Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27907g1501357056e-97
Kwal_33.146121291014015e-51
Sklu_1881.41301143894e-49
AFR044C1261053851e-48
Scas_697.15142823252e-39
CAGL0G06094g138863235e-39
YHR132W-A131843218e-39
YNL157W168862979e-35
Kwal_33.1361889194650.96
Kwal_56.2295159650613.6
ADR361W44376594.8
CAGL0F05885g71247588.2
YMR219W (ESC1)165839588.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27907g
         (148 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27907g complement(2581760..2582212) some similarities with...   276   6e-97
Kwal_33.14612                                                         159   5e-51
Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement      154   4e-49
AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH] ...   152   1e-48
Scas_697.15                                                           129   2e-39
CAGL0G06094g 583297..583713 highly similar to tr|Q9P305 Saccharo...   129   5e-39
YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the...   128   8e-39
YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with sim...   119   9e-35
Kwal_33.13618                                                          30   0.96 
Kwal_56.22951                                                          28   3.6  
ADR361W [2102] [Homologous to ScYAL032C (PRP45) - SH] complement...    27   4.8  
CAGL0F05885g 588828..590966 similar to sp|Q05080 Saccharomyces c...    27   8.2  
YMR219W (ESC1) [4175] chr13 (707132..712108) Nuclear protein req...    27   8.7  

>KLLA0F27907g complement(2581760..2582212) some similarities with
           sgd|S0007496 Saccharomyces cerevisiae YHR132wa Pi,
           hypothetical start
          Length = 150

 Score =  276 bits (705), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%)

Query: 1   MSDKQEHPVFGHEHRHPHIHDSESVDPKAPVANPENVDLSKLSPQELKIYKMYGKLPSKK 60
           MSDKQEHPVFGHEHRHPHIHDSESVDPKAPVANPENVDLSKLSPQELKIYKMYGKLPSKK
Sbjct: 1   MSDKQEHPVFGHEHRHPHIHDSESVDPKAPVANPENVDLSKLSPQELKIYKMYGKLPSKK 60

Query: 61  DLFQHKLQERKYFDSGDYALRRAGVKSDDLQSSPVANNNLPLTNPSGLRESIIKRRMSSS 120
           DLFQHKLQERKYFDSGDYALRRAGVKSDDLQSSPVANNNLPLTNPSGLRESIIKRRMSSS
Sbjct: 61  DLFQHKLQERKYFDSGDYALRRAGVKSDDLQSSPVANNNLPLTNPSGLRESIIKRRMSSS 120

Query: 121 ANGPSNVDAQRLNRQ 135
           ANGPSNVDAQRLNRQ
Sbjct: 121 ANGPSNVDAQRLNRQ 135

>Kwal_33.14612
          Length = 129

 Score =  159 bits (401), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 89/101 (88%), Gaps = 3/101 (2%)

Query: 35  ENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGVKSDDLQSSP 94
           E VD SK++PQELK+YKMYGKLPSKKDLF+HKLQERKYFDSGDYAL +AGVKSDDLQS  
Sbjct: 18  EKVDTSKMTPQELKLYKMYGKLPSKKDLFKHKLQERKYFDSGDYALNKAGVKSDDLQSDS 77

Query: 95  VANNNLPLTNPSGLRESIIKRRMSSSANGPSNVDAQRLNRQ 135
           + N++LP+TNPSGLRESIIKRR+SSSA G   +DAQ L RQ
Sbjct: 78  IGNSHLPVTNPSGLRESIIKRRLSSSAGG---MDAQELRRQ 115

>Sklu_1881.4 YHR132W-A, Contig c1881 4533-4925 reverse complement
          Length = 130

 Score =  154 bits (389), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 93/114 (81%), Gaps = 6/114 (5%)

Query: 22  SESVDPKAPVANPENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALR 81
           S ++D K PV      D SKL+PQELK+YK+YGKLPSKKDLF+HKLQERKYFDSGDYAL 
Sbjct: 9   SSNIDLKNPV------DTSKLTPQELKLYKLYGKLPSKKDLFKHKLQERKYFDSGDYALS 62

