Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27621g28127714650.0
Sklu_2260.235027210391e-142
Kwal_47.1815928727510251e-141
ADL087W2872499451e-129
Scas_704.433162688581e-115
YIL043C (CBR1)3222538411e-113
CAGL0L00847g2852468061e-108
Sklu_2184.23102315166e-64
KLLA0C16918g3102705132e-63
YML125C3122604983e-61
Scas_692.63142534941e-60
Kwal_33.142603082734887e-60
CAGL0B02519g3122424774e-58
YML087C3122354741e-57
AFR439C3102574626e-56
KLLA0D04488g2962444261e-50
ACR054C3062144201e-49
YKL150W (MCR1)3022224025e-47
CAGL0E06424g2982083878e-45
Scas_678.62992363833e-44
Kwal_23.54713122163834e-44
Scas_699.413181111001e-04
Sklu_2216.5620119983e-04
KLLA0E21901g357117890.003
Kwal_55.21561349145880.004
YOR037W (CYC2)366227770.10
ACR090C366221760.11
Scas_690.29688110760.14
CAGL0I00990g343107730.24
YPR003C75439710.62
YPR048W (TAH18)623103691.1
Kwal_27.12528614114681.2
Scas_718.1961677671.6
KLLA0B14476g395104661.8
AEL065C102564672.1
ACL098C65743662.2
KLLA0B12155g624136662.3
Scas_678.18686131662.4
CAGL0L07348g109646644.1
CAGL0H08580g62198644.5
CAGL0D04114g687128634.8
CAGL0F09185g22964624.9
YKR044W (UIP5)44353635.1
Kwal_55.20425103668619.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27621g
         (277 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...   568   0.0  
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                           404   e-142
Kwal_47.18159                                                         399   e-141
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...   368   e-129
Scas_704.43                                                           335   e-115
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...   328   e-113
CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...   315   e-108
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement        203   6e-64
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...   202   2e-63
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...   196   3e-61
Scas_692.6                                                            194   1e-60
Kwal_33.14260                                                         192   7e-60
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...   188   4e-58
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...   187   1e-57
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...   182   6e-56
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...   168   1e-50
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...   166   1e-49
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...   159   5e-47
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...   153   8e-45
Scas_678.6                                                            152   3e-44
Kwal_23.5471                                                          152   4e-44
Scas_699.41                                                            43   1e-04
Sklu_2216.5 YPR048W, Contig c2216 7954-9816 reverse complement         42   3e-04
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...    39   0.003
Kwal_55.21561                                                          39   0.004
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...    34   0.10 
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...    34   0.11 
Scas_690.29                                                            34   0.14 
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...    33   0.24 
YPR003C (YPR003C) [5439] chr16 complement(561499..563763) Protei...    32   0.62 
YPR048W (TAH18) [5480] chr16 (659177..661048) Protein of unknown...    31   1.1  
Kwal_27.12528                                                          31   1.2  
Scas_718.19                                                            30   1.6  
KLLA0B14476g 1271319..1272506 similar to sp|P39676 Saccharomyces...    30   1.8  
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...    30   2.1  
ACL098C [951] [Homologous to ScYKL017C (HCS1) - SH] (166422..168...    30   2.2  
KLLA0B12155g complement(1062000..1063874) similar to sgd|S000625...    30   2.3  
Scas_678.18                                                            30   2.4  
CAGL0L07348g complement(810166..813456) highly similar to sp|P15...    29   4.1  
CAGL0H08580g complement(841038..842903) highly similar to tr|Q12...    29   4.5  
CAGL0D04114g complement(406872..408935) highly similar to sp|P16...    29   4.8  
CAGL0F09185g complement(905569..906258) similar to sp|P40099 Sac...    28   4.9  
YKR044W (UIP5) [3296] chr11 (521657..522988) Member of the legum...    29   5.1  
Kwal_55.20425                                                          28   9.1  

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/277 (100%), Positives = 277/277 (100%)

Query: 1   MVPGKFIFTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFG 60
           MVPGKFIFTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFG
Sbjct: 1   MVPGKFIFTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFG 60

Query: 61  LPKSTQVLGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHF 120
           LPKSTQVLGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHF
Sbjct: 61  LPKSTQVLGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHF 120

Query: 121 AQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLV 180
           AQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLV
Sbjct: 121 AQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLV 180

Query: 181 YGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAE 240
           YGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAE
Sbjct: 181 YGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAE 240

Query: 241 GVQLLVCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQ 277
           GVQLLVCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQ
Sbjct: 241 GVQLLVCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQ 277

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score =  404 bits (1039), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 192/272 (70%), Positives = 222/272 (81%), Gaps = 1/272 (0%)

Query: 7   IFTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQ 66
           IF AT +++     +     SK  +PVL K++ Q+FPL++KTVLTHNTA+YRFGLPK T 
Sbjct: 11  IFLATVLVIAVFAIINKTLSSKSARPVLIKDQFQDFPLISKTVLTHNTAVYRFGLPKPTD 70

