Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27643g47847125400.0
Sklu_2260.147748213430.0
Kwal_47.1815546546912761e-174
ADL088W48647211731e-158
YER051W49249211371e-152
CAGL0J02860g4033939451e-124
Kwal_0.289578188790.14
AAR003W580118790.14
Scas_700.3736947730.64
KLLA0D07260g34232691.9
Kwal_26.869733236682.1
KLLA0F12804g580118692.2
CAGL0H03641g24167672.4
Sklu_1701.233432664.6
Scas_699.42885109665.3
YPL138C (SPP1)35344656.0
CAGL0M02255g35865638.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27643g
         (471 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27643g complement(2561213..2562649) similar to sp|P40034 S...   983   0.0  
Sklu_2260.1 YER051W, Contig c2260 321-1754                            521   0.0  
Kwal_47.18155                                                         496   e-174
ADL088W [1653] [Homologous to ScYER051W - SH] complement(530548....   456   e-158
YER051W (YER051W) [1479] chr5 (254655..256133) Protein containin...   442   e-152
CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces c...   368   e-124
Kwal_0.289                                                             35   0.14 
AAR003W [189] [Homologous to NOHBY] complement(342591..344333) [...    35   0.14 
Scas_700.37                                                            33   0.64 
KLLA0D07260g 619630..620658 similar to sgd|S0006059 Saccharomyce...    31   1.9  
Kwal_26.8697                                                           31   2.1  
KLLA0F12804g complement(1180909..1182651) similar to ca|CA0795|I...    31   2.2  
CAGL0H03641g 336494..337219 highly similar to sp|P53981 Saccharo...    30   2.4  
Sklu_1701.2 YPL138C, Contig c1701 2003-3007 reverse complement         30   4.6  
Scas_699.42                                                            30   5.3  
YPL138C (SPP1) [5308] chr16 complement(291365..292426) Component...    30   6.0  
CAGL0M02255g 270614..271690 highly similar to tr|Q12461 Saccharo...    29   8.7  

>KLLA0F27643g complement(2561213..2562649) similar to sp|P40034
           Saccharomyces cerevisiae YER051w singleton, start by
           similarity
          Length = 478

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/471 (100%), Positives = 471/471 (100%)

Query: 1   MTSGTVKCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEK 60
           MTSGTVKCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEK
Sbjct: 1   MTSGTVKCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEK 60

Query: 61  HVESFKCTLHDESKCALLKLNGVSVGTEDIAFTKRNRLRNKRPIDYIALNEGNDKRLKHE 120
           HVESFKCTLHDESKCALLKLNGVSVGTEDIAFTKRNRLRNKRPIDYIALNEGNDKRLKHE
Sbjct: 61  HVESFKCTLHDESKCALLKLNGVSVGTEDIAFTKRNRLRNKRPIDYIALNEGNDKRLKHE 120

Query: 121 HPHTQAFLACFEKWKDPKAISSSELESDFQIIKVPLRVSDPADSGMYVISANELGLVDSK 180
           HPHTQAFLACFEKWKDPKAISSSELESDFQIIKVPLRVSDPADSGMYVISANELGLVDSK
Sbjct: 121 HPHTQAFLACFEKWKDPKAISSSELESDFQIIKVPLRVSDPADSGMYVISANELGLVDSK 180

Query: 181 DHVKLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLE 240
           DHVKLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLE
Sbjct: 181 DHVKLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLE 240

Query: 241 VSHVESFKDGIRRPNAVNNNDLVDIVWNFGRTETDIERPKVTKYILMSVGNAYTDFHLDF 300
           VSHVESFKDGIRRPNAVNNNDLVDIVWNFGRTETDIERPKVTKYILMSVGNAYTDFHLDF
Sbjct: 241 VSHVESFKDGIRRPNAVNNNDLVDIVWNFGRTETDIERPKVTKYILMSVGNAYTDFHLDF 300

Query: 301 AGTSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNL 360
           AGTSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNL
Sbjct: 301 AGTSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNL 360

Query: 361 FMIPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGK 420
           FMIPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGK
Sbjct: 361 FMIPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGK 420

