVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAASD 396
           LG +  EIQ NLFA LR+VDE D VD+IFVEGI+EEGEGLAVMNRLRKAA++
Sbjct: 370 LGQSGEEIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAAAN 421

>KLLA0A03135g 279951..281165 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein
           singleton, start by similarity
          Length = 404

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/399 (66%), Positives = 315/399 (78%), Gaps = 8/399 (2%)

Query: 5   LISKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNTVGFP 64
           L S M   TRILKVDP +I FSDSAHIDGSLPT T AETE+NLLEAA IIRDT  TV FP
Sbjct: 2   LRSVMKLTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAFP 61

Query: 65  TETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQ-SHATSILHNI 123
           TETVYGLGGS+LND SV NIYKAKNRPSDNPLI+H+SS+ QLNR I+   S     L ++
Sbjct: 62  TETVYGLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSHV 121

Query: 124 PEIYRPLIEKLWPGPLTILLSVPP---KSTLSKLTTADQPTFAVRIPSNPVARALIALSD 180
           PEIY PL+EKLWPGPLTILLS+P    ++TLSKLTTA+QPTFA RIP+NP+ARALIALSD
Sbjct: 122 PEIYHPLVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALSD 181

Query: 181 TPIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRP 240
           TPIAAPSAN STRPSPT A HVFHDL GRIPLILDGG C+VGVESTVVDGLV+PP+LLRP
Sbjct: 182 TPIAAPSANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLRP 241

Query: 241 GGFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQ-ENEL 299
           GGFT+E + ++GGP W  C VE K  +   EKV+TPGMKYRHYSP+AKV L VP+ ++++
Sbjct: 242 GGFTYENILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVPEGDSQI 301

Query: 300 AIEQRLETVSRIIKES--TKDIKRFAVLSTLTFPQDLLVDSRGIYKSLGHTNIEIQANLF 357
              +RL  +  ++ +    +  K+ A L++L   +   +D + I++SLG T  EIQANLF
Sbjct: 302 ISSERLGRLKSLVDKEIIQQGAKKVAFLNSLHLNKH-FIDGKCIHESLGTTGKEIQANLF 360

Query: 358 ALLREVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAASD 396
           ALLR+VDE+DNVD+I VEG +   EGLA+MNRLRKAAS+
Sbjct: 361 ALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAASN 399

>AEL300C [2205] [Homologous to ScYGL169W (SUA5) - SH] (78172..79428)
           [1257 bp, 418 aa]
          Length = 418

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/399 (64%), Positives = 314/399 (78%), Gaps = 13/399 (3%)

Query: 7   SKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNTVGFPTE 66
           S MS+ T++L+VDP +I FS +AHIDGSLP I+D ETE++LLEAAR+IRD   TV FPTE
Sbjct: 15  SAMSYNTKVLRVDPSAIHFSATAHIDGSLPRISDPETEKHLLEAARLIRDDGETVAFPTE 74

Query: 67  TVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSHATSILHNIPEI 126
           TVYGLGGSSLND SV NIYKAKNRPSDNPLISHVSSI QLNRRI+ Q     +L NIP +
Sbjct: 75  TVYGLGGSSLNDASVRNIYKAKNRPSDNPLISHVSSIAQLNRRIYQQDREGDVLRNIPVV 134

Query: 127 YRPLIEKLWPGPLTILLSVPPKSTLSKLTTADQPTFAVRIPSNPVARALIALSDTPIAAP 186
           Y  L+ +LWPGPLTILL +  ++ LS LTTA QPTFAVRIP++PVARALIALSDTPIAAP
Sbjct: 135 YHELVRQLWPGPLTILLPINEETALSVLTTAGQPTFAVRIPADPVARALIALSDTPIAAP 194

Query: 187 SANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRPGGFTWE 246
           SAN STRPSPT A HV+HDL+G+IPLILDGG+C VGVESTV+DGLV+PP+LLRPGGFT+E
Sbjct: 195 SANVSTRPSPTAAEHVYHDLKGKIPLILDGGSCRVGVESTVIDGLVNPPMLLRPGGFTYE 254