Query: 67  VLGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIG 126
           VLGLPIGQHIS+Q  I+GK+I+RSYTPTSLDSDA GHFELLIKSYEKGNISK   +L IG
Sbjct: 71  VLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSYEKGNISKMIGELKIG 130

Query: 127 DKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTE 186
           D+IKVRGPKGFY Y  NMN  + M+AGGTGIAPMYQI+K+I  N  DKTKV+LVYGN +E
Sbjct: 131 DRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNLQDKTKVALVYGNVSE 190

Query: 187 EDILLKKELDAFVERKPDQFKVYYLLDK-APEAWTGGVGYITVDTMKERLPAPAEGVQLL 245
           EDILLKKELDA VE  PDQFK++Y+LDK   E W GG+GY+T D MKE LPA  EGVQLL
Sbjct: 191 EDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADVMKEYLPAAGEGVQLL 250

Query: 246 VCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQ 277
           VCGPPPMVSSIKRNAV LG+E+AKPISKMGDQ
Sbjct: 251 VCGPPPMVSSIKRNAVALGFERAKPISKMGDQ 282

>Kwal_47.18159
          Length = 287

 Score =  399 bits (1025), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/275 (70%), Positives = 226/275 (82%), Gaps = 2/275 (0%)

Query: 5   KFIFTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKS 64
           K I     + L  +  V     SK  KP+L K++ QEFPLV+KTVLTHNTA+YRFGLPK 
Sbjct: 9   KTILIGGLIALGAVYFVSQLLSSKASKPILLKDEFQEFPLVSKTVLTHNTAVYRFGLPKH 68

Query: 65  TQVLGLPIGQHISVQANI-NGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQL 123
           T VLGLPIGQHIS+Q  + +GK+I+RSYTPTSLDSD+VG FELLIKSYE+GN+SK   +L
Sbjct: 69  TDVLGLPIGQHISIQGTLKDGKEIMRSYTPTSLDSDSVGFFELLIKSYEQGNVSKMIGEL 128

Query: 124 NIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGN 183
            IGDKIKVRGPKGFY Y PNMN EIGMIAGGTGIAPMYQI+KSI ++  D+TKVS++YG+
Sbjct: 129 QIGDKIKVRGPKGFYTYTPNMNSEIGMIAGGTGIAPMYQIIKSIHSDPKDRTKVSIIYGS 188

Query: 184 QTEEDILLKKELDAFVERKPDQFKVYYLLDK-APEAWTGGVGYITVDTMKERLPAPAEGV 242
           QTE+DILLKKE+DA VE  PDQFKV+YLLDK A + WTGGVGY+T + MKE LPA  +GV
Sbjct: 189 QTEDDILLKKEIDAIVESNPDQFKVHYLLDKPARDTWTGGVGYVTAEVMKEHLPAAGDGV 248

Query: 243 QLLVCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQ 277
           QLLVCGPP MVSSIKRNAV LG+EKAKPISKMGDQ
Sbjct: 249 QLLVCGPPGMVSSIKRNAVALGFEKAKPISKMGDQ 283

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score =  368 bits (945), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 208/249 (83%), Gaps = 3/249 (1%)

Query: 31  KPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKDILRS 90
           K  L+K+  QEF L+ KTVLTHNTAIYRFGLP++  VLGLPIGQHIS+   I+GK++LRS
Sbjct: 36  KTTLNKD-WQEFSLLTKTVLTHNTAIYRFGLPEADAVLGLPIGQHISISGVIDGKEMLRS 94

Query: 91  YTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGM 150
           YTPTSLDSDA G+FELL+KSYEKGNISK  A+L IGD+IKVRGPKGFYHY+PNM +EIGM
Sbjct: 95  YTPTSLDSDATGYFELLVKSYEKGNISKMLAELAIGDRIKVRGPKGFYHYEPNMYKEIGM 154

Query: 151 IAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYY 210
           IAGGTGI+PMYQI+++IF+N  DKT+V LVYGNQT++DILLK ELDA V  KPDQFK+ Y
Sbjct: 155 IAGGTGISPMYQIIRAIFSNPRDKTRVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILY 214

Query: 211 LLDKAPEA--WTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKA 268
           +LDK  E   W G +GYIT   M+E LPAP+   QLL+CGPPPMVSS KR AV+LG+EKA
Sbjct: 215 MLDKVAEGEQWEGKLGYITEAIMREHLPAPSSSAQLLLCGPPPMVSSAKRIAVSLGFEKA 274

Query: 269 KPISKMGDQ 277
           KPISK GDQ
Sbjct: 275 KPISKKGDQ 283

>Scas_704.43
          Length = 316

 Score =  335 bits (858), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 162/268 (60%), Positives = 202/268 (75%), Gaps = 2/268 (0%)

Query: 12  FVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLP 71
           F+L   I  + +  +   +K VL K    +F LV+KTVLTHNTAIY FGLP +  VLGLP
Sbjct: 45  FILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLP 104

Query: 72  IGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKV 131
           IGQHIS++ NI+GKDI+RSYTPTSLDS+  G FELL+KSY  GNISK    LNIGD+I V
Sbjct: 105 IGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINV 164