Query: 421 TCEWLLNSDHIQSISSEDIENLVKYLSSSNIKYKPINYQSKKELITELKNK 471
           TCEWLLNSDHIQSISSEDIENLVKYLSSSNIKYKPINYQSKKELITELKNK
Sbjct: 421 TCEWLLNSDHIQSISSEDIENLVKYLSSSNIKYKPINYQSKKELITELKNK 471

>Sklu_2260.1 YER051W, Contig c2260 321-1754
          Length = 477

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/482 (54%), Positives = 328/482 (68%), Gaps = 36/482 (7%)

Query: 8   CHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEKHVESFKC 67
           C +C  DD     + +WV CE C  W H+ CVP++ +    ++           +  F C
Sbjct: 6   CSYCSNDDP---SKSLWVQCELCPQWVHVECVPLKHLRNDSDDSVTTHPTSASQIVKFSC 62

Query: 68  TLHDESKCALLKLNGVSVGTEDIAFTKRNRLRNKRP---------------IDYIALNEG 112
             H E    LL++   +          R R +   P               IDYIALNEG
Sbjct: 63  ENHGE---VLLQVKQQA----------RKRKQKDPPPTGNDKKYGLRKKKKIDYIALNEG 109

Query: 113 NDKRLKHEHPHTQAFLACFEKWKDPKAISSSE-LESDFQIIKVPLRVSDPADSGMYVISA 171
            D+RLK EHPH  AFL CF+KW +   I SSE LE+ F  I VPL+V DP +SGM + + 
Sbjct: 110 EDRRLKDEHPHIPAFLKCFDKWSNTTNIISSESLEATFDSITVPLKVKDPENSGMKIPTV 169

Query: 172 NELGLVDSKDHV-KLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDR 230
            ELG  + ++   K+ V  + +++GDDYPLDVMDVQTQ N  WT+SQWN+Y+S T    R
Sbjct: 170 QELGRENMENESSKITVNDIARVLGDDYPLDVMDVQTQQNSDWTISQWNDYFSKTPTEQR 229

Query: 231 DRIRNVISLEVSHVESFKDGIRRPNAVNNNDLVDIVW-NFGRTETDIERPKVTKYILMSV 289
           DRIRNVISLEVSHV+ F+DGIRRP AV  NDL D+VW +    ++D+ RPKVTKYILMSV
Sbjct: 230 DRIRNVISLEVSHVQQFRDGIRRPTAVEVNDLADLVWEDVVDKKSDVPRPKVTKYILMSV 289

Query: 290 GNAYTDFHLDFAGTSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQLEA 349
           GNAYTDFHLDFAGTSVYYNVISG KKFILFPPT +NL +Y+ WCD+D+QN +FLGD LE 
Sbjct: 290 GNAYTDFHLDFAGTSVYYNVISGKKKFILFPPTIHNLGQYKRWCDSDHQNLVFLGDMLED 349

Query: 350 GIAMELTEGNLFMIPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPKKF 409
           G+AMEL  G+LFMIPCGYIHAVYTP DS +VGGNFLTLRDITTQL +VEIE  TKVPK+F
Sbjct: 350 GVAMELNSGDLFMIPCGYIHAVYTPIDSLVVGGNFLTLRDITTQLKIVEIERLTKVPKRF 409

Query: 410 TFPQFESVMGKTCEWLLNSDHIQSISSEDIENLVKYLSSSNIKYKPINYQSKKELITELK 469
           TFP F+ VMGKTCEW+L   H ++I  E I+ L+ ++S   +KYKP+NY++KKEL+ EL+
Sbjct: 410 TFPHFDIVMGKTCEWVLK--HRKAIPDEHIKTLISHMSDPKVKYKPVNYRNKKELLQELE 467

Query: 470 NK 471
            K
Sbjct: 468 KK 469

>Kwal_47.18155
          Length = 465

 Score =  496 bits (1276), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 244/469 (52%), Positives = 318/469 (67%), Gaps = 21/469 (4%)