Query: 247 QVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQENELAIEQRLE 306
           ++  +GG QW++CKVEN+ TV +GEKVRTPGMKY+HYSPRA    F P  ++L   +R++
Sbjct: 255 EIIELGGEQWSHCKVENRMTVGSGEKVRTPGMKYKHYSPRASTVAFAPINDDLPTSERMK 314

Query: 307 TV-SRIIK----ESTKDIKRFAVLSTLTFPQDLL------VDSRGIYKSLGHTNIEIQAN 355
            V S I+K      T   ++  +L+++ FP +LL      VD   +  SLG +  E+Q+N
Sbjct: 315 IVTSEIMKYMTSHGTDKRQKVGLLTSIMFPNNLLESITDEVDV--VVYSLGSSGKEVQSN 372

Query: 356 LFALLREVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAA 394
           LFA+LR +DE+D VD+IFVEGI +  EGLAVMNRLRKAA
Sbjct: 373 LFAMLRRLDEEDEVDLIFVEGISDRNEGLAVMNRLRKAA 411

>CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein,
           start by similarity
          Length = 422

 Score =  505 bits (1300), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 258/407 (63%), Positives = 306/407 (75%), Gaps = 19/407 (4%)

Query: 6   ISKMS--FQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNTVGF 63
             KMS   +T +LKVD  SIVF ++AHIDG LP + DA +   LL+AA IIRDT+ TV F
Sbjct: 10  FCKMSQPLRTEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHIIRDTEETVAF 69

Query: 64  PTETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSHATSILHNI 123
           PTETVYGLGGSSLNDNSV NIYKAKNRPSDNPLI+HVSSIDQLNR+I+       IL NI
Sbjct: 70  PTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYNDYEDGDILRNI 129

Query: 124 PEIYRPLIEKLWPGPLTILLSVPPKS--TLSKLTTADQPTFAVRIPSNPVARALIALSDT 181
           P+IY PLIEKLWPGPLTILL +PP+   +LSKLTT DQPTFAVRIP+N +ARALIAL+DT
Sbjct: 130 PKIYHPLIEKLWPGPLTILLPIPPERNVSLSKLTTGDQPTFAVRIPANSIARALIALADT 189

Query: 182 PIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRPG 241
           PIAAPSAN STRPSPTLASHV+HDL+GRIPLI+DGGAC VGVESTVVDGL  PP LLRPG
Sbjct: 190 PIAAPSANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLCLPPALLRPG 249

Query: 242 GFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQENELAI 301
           GFT+E +  +GG  W NCKVENKKT+S GEKVRTPGMKY+HY+P AKV + +P +++  +
Sbjct: 250 GFTYEDILHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVLLPNDSDTQM 309

Query: 302 EQRLETVSRIIKESTKDI--KRFAVLSTLTFP---QDLLVDSRGIYKS---------LGH 347
            Q ++ +   +     DI  K+ A+++TL       ++ + +   YK          LG 
Sbjct: 310 -QLIDKMKVFLSSHQPDIIDKKVAIMTTLKLTPILNEISLFASSNYKGTKTEFLVSELGA 368

Query: 348 TNIEIQANLFALLREVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAA 394
           +   IQANLFA LR+ DE DNVD I VEGI E  EGLAVMNRLRKA+
Sbjct: 369 SGEAIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKAS 415

>Scas_707.49
          Length = 441

 Score =  485 bits (1248), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 249/399 (62%), Positives = 296/399 (74%), Gaps = 9/399 (2%)

Query: 4   TLISKMSFQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNTVGF 63
           T ++  SFQT+I KVDP  I F +++HIDG+LP ITD  TE  LLEAA+IIRDTD TV F
Sbjct: 38  TTMASPSFQTKIAKVDPTKIFFPENSHIDGTLPIITDPITESALLEAAQIIRDTDQTVAF 97