Query: 132 RGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILL 191
            GP G YHY+PN   ++GMIAGGTGIAPM+QIMK+I+ N  D T+V+L+YGN  E DILL
Sbjct: 165 CGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILL 224

Query: 192 KKELDAFVERKPDQFKVYYLLDKAP-EAWTGGVGYITVDTMKERLPAP-AEGVQLLVCGP 249
           +KELD  V+ +PDQFKV YLLDK   + W G +GY+T+D M++ +P+P  EGVQ+L+CGP
Sbjct: 225 RKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGP 284

Query: 250 PPMVSSIKRNAVTLGYEKAKPISKMGDQ 277
           P MV S KRNAVT+GY + KP+SKM DQ
Sbjct: 285 PRMVGSAKRNAVTMGYARGKPLSKMEDQ 312

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score =  328 bits (841), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 159/253 (62%), Positives = 194/253 (76%), Gaps = 4/253 (1%)

Query: 29  KDKPVLD--KEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKD 86
           K KPVLD  +   Q FPLV KT+LTHNT++Y+FGLP +  VLGLPIGQHI ++ANINGKD
Sbjct: 66  KTKPVLDPKRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKD 125

Query: 87  ILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNE 146
           I RSYTPTSLD D  G+FELL+KSY  GN+SK   +L IGD I+++GP+G YHY+ N   
Sbjct: 126 ITRSYTPTSLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRS 185

Query: 147 EIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQF 206
            +GMIAGGTGIAPMYQIMK+I  +  D TKVSLV+GN  EEDILLKKEL+A V  KP QF
Sbjct: 186 HLGMIAGGTGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQF 245

Query: 207 KVYYLLDKAP-EAWTGGVGYITVDTMKERLPAPA-EGVQLLVCGPPPMVSSIKRNAVTLG 264
           K+ Y LD    E WTGGVGYIT D +KE LPA   + VQ+L+CGPP MV+S++R+ V LG
Sbjct: 246 KIVYYLDSPDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLG 305

Query: 265 YEKAKPISKMGDQ 277
           + ++KP+SKM DQ
Sbjct: 306 FRRSKPLSKMEDQ 318

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score =  315 bits (806), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 152/246 (61%), Positives = 190/246 (77%), Gaps = 3/246 (1%)

Query: 34  LDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKDILRSYTP 93
           L K + +EF LV K  LTHNTA Y+F L   + VLGLPIGQHI+V+  I GK + RSYTP
Sbjct: 37  LLKTEFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTP 96

Query: 94  TSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAG 153
           TSLD + VG FELL+KSY +GNISKH   + IG+KI + GP+GFY Y PN+++ + M+AG
Sbjct: 97  TSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAG 156

Query: 154 GTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLD 213
           GTGI PM+QIMK+I  + SDKT+V+L+YGN  EEDILLK+ELD  V+++PDQFK+ YLLD
Sbjct: 157 GTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLD 216

Query: 214 KAPEA--WTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKAKPI 271
           K PE   W GGVGY+T+D MKE  P+  E VQLLVCGPP MVSS+KRNAV LG+ +AKP+
Sbjct: 217 K-PERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPV 275

Query: 272 SKMGDQ 277
           SKM D+
Sbjct: 276 SKMEDR 281

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score =  203 bits (516), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 99/231 (42%), Positives = 150/231 (64%), Gaps = 2/231 (0%)

Query: 47  KTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFEL 106
           + +++ N+AIYRF L  S + L +P+G H++V+  I GK+ +R YTP +   D  GHF++
Sbjct: 78  QILISKNSAIYRFKLKTSLETLKIPVGHHLAVKIPIEGKNEIRYYTPITQRYDT-GHFDI 136

Query: 107 LIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKS 166
           ++KSY  G +SK+FA L  G  ++ +GP G ++Y  N ++ IGMIAGG+GI PM Q++  
Sbjct: 137 IVKSYTDGKVSKYFASLKPGQLVEFQGPVGRFNYATNSSKAIGMIAGGSGITPMLQVLSQ 196

Query: 167 IFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYI 226
           I     D TKVSL+Y N+TE DILLK ELD   ++ P+ F+V+Y+L K    WTG  GY+
Sbjct: 197 IVTTPEDTTKVSLIYANETENDILLKDELDEMADKYPN-FEVHYVLHKPSPGWTGDTGYV 255

Query: 227 TVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQ 277
           T D M++ LP P++  +LL+CGP  M++ +   +  LG+ +    SK  DQ
Sbjct: 256 TKDQMQKYLPGPSDENRLLICGPLAMINMLLNYSEELGWPRGIVKSKPDDQ 306

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score =  202 bits (513), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 104/270 (38%), Positives = 162/270 (60%), Gaps = 3/270 (1%)

Query: 8   FTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQV 67
           F   FV+L  I+A  +     + K +   ++     L  +T+++ NTAIYRF L  S + 
Sbjct: 40  FLLGFVILGAILAYRMVVARSRLKSIY-SDRWTALELEDQTIVSKNTAIYRFKLKTSLEC 98