Query: 82  RAGVKSDDLQSSPVANNNLPLTNPSGLRESIIKRRMSSSANGPSNVDAQRLNRQ 135
           +AGVKSDDLQS  + +++LP+TNPSGLRESII+RRMSSSA       +Q+LNRQ
Sbjct: 63  KAGVKSDDLQSDSIGSSHLPVTNPSGLRESIIRRRMSSSAGSVDAAASQQLNRQ 116

>AFR044C [3236] [Homologous to ScYHR132W-A - SH; ScYNL157W - SH]
           (511998..512378) [381 bp, 126 aa]
          Length = 126

 Score =  152 bits (385), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 91/105 (86%), Gaps = 3/105 (2%)

Query: 31  VANPENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGVKSDDL 90
           +A+  +VDLS L+PQELK+YK+YGKLP KKDLF+HKL ERKYFDSGDYAL +AGVKS+DL
Sbjct: 12  LADTGDVDLSALTPQELKLYKLYGKLPGKKDLFKHKLHERKYFDSGDYALSKAGVKSEDL 71

Query: 91  QSSPVANNNLPLTNPSGLRESIIKRRMSSSANGPSNVDAQRLNRQ 135
            S+ V +++LP+TNPSGLRESII+RRMSSSA G   +D+Q LNRQ
Sbjct: 72  GSAAVGSSHLPVTNPSGLRESIIRRRMSSSAGG---LDSQNLNRQ 113

>Scas_697.15
          Length = 142

 Score =  129 bits (325), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 62/82 (75%), Positives = 76/82 (92%), Gaps = 2/82 (2%)

Query: 37  VDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGV-KSDDLQSSPV 95
           VDLSKL+PQELK++KMYGKLPSK+DL +HK+QERKYFDSGDYALR+AGV K DD+ SS  
Sbjct: 29  VDLSKLTPQELKLFKMYGKLPSKRDLLKHKMQERKYFDSGDYALRKAGVIKKDDVMSSN- 87

Query: 96  ANNNLPLTNPSGLRESIIKRRM 117
           ++NN+P+TNPSGLRESII+RR+
Sbjct: 88  SSNNMPVTNPSGLRESIIRRRL 109

>CAGL0G06094g 583297..583713 highly similar to tr|Q9P305
           Saccharomyces cerevisiae YHR132wa, start by similarity
          Length = 138

 Score =  129 bits (323), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 77/86 (89%), Gaps = 1/86 (1%)

Query: 37  VDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGV-KSDDLQSSPV 95
           VD+S+LS QELK+YKMYGKLPSKKD+F+H++  RKYFDSGDYAL++AGV +SDD+     
Sbjct: 32  VDVSRLSEQELKLYKMYGKLPSKKDIFKHRMAGRKYFDSGDYALKKAGVIRSDDVIDENN 91

Query: 96  ANNNLPLTNPSGLRESIIKRRMSSSA 121
           ++NNLP+TNPSGLRESII+RRMSSSA
Sbjct: 92  SSNNLPVTNPSGLRESIIRRRMSSSA 117

>YHR132W-A (YHR132W-A) [2419] chr8 (370055..370450) Member of the
           cAMP-regulated phosphoprotein or endosulfine conserved
           region containing family, has high similarity to
           uncharacterized S. cerevisiae Ynl157p [396 bp, 131 aa]
          Length = 131

 Score =  128 bits (321), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 77/84 (91%), Gaps = 2/84 (2%)

Query: 35  ENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGV-KSDDLQSS 93
           E VDLSKLSPQELK+YKMYGKLPSKKDL +HK+Q+R+YFDSGDYAL++AGV KSDD+  +
Sbjct: 23  EGVDLSKLSPQELKLYKMYGKLPSKKDLLRHKMQDRQYFDSGDYALKKAGVIKSDDVIVN 82

Query: 94  PVANNNLPLTNPSGLRESIIKRRM 117
             ++NNLP+TNPSGLRESII+RRM
Sbjct: 83  -NSSNNLPVTNPSGLRESIIRRRM 105

>YNL157W (YNL157W) [4440] chr14 (340352..340858) Protein with
           similarity to Yhr132w-ap and with weak similarity to
           human ENSA alpha-endosulfine and human ARPP-19
           cAMP-regulated phosphoprotein [507 bp, 168 aa]
          Length = 168

 Score =  119 bits (297), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 55/86 (63%), Positives = 71/86 (82%), Gaps = 6/86 (6%)