Query: 8   CHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEKHVESFKC 67
           C +C    S D  + +WV CE CD W H+TCVPI+ +V ++   S+        ++ F C
Sbjct: 6   CAYCS---SSDPDKLLWVQCEVCDSWVHVTCVPIKDIVNEMGEASKTYPQDADQIKRFSC 62

Query: 68  TLHDESKCAL---LKLNGVSVGTEDIAFTKRNRLRNKRPIDYIALNEGNDKRLKHEHPHT 124
             H      +   LK   ++    D++  KR  LR K+ +DYI+LNEG D+RLK+EHPH 
Sbjct: 63  AEHPYPALEINMGLKKRKLNSTMADLS-AKRQGLRKKKQVDYISLNEGADRRLKNEHPHM 121

Query: 125 QAFLACFEKWKDPKAISSS-ELESDFQIIKVPLRVSDPADSGMYVISANELGLVDSKDHV 183
            AFLACF +W++   +    ELE  F  IKVPL++ DP +SGM +    + G        
Sbjct: 122 HAFLACFSRWENKTNVMDCLELEDKFNSIKVPLKIKDPENSGMQIPKDVDGG-------- 173

Query: 184 KLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLEVSH 243
              V+ +T+ +G+DY +DVMDVQ+Q N  WT+++WN+Y+  T    RDRIRNVISLEVSH
Sbjct: 174 NFTVDTVTRFLGEDYRVDVMDVQSQQNSTWTMAEWNKYFMQTPIESRDRIRNVISLEVSH 233

Query: 244 VESFKDGIRRPNAVNNNDLVDIVWNFGRTETDIERPKVTKYILMSVGNAYTDFHLDFAGT 303
           VE FK G+RRP  V +ND+VD++WN      +  RPKVTKYILMSV NAYTDFHLDFAGT
Sbjct: 234 VEQFKSGLRRPRVVESNDVVDLLWN--AIPDNTVRPKVTKYILMSVQNAYTDFHLDFAGT 291

Query: 304 SVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNLFMI 363
           SVYY VISGSKKFILFPPT  NL  Y +WC ND+QN IFLGDQLE GIAM+L+ G+LFMI
Sbjct: 292 SVYYKVISGSKKFILFPPTPRNLAAYTQWCGNDDQNLIFLGDQLEEGIAMDLSAGDLFMI 351

Query: 364 PCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGKTCE 423
           PCGYIHAVYTP D+ ++GGNFLTLRD+ TQL +V+IE  TKVPKKFTFPQFESVMGKTCE
Sbjct: 352 PCGYIHAVYTPVDTLVIGGNFLTLRDLKTQLMIVDIEKVTKVPKKFTFPQFESVMGKTCE 411

Query: 424 WLLNSDHIQ---SISSEDIENLVKYLSSSNIKYKPINYQSKKELITELK 469
           +++  +       I +E  E L+ Y+     KY+P+N+ +K++L+   +
Sbjct: 412 YIVKKEANGIDLGIKNEQKEALLHYIQDPKFKYRPVNFSTKRQLLERFQ 460

>ADL088W [1653] [Homologous to ScYER051W - SH]
           complement(530548..532008) [1461 bp, 486 aa]
          Length = 486

 Score =  456 bits (1173), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 227/472 (48%), Positives = 300/472 (63%), Gaps = 34/472 (7%)

Query: 7   KCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEKHVESFK 66
           +C +CK          +WV CE C  W H+ C+P +  +   E PS     +   + +F+
Sbjct: 30  QCVYCKGKMEHR----MWVQCEACPQWVHVQCIPEE-CLSGGEYPS-----RSSDIAAFE 79

Query: 67  CTLHDESKCALLKLNGVSVGTE-----DIAFTKRNRLRNKRPIDYIALNEGNDKRLKHEH 121
           C+ H  ++ A L L G     E     + A T+R RLR + P+DYIALNEG D RL+HEH
Sbjct: 80  CSAHGTAR-ARLALKGKRRRVEAKEEPERAGTRRYRLRKRGPLDYIALNEGQDVRLRHEH 138