Query: 68  LGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGD 127
           L +P G H++V+  +  KD +R YTP S +    GHF++++KSY  G +SK+FA L  G 
Sbjct: 99  LDIPTGHHLAVRIPLEDKDEIRYYTPIS-NKFETGHFDIMVKSYADGQVSKYFASLRPGQ 157

Query: 128 KIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEE 187
            +  +GP G + Y+ N ++ IGMIAGG+G+ PM Q++ +I    +D T+V+L+Y N+TE 
Sbjct: 158 TVDFKGPVGRFAYEANSSKHIGMIAGGSGLTPMLQVLNTIITTPTDLTRVTLLYANETEN 217

Query: 188 DILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVC 247
           DILLK ELD   E+ P+ F V+YL++    +W G VG++T + M + LP P+   +LL+C
Sbjct: 218 DILLKDELDEISEKYPN-FLVHYLVNHPSSSWQGEVGWVTKEIMSKYLPDPSAENRLLIC 276

Query: 248 GPPPMVSSIKRNAVTLGYEKAKPISKMGDQ 277
           G P M  ++ + A  LG+ K    S   DQ
Sbjct: 277 GKPEMKKTLLKYAEELGWPKGILKSNPDDQ 306

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score =  196 bits (498), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 156/260 (60%), Gaps = 2/260 (0%)

Query: 18  IIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHIS 77
           +I  V  Y + K +  L  ++     L  +T+++ NTA+YRF L    + L +P G H++
Sbjct: 51  MIIFVRAYSAYKRRRSLYPDRWTSLELEDQTIISKNTALYRFKLKTRLESLDIPAGHHVA 110

Query: 78  VQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGF 137
           V+  I+GK  +R Y P S   ++ G+ +L++K+Y  G +SK+FA LN GD +  +GP G 
Sbjct: 111 VRVPIDGKQEVRYYNPISSKLES-GYLDLVVKAYVDGKVSKYFAGLNSGDTVDFKGPIGT 169

Query: 138 YHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDA 197
            +Y+PN ++ +G++AGG+GI P+ QI+  I     D TKVSL+Y N+TE DILLK ELD 
Sbjct: 170 LNYEPNSSKHLGIVAGGSGITPVLQILNEIITVPEDLTKVSLLYANETENDILLKDELDE 229

Query: 198 FVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIK 257
             E+ P  F+V+Y++    + WTG VGYIT D M   LP  +E  +LL+CGP  M +   
Sbjct: 230 MAEKYP-HFQVHYVVHYPSDRWTGDVGYITKDQMNRYLPEYSEDNRLLICGPDGMNNLAL 288

Query: 258 RNAVTLGYEKAKPISKMGDQ 277
           + A  LG++     S   DQ
Sbjct: 289 QYAKELGWKVNSTRSSGDDQ 308

>Scas_692.6
          Length = 314

 Score =  194 bits (494), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 101/253 (39%), Positives = 156/253 (61%), Gaps = 2/253 (0%)

Query: 25  YQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANING 84
           Y + + K  L  ++     L  +TV++ NTA+YRF L  + + L +P G HI+V+  I+ 
Sbjct: 60  YMAHQRKRSLFPDRWTSLELDDQTVVSKNTALYRFKLKTNLESLDIPAGYHIAVRVFIDD 119

Query: 85  KDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNM 144
           K+ +R Y P S   D  GHF+LLIKSY  G +SK+FA L  GD ++ +GP G  HY PN 
Sbjct: 120 KEEIRYYNPISSKLDT-GHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHYAPNS 178

Query: 145 NEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPD 204
           ++ +G++AGG+GI P+ Q++  I     D TK+SL+Y N TE DILLK ELD   E+ P 
Sbjct: 179 SKALGIVAGGSGITPVLQMLNEIITVPEDLTKLSLIYANDTENDILLKDELDEMSEKYP- 237

Query: 205 QFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLG 264
            F+V+Y++    E+W G VG ++ + M++ LP  ++  +LL+CGP  M   + + A  LG
Sbjct: 238 HFEVHYVVRNPSESWEGDVGLVSKEQMEKYLPKYSDDHRLLICGPEAMEKMVVKYAEELG 297

Query: 265 YEKAKPISKMGDQ 277
           ++++   +K  DQ
Sbjct: 298 WKQSVSKNKGDDQ 310

>Kwal_33.14260
          Length = 308

 Score =  192 bits (488), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 103/273 (37%), Positives = 159/273 (58%), Gaps = 5/273 (1%)

Query: 5   KFIFTATFVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKS 64
           KF++   F  +      +  Y+ +K    +  +K     L  +T+L+ NTA+YRF +  S
Sbjct: 37  KFLWILPFAAVIVGFRFLTAYKRRKS---VFPDKWSALELEDQTLLSKNTAMYRFKMKTS 93

Query: 65  TQVLGLPIGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLN 124
            + L  P+G H++V+  I+GKD +R YTP S      G+F++++KSY  G +SK+FA L 
Sbjct: 94  FETLNFPVGHHLAVRVPIDGKDQIRYYTPVSPQYQP-GYFDIIVKSYADGQVSKYFAGLK 152