Query: 37  VDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKYFDSGDYALRRAGVKSDDLQSSPV- 95
           +D SK SP E+K+YKMYGKLPSKKD+F+H +Q+RKYFDSGDYAL++AG++++D    P+ 
Sbjct: 26  IDTSKFSPNEMKLYKMYGKLPSKKDIFKHTMQKRKYFDSGDYALQKAGIQNND----PIN 81

Query: 96  -ANNNLPLTNPSGLRESIIKRRMSSS 120
              NNLPLTNPS LRE IIKRR+S+ 
Sbjct: 82  YGKNNLPLTNPSKLREDIIKRRISTC 107

>Kwal_33.13618
          Length = 891

 Score = 29.6 bits (65), Expect = 0.96,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 15/94 (15%)

Query: 33  NPENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKLQERKY--FDSGDYALRRAG-VKSDD 89
           NP+++ LSKL  +  KI           D F  KL+ + Y  F + +  L++ G + SD 
Sbjct: 133 NPQDIFLSKLGDERTKI-----------DDFYQKLEAQLYGRFRALELDLQKIGALHSDA 181

Query: 90  LQSSPVANNNLPLTNPSGLRESIIKRRMSSSANG 123
           L          P  +    RES++ RR ++  NG
Sbjct: 182 LTDQGSLETGAPHEHRPRRRESVLSRR-TTRENG 214

>Kwal_56.22951
          Length = 596

 Score = 28.1 bits (61), Expect = 3.6,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 18 HIHDSESVDPKAPVANPENVDLSKLSPQELKIYKMYGKLPSKKDLFQHKL 67
           IHD      +    N E VDLS LS ++ + Y++  + P +K L Q  L
Sbjct: 41 QIHDIAHSFQRQEAPNSEGVDLSLLSEEQRRNYELANQ-PYEKSLSQRHL 89

>ADR361W [2102] [Homologous to ScYAL032C (PRP45) - SH]
          complement(1345956..1347287) [1332 bp, 443 aa]
          Length = 443

 Score = 27.3 bits (59), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 6/76 (7%)

Query: 4  KQEHPVFGHEHRHPHIHDSESV-----DPKAPVANPENVDLSKLSPQELKIYKMYGKLPS 58
          K+  P     H+ P     E V     D   P   P NV      P   + + M   LPS
Sbjct: 15 KESSPTVASAHQSPENQGDEPVAGIVFDSLQPDGIP-NVSFQDFIPIRQRDFNMEIPLPS 73

Query: 59 KKDLFQHKLQERKYFD 74
          K+D+ Q   + + YFD
Sbjct: 74 KQDIEQTFQRTKAYFD 89

>CAGL0F05885g 588828..590966 similar to sp|Q05080 Saccharomyces
           cerevisiae YMR032w HOF1 involved in cytokinesis, start
           by similarity
          Length = 712

 Score = 26.9 bits (58), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 21/47 (44%)

Query: 62  LFQHKLQERKYFDSGDYALRRAGVKSDDLQSSPVANNNLPLTNPSGL 108
           L   + QE   F+ GDY L    V  D  +     N+N   T+ +GL
Sbjct: 653 LINSEAQELANFEKGDYLLLTEVVNEDWYRGEVYGNSNTTTTHGNGL 699

>YMR219W (ESC1) [4175] chr13 (707132..712108) Nuclear protein required
            for plasmid anchoring and partitioning mediated by Sir4p,
            may function to localize silencing complexes to the
            nuclear periphery [4977 bp, 1658 aa]
          Length = 1658

 Score = 26.9 bits (58), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 21/39 (53%)

Query: 21   DSESVDPKAPVANPENVDLSKLSPQELKIYKMYGKLPSK 59
            D E V    P +N EN+   K +P   ++Y+++   P++
Sbjct: 1455 DKEEVTDSYPYSNSENITAEKSAPTSPEVYEIFSDTPNE 1493

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.129    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,032,941
Number of extensions: 220282
Number of successful extensions: 729
Number of sequences better than 10.0: 44
Number of HSP's gapped: 722
Number of HSP's successfully gapped: 44
Length of query: 148
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 56
Effective length of database: 13,411,253
Effective search space: 751030168
Effective search space used: 751030168
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 56 (26.2 bits)