Query: 122 PHTQAFLACFEKWKD-PKAISSSELESDFQIIKVPLRVSDPADSGMYVISANELGLVDSK 180
           PH  AF  CF KW    + ++S+EL+  F  ++ P+ V+DP  SGM   + +E  L D  
Sbjct: 139 PHRAAFQGCFTKWSGLGRTVTSAELQQSFAELREPVLVADPEHSGMQTPAMDEQVLAD-- 196

Query: 181 DHVKLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLE 240
                       ++G DY LDVMDVQ+Q NE+WT+ QW EY  HT+   RDRIRNVISLE
Sbjct: 197 ------------VLGADYSLDVMDVQSQQNERWTMGQWKEYM-HTARGVRDRIRNVISLE 243

Query: 241 VSHVESFKDGIRRPNAVNNNDLVDIVWNFGRTETDIERPKVTKYILMSVGNAYTDFHLDF 300
           VSHV  F   IRRP AV +NDLVD+VW          +PKV KY+LMS  NAYTDFHLDF
Sbjct: 244 VSHVPEFGQRIRRPRAVEDNDLVDLVWPVQPAPEIGAKPKVQKYVLMSAANAYTDFHLDF 303

Query: 301 AGTSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNL 360
           AGTSVYY+++ G+K+F+LFPPT  NL  Y+ WC +DNQ  IFLGD+L+ G+   L  G+L
Sbjct: 304 AGTSVYYSLLRGAKQFLLFPPTPANLGAYKAWCADDNQGLIFLGDRLQDGVLFSLRPGDL 363

Query: 361 FMIPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGK 420
           FMIP G+IHAVYTPEDSF+VGGN+L LRD++T + +V IE +T+VPKKFTFP+FE VMG 
Sbjct: 364 FMIPSGFIHAVYTPEDSFVVGGNYLCLRDLSTHIRIVRIEQETQVPKKFTFPKFERVMGL 423

Query: 421 TCEWLLNS--DHIQSISSEDIENLVKYLSSSNIKYKPINYQSKKELITELKN 470
           T EWLL    + +Q I+ E    L+ YL  + +KYKP +Y +K  ++  L+ 
Sbjct: 424 TAEWLLEGLPERLQLITHEHAVALLDYLRDTRLKYKPAHYHTKSTMLASLEK 475

>YER051W (YER051W) [1479] chr5 (254655..256133) Protein containing a
           PHD-finger, which may be involved in chromatin-mediated
           transcriptional regulation, and a Jumonji (jmjC) domain,
           has low similarity to uncharacterized C. albicans
           Orf6.8281p [1479 bp, 492 aa]
          Length = 492

 Score =  442 bits (1137), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 237/492 (48%), Positives = 314/492 (63%), Gaps = 42/492 (8%)

Query: 8   CHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAF--KEKHVESF 65
           C  C+  D  + G  IWV C+ C  W H+ CVP++ +       S++L++    K ++S+
Sbjct: 7   CQHCQLKD--NPGALIWVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSY 64

Query: 66  KCTLHDE----SKCALLKLNGVSV----GTEDIAFTKRNRLRNKRPIDYIALNEGNDKRL 117
           +C  H E    +  AL+   G         ED    KR   R K+ +DYIALNEG  KR 
Sbjct: 65  RCPNHKEGEYLTAYALITQKGKRQRNKENPEDSHINKRYNFRKKKLLDYIALNEGESKRD 124

Query: 118 KHEHPHTQAFLACFEKWKD-PKAISSSELESDFQIIKVPLRVSDPADSGMYVISANELGL 176
           K  HPH ++F+  FEKWK+    I++++    F  I VP ++ DP +SG+YV +      
Sbjct: 125 KMNHPHKESFMKSFEKWKNGSNIINAADFAEKFDNIDVPYKIIDPLNSGVYVPNV----- 179

Query: 177 VDSKDHVKLNVEYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNV 236
               D+  L V Y+T+++G+DY +DVMDVQ+QMNE W L  WNEY+++T P  RDRIRNV
Sbjct: 180 --GTDNGCLTVNYITEMIGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNV 237