Query: 125 IGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQ 184
            G  +  +GP G ++Y  N  ++IGMIAGG+GI PM QI+  I     D TKVSL+Y N+
Sbjct: 153 AGSAVDFKGPVGRFNYVVNSYKQIGMIAGGSGITPMLQILNKIITTPEDLTKVSLIYANE 212

Query: 185 TEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQL 244
           TE DILLK+E+D   E+ P+ F+V+Y+L      W G VG +T + M++ LP  +   +L
Sbjct: 213 TENDILLKEEIDEIAEKYPN-FEVHYVLRTPSSTWKGDVGLVTNELMQKYLPISSSDNRL 271

Query: 245 LVCGPPPMVSSIKRNAVTLGYEKAKPISKMGDQ 277
           ++ G P M+  +   A  LG+ K    SK  D+
Sbjct: 272 VMSGKPEMIRMLLEYAEELGWPKGIEKSKGDDR 304

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score =  188 bits (477), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 147/242 (60%), Gaps = 2/242 (0%)

Query: 25  YQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANING 84
           + + K +  L  +K     L  +T+++ NTAIYRF L    + + +P G H+ V+  I+G
Sbjct: 58  FAAFKRRRSLYPDKWTSLELEDQTLISRNTAIYRFKLKTPLETIDIPSGHHVQVRVFIDG 117

Query: 85  KDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNM 144
           K+ +R+Y P S   +  GH +LL+KSY+ G +SK+FA +  G+ +  RGP G   Y+PN 
Sbjct: 118 KEEVRNYNPISTRFEK-GHIDLLVKSYKDGKVSKYFASMKPGETVDFRGPVGSLVYKPNT 176

Query: 145 NEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPD 204
            + IGM+ GG+GI P  Q++  I     D TK+SL+Y N+TE+DILLK+ELD   E+ P 
Sbjct: 177 YKNIGMVCGGSGITPALQMLNDIITVPEDLTKLSLIYCNETEKDILLKEELDEMAEKYP- 235

Query: 205 QFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLG 264
            F V+Y++ +    W G VG+I+ +TM + LP PA+  +LL+CGP      +   A  +G
Sbjct: 236 HFNVHYIVSQPTGQWEGEVGHISKETMVKHLPHPADDSRLLICGPEGFTQKVFDQAKEIG 295

Query: 265 YE 266
           ++
Sbjct: 296 WK 297

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score =  187 bits (474), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 92/235 (39%), Positives = 145/235 (61%), Gaps = 2/235 (0%)

Query: 34  LDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANINGKDILRSYTP 93
           L + K    PL  KT ++ NT++Y F L    + L +P+G H++V+  ING+ ++R YTP
Sbjct: 67  LYRNKWVALPLSKKTRISRNTSLYCFKLKYPFERLHIPMGYHLAVRVTINGERLVRYYTP 126

Query: 94  TSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAG 153
            ++  +  GH EL++K+Y+ G +SK+F +L I   ++ +GP G   Y  +   E+G+IAG
Sbjct: 127 VNV-PNTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFKGPLGELEYDQDTATELGIIAG 185

Query: 154 GTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLD 213
           G+GI P+ Q+++ I  +  D T +SL+Y N+TE+DIL+K +LD   +  P  FKV+Y++ 
Sbjct: 186 GSGITPVLQVLQEIIPSPEDLTHISLIYANETEDDILMKSQLDHMAKEYP-HFKVHYVIH 244

Query: 214 KAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKA 268
           K    W G VGY+T++ MK  LP  AE  +LL+CGPP M   +   A  LG+   
Sbjct: 245 KPNGKWNGDVGYVTLEEMKRYLPKQAEDHRLLICGPPKMNEMVLNYAKELGWSNG 299

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score =  182 bits (462), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 149/257 (57%), Gaps = 5/257 (1%)

Query: 21  VVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQA 80
           ++L Y+S+    +L  E      L  + VL+ N AIYRF L  S + L +P G H++ + 
Sbjct: 55  LLLAYRSRTS--ILPNE-WTPLELEERIVLSKNAAIYRFKLRSSVETLDIPTGFHLAAKV 111

Query: 81  NINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHY 140
            ++G + +R YTP S +  A GHF++++KSY  G +SK FA L  G  ++ +GP G + Y
Sbjct: 112 MLDGVEEVRYYTPIS-NKFAEGHFDIIVKSYVDGKVSKWFAGLQPGQTVEFKGPVGRFSY 170

Query: 141 QPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVE 200
             N  ++IGM+ GG+ I PM  ++  I     D T+V L+Y N+TE DILLK ELD    
Sbjct: 171 VTNAYKKIGMVTGGSAITPMLSVLNKIVTTPEDTTQVCLIYANETENDILLKDELDDLAS 230

Query: 201 RKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNA 260
           + P+ F+V+Y++ K   +WTG VGY+T   +++ LP      +LL+CGPP M   +   A
Sbjct: 231 KYPN-FEVHYVVRKPSASWTGEVGYVTKQHLEKYLPPCNPAHRLLICGPPKMKQMVLEYA 289