Query: 64  PTETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSHATSILHNI 123
           PTETVYGLGGS+LND SV+NIYKAKNRPSDNPLI+HVSSI+QLNR+IF      S L NI
Sbjct: 98  PTETVYGLGGSALNDQSVINIYKAKNRPSDNPLITHVSSINQLNRKIFKSHKTDSSLQNI 157

Query: 124 PEIYRPLIEKLWPGPLTILLSVP-PKSTLSKLTTADQPTFAVRIPSNPVARALIALSDTP 182
           P IY  LI+ LWPGPLTILL     + TLS  TT  QPTFAVRIPSN +ARALIALSDTP
Sbjct: 158 PIIYHKLIKTLWPGPLTILLPTENTRGTLSVKTTNSQPTFAVRIPSNVIARALIALSDTP 217

Query: 183 IAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRPGG 242
           IAAPSAN ST+PSPTLASHVFHDL+G+IPLILDGG C VGVESTV+DGL  PP+LLRPGG
Sbjct: 218 IAAPSANTSTKPSPTLASHVFHDLKGKIPLILDGGPCNVGVESTVLDGLSRPPMLLRPGG 277

Query: 243 FTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVP---QENEL 299
            T E +  +GG  W +CKVENK+ V  GE VRTPGMKY+HYSP AKV L +P        
Sbjct: 278 LTLEHILELGGQDWIDCKVENKQNVKQGETVRTPGMKYKHYSPDAKVILLIPPPDSNQRP 337

Query: 300 AIEQRLETVSRIIKESTKDIKRFAVLS--TLTFPQDLLVDSRG-IYKSLGHTNIEIQANL 356
            ++  L  ++ I+ +     K+ A+L+   L   + L  ++   I K LG    EIQANL
Sbjct: 338 TVKSYLHELNEIVGQEKG--KKIAILTGPILNREEKLFPNNTDIIVKHLGDEGNEIQANL 395

Query: 357 FALLREVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAAS 395
           FA+LRE DE DNVD++ VEG  E+GEGLA+MNRL+KA++
Sbjct: 396 FAMLREADEIDNVDVMIVEGSSEDGEGLAIMNRLKKASA 434

>KLLA0B04334g 388079..388480 similar to sp|P38877 Saccharomyces
           cerevisiae YHR191c CFT8 singleton, start by similarity
          Length = 133

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 344 SLGHTNIEIQANLFALLREVDEKDNVDIIFVEGIDEEGEGLA 385
           SLGH  IEIQ +L    + +D   +VD  F+E    EG GL 
Sbjct: 28  SLGHVMIEIQGDLQHPQKSIDPALDVDSRFIE---HEGNGLV 66

>AFR420W [3612] [Homologous to ScYKL203C (TOR2) - SH; ScYJR066W (TOR1)
            - SH] complement(1188911..1196299) [7389 bp, 2462 aa]
          Length = 2462

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 17/24 (70%)

Query: 245  WEQVRSMGGPQWANCKVENKKTVS 268
            WEQ+  +G  +WAN K++ K+ ++
Sbjct: 1431 WEQLSQLGAEKWANAKLDIKRIIA 1454

>Kwal_56.23909
          Length = 776

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 65  TETVYGLGGSSLNDNSVLNIYKAKNR-----PSDNPLISHVSSIDQLNRRIFGQSHATSI 119
           T+ +  L G  L  N V ++   KNR      S+   +S++++ID + R +       + 
Sbjct: 467 TDKLLDLKGYRLEQNWVKSLKILKNRFDFKNYSNAQGVSNINNIDVMLRDVKHSEELCAQ 526

Query: 120 LHNIPEIYRPLI 131
           +H++PEI R +I
Sbjct: 527 MHSVPEISREVI 538

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,735,389
Number of extensions: 559503
Number of successful extensions: 1840
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1859
Number of HSP's successfully gapped: 24
Length of query: 396
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 292
Effective length of database: 12,995,837
Effective search space: 3794784404
Effective search space used: 3794784404
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)