Query: 237 ISLEVSHVESFKDGIRRPNAVNNNDLVDIVWNFG---------RTETDIERPKVTKYILM 287
           ISLEVS++E  +  + RP AV  NDLVD +W+F          + E +  +PKVTKYILM
Sbjct: 238 ISLEVSNIEGLE--LERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILM 295

Query: 288 SVGNAYTDFHLDFAGTSVYYNVISGSKKFILFPPTDYNLKKYREWCDNDNQNDIFLGDQL 347
           SV +AYTDFHLDFAGTSVYYNVISG KKF+LFPPT  N+ KY EW   ++QN +FLGD L
Sbjct: 296 SVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDIL 355

Query: 348 EAGIAMELTEGNLFMIPCGYIHAVYTPEDSFIVGGNFLTLRDITTQLNVVEIEHQTKVPK 407
           E GIAMEL  G+LFMIP GYIHAVYTP DS + GGNFLT+RD+ T L +VEIE  TKVP+
Sbjct: 356 EDGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPR 415

Query: 408 KFTFPQFESVMGKTCEWL-LNSDHIQS-ISSED---------IENLVKYLSSSNIKYKPI 456
           +FTFP+F+ VMGK CE+L L+ + I S +S  D         I++L  Y+    +KYKP+
Sbjct: 416 RFTFPKFDQVMGKLCEYLALDKNKITSDVSDGDLLSRTTNCAIQSLHAYVIKPEVKYKPL 475

Query: 457 NYQSKKELITEL 468
           N+ SKK L   L
Sbjct: 476 NFTSKKHLAKAL 487

>CAGL0J02860g 276002..277213 similar to sp|P40034 Saccharomyces
           cerevisiae YER051w, hypothetical start
          Length = 403

 Score =  368 bits (945), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 196/393 (49%), Positives = 261/393 (66%), Gaps = 21/393 (5%)

Query: 88  EDIAFTKRNRLRNKRPIDYIALNEGNDKRLKHEHPHTQAFLACFEKW----KDPKAISSS 143
           +++   KR   R K  +DY ALNEG DK+ K  HPH   F   FEK      +  +++ S
Sbjct: 19  DEVPRKKRYNFRKKVELDYSALNEGEDKKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCS 78

Query: 144 ELESDFQIIKVPLRVSDPADSGMYVISANELGLVDSKDHVKLNVEYLTKIMGDDYPLDVM 203
           E    F  I  PL++SDP +SGM V+S N      +K    L V+ +T+ +GDDY ++VM
Sbjct: 79  EYCKRFDDIDFPLKISDPENSGM-VVSTN------NKTTRDLTVDDITQAVGDDYFVNVM 131

Query: 204 DVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLEVSHVESFKDGIRRPNAVNNNDLV 263
           DVQ+Q NE+W+L +W  Y++  +  ++DRIRNVISLEVSHVE  +    RP+ V++ DLV
Sbjct: 132 DVQSQENERWSLREWCNYFNKPA-EEKDRIRNVISLEVSHVEDLQ--YDRPDIVDDKDLV 188

Query: 264 DIVWNFGR---TETDIERPKVTKYILMSVGNAYTDFHLDFAGTSVYYNVISGSKKFILFP 320
           DIVWN      TE D  RPKVTKY LMSV NA+TD+HLDFAGTSVYYN+  G KKFIL+P
Sbjct: 189 DIVWNNVENLDTEND-PRPKVTKYCLMSVKNAFTDYHLDFAGTSVYYNLAFGKKKFILYP 247

Query: 321 PTDYNLKKYREWCDNDNQNDIFLGDQLEAGIAMELTEGNLFMIPCGYIHAVYTPEDSFIV 380
           PT  N++ Y EW  +  QN +FLG++L  G+AMEL  G+LFMIP GYIH VYTPEDS I 
Sbjct: 248 PTPENIENYIEWSTSTYQNMLFLGEKLTGGVAMELNGGDLFMIPSGYIHVVYTPEDSLIF 307