Query: 261 VTLGYEKAKPISKMGDQ 277
             LG+ K    SK  DQ
Sbjct: 290 EQLGWPKGAMKSKPEDQ 306

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score =  168 bits (426), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 90/244 (36%), Positives = 132/244 (54%), Gaps = 4/244 (1%)

Query: 15  LCTIIAVVLEYQSKKD--KPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPI 72
           + T I +   Y    D  K  L   +  + P++    L+H+T  + F LPK  QV GL  
Sbjct: 23  IATAIILQRNYSIMNDTSKAFLGDNEWIDLPIIKIEKLSHDTKRFTFALPKKDQVSGLIT 82

Query: 73  GQHISVQ-ANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKV 131
              I  +     G +++R YTP S D+   G  EL++K YE G  + H   L   D +  
Sbjct: 83  ASCILAKFVTPKGSNVIRPYTPVS-DNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSF 141

Query: 132 RGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILL 191
           +GP   + ++PN  + I ++  GTGI P+YQ++  I  N  D TK+ L YGN+T EDILL
Sbjct: 142 KGPITKWEWKPNSYDSITLLGAGTGINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDILL 201

Query: 192 KKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPP 251
           K ELD   ++ PDQ K+ Y +DKA   + G  G+IT D +  + P P+E  Q+ VCGPPP
Sbjct: 202 KSELDNLQKKYPDQVKITYFVDKAEGNFEGETGFITKDYLSHQAPKPSEKNQVFVCGPPP 261

Query: 252 MVSS 255
            + +
Sbjct: 262 FMKA 265

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score =  166 bits (420), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 123/214 (57%), Gaps = 2/214 (0%)

Query: 50  LTHNTAIYRFGLPKSTQVLGLPIGQHISVQ-ANINGKDILRSYTPTSLDSDAVGHFELLI 108
           ++H+T  + F LP    V GL     +  +     G +++R YTP S D+ A G F+L+I
Sbjct: 70  VSHDTRRFTFALPSQDHVTGLTTASALLAKYVTPKGSNVIRPYTPVS-DNMARGMFQLVI 128

Query: 109 KSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIF 168
           K Y+ G  + H   L   D ++ +GP   + + PNM + I ++  GTGI P++Q+M  I 
Sbjct: 129 KHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWDPNMFDSIVLMGAGTGITPLFQMMHHIA 188

Query: 169 ANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITV 228
            N +D TKV L+YGN+T +DILL+KEL+    + PDQ KV Y +DK    + G  G+IT 
Sbjct: 189 ENPTDNTKVHLLYGNKTPQDILLRKELEELASKYPDQVKVTYFVDKPEGDYKGEKGFITK 248

Query: 229 DTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVT 262
           D +K+ LP P     + VCGPPP + +   N V+
Sbjct: 249 DFLKQNLPTPGSNSHIFVCGPPPFMDAFSGNKVS 282

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score =  159 bits (402), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 129/222 (58%), Gaps = 4/222 (1%)

Query: 37  EKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQ-ANINGKDILRSYTPTS 95
           +K  + P+      +H+T  + F LP     +GL +   +  +     G +++R YTP S
Sbjct: 51  DKWIDLPISKIEEESHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVS 110

Query: 96  LDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGT 155
            D    GHF+L++K YE G ++ H   L   D +  +GP   + +QPN  + I ++  GT
Sbjct: 111 -DLSQKGHFQLVVKHYEGGKMTSHLFGLKPNDTVSFKGPIMKWKWQPNQFKSITLLGAGT 169

Query: 156 GIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLL--D 213
           GI P+YQ+   I  N +DKTKV+L+YGN+T +DILL+KELDA  E+ PD+F V Y +   
Sbjct: 170 GINPLYQLAHHIVENPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDK 229

Query: 214 KAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSS 255
           +  + + G + +I+ D ++E +P P E   L VCGPPP +++
Sbjct: 230 QDDQDFDGEISFISKDFIQEHVPGPKESTHLFVCGPPPFMNA 271

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score =  153 bits (387), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 118/208 (56%), Gaps = 3/208 (1%)

Query: 51  THNTAIYRFGLPKSTQVLGLPIGQHISVQ-ANINGKDILRSYTPTSLDSDAVGHFELLIK 109
           +H+T  + F LP    V GL +   +  +     G  ++R YTP S D    G+ E +IK
Sbjct: 62  SHDTKRFFFKLPTDDSVSGLTLASAVLTKFMTPKGNPVIRPYTPVS-DLSEKGYIEFVIK 120

Query: 110 SYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFA 169
            YE G ++ H  QL   D +  +GP   + ++PN  + I ++ GGTGI P+YQ++  I  
Sbjct: 121 HYEGGKMTDHLFQLKPKDTLAFQGPIPKWQWKPNSFDTITLLGGGTGITPLYQLVHHITQ 180

Query: 170 NDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEA-WTGGVGYITV 228
           N  DKTK++L YG++T  DILLKKELD   ++ P+Q  + Y +DK     + G  G+IT 
Sbjct: 181 NKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGKFDGNKGFITK 240

Query: 229 DTMKERLPAPAEGVQLLVCGPPPMVSSI 256
           D + +  P P E  Q+ VCGPPP + S+
Sbjct: 241 DFLAKNAPGPKEKTQVFVCGPPPFMDSL 268

>Scas_678.6
          Length = 299

 Score =  152 bits (383), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 84/236 (35%), Positives = 123/236 (52%), Gaps = 11/236 (4%)

Query: 41  EFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQ-ANINGKDILRSYTPTSLDSD 99
           + P+V     +H+T  + F LP    + GL +   I  +     G +++R YTP S   D
Sbjct: 52  DLPIVKIEDESHDTKRFTFKLPSEDAITGLTLASAIFTKYVTAKGNNVVRPYTPVS-PLD 110

Query: 100 AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAP 159
             G FEL+IK Y  G +S H   L   D +  +GP   + + PN  + I ++  GTG  P
Sbjct: 111 QQGTFELVIKHYNDGKMSSHLFSLKPNDVVSFKGPIKKWQWVPNSFKSITLLGAGTGTTP 170

Query: 160 MYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAW 219
           +YQ+   I  N  DKTK+++ YGN+T  DILLKKE +   E+ PDQ KV Y +DK  +  
Sbjct: 171 LYQLASHIARNPEDKTKINVFYGNKTSSDILLKKEWNELQEKYPDQVKVTYFVDKLDDGK 230

Query: 220 TGGV--GYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKAKPISK 273
             GV  G+I+ + + +  P P E   L +CGPPP + +          EKAKP  +
Sbjct: 231 ENGVELGFISKEFIAKNAPGPKEDTHLFICGPPPFMKAYSG-------EKAKPTDQ 279

>Kwal_23.5471
          Length = 312

 Score =  152 bits (383), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 76/216 (35%), Positives = 124/216 (57%), Gaps = 2/216 (0%)

Query: 41  EFPLVAKTVLTHNTAIYRFGLPKSTQVLGLPIGQHISVQANI-NGKDILRSYTPTSLDSD 99
           E P+     ++H+T  + F LP+  QV GL     +  +     G +++R YTP S D  
Sbjct: 67  ELPIAKIEDVSHDTRRFVFSLPQEDQVSGLITASALLAKLQTPKGSNVIRPYTPVS-DVS 125

Query: 100 AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAP 159
             GH E +IK Y+ G +++        D +  +GP   + ++PN  + I +I  G+GI P
Sbjct: 126 TKGHIEFVIKHYKGGKMTEMLFDKKPSDTVAFKGPIIKWEWKPNSFDSITLIGAGSGITP 185

Query: 160 MYQIMKSIFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAW 219
           +YQ++  I  N  DKTK+ L+YGN+T  DILLKKEL+    +  DQ K+++ +DKA   +
Sbjct: 186 LYQLLHHISQNPEDKTKIHLLYGNKTPNDILLKKELEEVQAKYADQVKIHFFVDKAEGPF 245

Query: 220 TGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSS 255
            G +G+IT + +++ +P  +E  Q+ VCGPPP + +
Sbjct: 246 DGEIGFITKEFLEKNVPKASEKNQVFVCGPPPFMQA 281

>Scas_699.41
          Length = 318

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 48/111 (43%), Gaps = 15/111 (13%)

Query: 87  ILRSYTPTSL-------------DSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRG 133
           ++R+YTP  L             D +  G     +K Y  G +++   +L +   +++RG
Sbjct: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160

Query: 134 PKGFYHYQPNMNE--EIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYG 182
           P   Y +Q   N   ++ M   G G+   +Q++ S  + +  +  V L + 
Sbjct: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHS 211

>Sklu_2216.5 YPR048W, Contig c2216 7954-9816 reverse complement
          Length = 620

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 60/119 (50%), Gaps = 8/119 (6%)

Query: 100 AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAP 159
           AV  +  +++   KG  + +   L+  DKI+ +  + F        + I MI+ G G+AP
Sbjct: 428 AVVKYRTILRRIRKGLCTDYIISLSGNDKIRYKLQRNFLLNSSMKGKPIIMISPGVGLAP 487

Query: 160 MYQIMKSIFANDSDKTKVSLVYGNQTE-EDILLKKELDAFVERKPDQFKVYYLLDKAPE 217
           M  +++S F  D     + L +GN+ + +D L +++L+ + +   +  K+Y    + P+
Sbjct: 488 MMSLIRSGFFED-----MHLFFGNRIKSKDFLYREDLEKWND--SNIIKLYTCFSRDPQ 539

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 46/117 (39%), Gaps = 43/117 (36%)

Query: 87  ILRSYTPTSL-------------DSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRG 133
           ++RSYTP  L             + +A G     IK Y++G +++    L +G  +++RG
Sbjct: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175

Query: 134 P---------------------------KGFYHYQPNMNEEIGMIAGGTGIAPMYQI 163
           P                           K  Y YQP    +I    GGTGI P+ Q+
Sbjct: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQPF---DILFFTGGTGIVPLLQM 229