Query: 381 GGNFLTLRDITTQLNVVEIEHQTKVPKKFTFPQFESVMGKTCEWLLNSD---HIQSISSE 437
           GGN+LT RDI+ QL +V++E QT V K++TFP F+ VMG+TCEWL  +        +  E
Sbjct: 308 GGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPMFDEVMGRTCEWLCQNQKKGKQMQVKKE 367

Query: 438 DIENLVKYLSSSNIKYKPINYQSKKELITELKN 470
            + +L+ Y+ S   KYKP N+ +KK+++ EL N
Sbjct: 368 TVNDLISYMKSGKTKYKPTNFINKKQMLQELSN 400

>Kwal_0.289
          Length = 578

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 73/188 (38%), Gaps = 23/188 (12%)

Query: 212 KWTLSQWNEYYSHTSPSDRDRIRNVISLEVSHVESFKDGIRRPNAVNNNDLVDIVWNFGR 271
           KW LS + EYY + S      + +  S     +++ ++    P  +  NDL  +      
Sbjct: 249 KWNLSFYAEYYKNNSDESPLYLFDCNS---QAIKTLRNEYATPE-IFKNDLFKLF----- 299

Query: 272 TETDIERPKVTKYILMSVGNAYTDFHLDFAGTSVYYNVISGSKKFILFPP--------TD 323
            E D+      +++++    + + FH D   TS +   ++G K +I+ PP        TD
Sbjct: 300 QEKDVHCRPDHRWLIVGPAGSGSTFHKDPNQTSAWNAGLTGKKLWIMLPPGVKPPGVSTD 359

Query: 324 YNLKK------YREWCDNDNQNDIFLGDQLEAGIAMELTEGNLFMIPCGYIHAVYTPEDS 377
            + ++        EW  +   ND     Q           G    +P G+ H V    DS
Sbjct: 360 KDEEEVTSPVGVAEWILSGYYNDAVKMAQEGKCFITVTFPGECIYVPSGWWHTVINLTDS 419

Query: 378 FIVGGNFL 385
             +  NF+
Sbjct: 420 VALTENFV 427

>AAR003W [189] [Homologous to NOHBY] complement(342591..344333)
           [1743 bp, 580 aa]
          Length = 580

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 52/118 (44%), Gaps = 16/118 (13%)

Query: 283 KYILMSVGNAYTDFHLDFAGTSVYYNVISGSKKFILFPP--------TDYNLKKY----- 329
           ++++     + + FH D   TS +  V+SG K +++ PP        TD   ++      
Sbjct: 315 RWLIAGPARSGSTFHKDPNQTSAWNAVLSGMKLWVMLPPDVAPPGVSTDKEEEEVTSPVG 374

Query: 330 -REWCDNDNQND-IFLGDQLEAGIAMELTEGNLFMIPCGYIHAVYTPEDSFIVGGNFL 385
             EW  +   ND + L  Q +  I ++     ++ +P G+ H V    DS  +  NF+
Sbjct: 375 ITEWVLSGYYNDAVNLAQQGKCRIGVQFASECIY-VPAGWWHTVINITDSVALTENFV 431

>Scas_700.37
          Length = 369

 Score = 32.7 bits (73), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 2  TSGTVKCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKL 48
          T+  V C  CK+ D  +    + VGC+ CD W H +C+ I  V  KL
Sbjct: 23 TNEAVYC-ICKRPDHGE----LMVGCDGCDDWFHFSCLKIPTVYQKL 64

>KLLA0D07260g 619630..620658 similar to sgd|S0006059 Saccharomyces
          cerevisiae YPL138c, start by similarity
          Length = 342

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 4/32 (12%)

Query: 10 FCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPI 41
           CKK D+ +    + VGC+ CD W H +C+ I
Sbjct: 26 ICKKPDTGE----LMVGCDGCDDWFHFSCLKI 53

>Kwal_26.8697
          Length = 332

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 6/36 (16%)

Query: 10 FCKKDDSEDKGQPIWVGCEFCDGWCHLTC--VPIQF 43
           CKK DS +    + VGC+ CD W H +C  VP +F
Sbjct: 27 ICKKPDSGE----LMVGCDGCDDWFHFSCLRVPQKF 58

>KLLA0F12804g complement(1180909..1182651) similar to
           ca|CA0795|IPF15641 Candida albicans unknown function,
           start by similarity
          Length = 580

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 49/118 (41%), Gaps = 16/118 (13%)

Query: 283 KYILMSVGNAYTDFHLDFAGTSVYYNVISGSKKFILFPP--------TDYNLKKY----- 329
           ++++     + + FH D   TS +   +SG K +++ PP        TD   ++      
Sbjct: 317 RWLIAGPARSGSTFHKDPNHTSAWNTGLSGMKLWVMLPPGENPPGVMTDKEEEEVTSPVG 376

Query: 330 -REWCDNDNQND-IFLGDQLEAGIAMELTEGNLFMIPCGYIHAVYTPEDSFIVGGNFL 385
             EW  +   ND + L  +    I +    G    +P G+ H+V    DS  +  NF+
Sbjct: 377 IAEWIISGYYNDAVKLAQEGRCQICVTFP-GECIYVPSGWWHSVINLTDSVALTENFV 433

>CAGL0H03641g 336494..337219 highly similar to sp|P53981
           Saccharomyces cerevisiae YNL010w, start by similarity
          Length = 241

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 188 EYLTKIMGDDYPLDVMDVQTQMNEKWTLSQWNEYYSHTSPSDRDRIRNVISLEVSHVESF 247
           + LTK++G+D  +  +D+++   E     +W   Y   SP   D+ R + + +       
Sbjct: 107 DLLTKMVGED-SIHKLDIESNEVEIKDNKEWRIIYKDESPFGHDKSRTINAYKKKFEADL 165

Query: 248 KDGIRRP 254
           KDG  RP
Sbjct: 166 KDGEERP 172

>Sklu_1701.2 YPL138C, Contig c1701 2003-3007 reverse complement
          Length = 334

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 4/32 (12%)

Query: 10 FCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPI 41
           CKK D+ D    + VGC+ CD W H  C+ I
Sbjct: 27 ICKKPDNGD----LMVGCDGCDDWFHFECLKI 54

>Scas_699.42
          Length = 885

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 9/109 (8%)

Query: 360 LFMIPCGYIHAVYTPEDSFIV-----GGNFLTLRDITTQLNVVEIEHQ-TKVPKKFTFPQ 413
           L + PCG    V   + S +V      GNF  L      + V  + ++ T  P+  T P 
Sbjct: 172 LIIDPCGTRFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPL 231

Query: 414 FESVMGKTCEWLLNSDHIQSISSEDIENLVKYLSSSN---IKYKPINYQ 459
             S+ G T + +  +  + +  +  I++ +   SSSN   +KY P  Y+
Sbjct: 232 INSIKGSTSKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYE 280

>YPL138C (SPP1) [5308] chr16 complement(291365..292426) Component
          of SET1 and COMPASS complex, may be involved in
          chromatin remodeling [1062 bp, 353 aa]
          Length = 353

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 2  TSGTVKCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTC--VPIQF 43
          T   V C  CK+ D  +    + VGC+ CD W H TC  +P QF
Sbjct: 19 TGEDVYC-ICKRPDYGE----LMVGCDGCDDWFHFTCLHIPEQF 57

>CAGL0M02255g 270614..271690 highly similar to tr|Q12461
           Saccharomyces cerevisiae YPL152w RRD2, start by
           similarity
          Length = 358

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 402 QTKVPKKFTFPQFESVMGKTCEWL--LNSDHIQSISSEDIENLVKYLSSSNIKYKPINYQ 459
           Q K   +F   +F       CE    L S H  +++SE IE L  YL  S    + I+Y 
Sbjct: 73  QDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLSIYLQESWGNKRRIDYG 132

Query: 460 SKKEL 464
           S  EL
Sbjct: 133 SGHEL 137

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,248,698
Number of extensions: 802813
Number of successful extensions: 2239
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2244
Number of HSP's successfully gapped: 29
Length of query: 471
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 366
Effective length of database: 12,961,219
Effective search space: 4743806154
Effective search space used: 4743806154
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)