>Kwal_55.21561
          Length = 349

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 61/145 (42%), Gaps = 39/145 (26%)

Query: 62  PKSTQVLGLPIGQHI-SVQANINGKDILRSYTPTSLDSDAVGHFELL------------- 107
           P+ST +  L     + SVQ       ++R+YTP  L     G F++L             
Sbjct: 83  PQSTNMWALMKSDKLWSVQVKQPEIMVVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFY 142

Query: 108 IKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNE--------------------- 146
           +K Y+ G +++  ++L  G  +++RGP   Y + P+M+                      
Sbjct: 143 LKKYQYGEVARWLSRLPEGHILELRGPYIDYEF-PSMDNGEKLDRSFLWGAKPSSDKLMI 201

Query: 147 ---EIGMIAGGTGIAPMYQIMKSIF 168
              +I     GTGIAP+ Q++ + F
Sbjct: 202 QPFDISAFTAGTGIAPIMQLLLTEF 226

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 83/227 (36%), Gaps = 63/227 (27%)

Query: 87  ILRSYTPTSL-------------DSD-AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVR 132
           ++R+YTP  L             D D A G     IK YE G +++    L  G  I++R
Sbjct: 116 VVRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIR 175

Query: 133 GP---KGFYH------------YQPNMNE----------------EIGMIAGGTGIAPMY 161
           GP     F H            Y  N NE                +I M   GTGI    
Sbjct: 176 GPFIDYEFPHLPNELKRSRDCLYMDNRNERGNNVRENSQFIYQPYDIMMFTAGTGIVTAL 235

Query: 162 QIMKS---------IFANDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLL 212
           Q++ +         +F  D +  ++  +Y          + +L  F   +  +  V   +
Sbjct: 236 QLLLTESPFRGTIKLFHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDRQTKQDVLKSI 295

Query: 213 DKA---PEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSI 256
            K+   P  + G + +  V+  K  +P  A     LVCGP   +SSI
Sbjct: 296 QKSITKPYPYKGLLPFSNVNN-KNIMPVLA-----LVCGPESYISSI 336

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 84/221 (38%), Gaps = 59/221 (26%)

Query: 87  ILRSYTPTSLDSD--------------AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVR 132
           ++R YTP  L +D                G   L IK Y  G +++   +L  G  ++VR
Sbjct: 124 VVRQYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVR 183

Query: 133 GPKGFYHYQPNMNE-------------------------EIGMIAGGTGIAPMYQIMKSI 167
           GP   + + P ++                          +I + A GTGI    Q++ + 
Sbjct: 184 GPYPEFEF-PELDADTKRDREFSGRGRACVAAAARAGPFDIALFAAGTGIVTALQLLTT- 241

Query: 168 FANDSDKTKVSLVYGNQTEEDI-----LLKK-------ELDAFVERKPDQFKVYYLLDKA 215
              D  K K+ L Y  ++   +     LL++       +L  F   K +  ++   L K 
Sbjct: 242 --EDPFKGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLG--LSKI 297

Query: 216 PEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSI 256
            +  +G   +      ++R    AE V  LVCGP   ++ I
Sbjct: 298 SDLVSGPFPFSENAPFEQR--PKAEPVLSLVCGPDDYIAFI 336

>Scas_690.29
          Length = 688

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 12/110 (10%)

Query: 148 IGMIAGGTGIAP----MYQIMKSIFANDSDKT--KVSLVYGNQTEEDILLKKELDAFVER 201
           I M+  GTG+AP    + + +K +  N+ + T  K  L YG++  +D L K+E   + E+
Sbjct: 536 IIMVGPGTGVAPFRAFIRERVKFLETNNDNLTLGKHLLFYGSRNHDDFLYKEEWPIYAEK 595

Query: 202 KPDQFKV---YYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCG 248
             D F++   +  LD   + +   V +   +  +E     ++G  + VCG
Sbjct: 596 LGDSFEMIVAHSRLDPGKKVY---VQHNLKERSEEVFQLISQGAFIYVCG 642

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 31/107 (28%)

Query: 87  ILRSYTPTSLD------------SDAVGHFELL--IKSYEKGNISKHFAQLNIGDKIKVR 132
           ++R+YTP  L             +D V   +LL  IKSY  G +++    L +G  +++R
Sbjct: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179

Query: 133 GPKGFYHYQPNMNEE-----------------IGMIAGGTGIAPMYQ 162
           GP   Y ++ ++++                  +   AGGTGI    Q
Sbjct: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQ 226

>YPR003C (YPR003C) [5439] chr16 complement(561499..563763) Protein
           with similarity to Sul1p, member of the sulfate permease
           family of membrane transporters [2265 bp, 754 aa]
          Length = 754

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 94  TSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKVR 132
           TS+DS A    E +I SY++ N+  +   ++I DK++ R
Sbjct: 640 TSIDSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRR 678

>YPR048W (TAH18) [5480] chr16 (659177..661048) Protein of unknown
           function, has similarity to NAPDH-cytochrome P450
           reductases [1872 bp, 623 aa]
          Length = 623

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/103 (17%), Positives = 54/103 (52%), Gaps = 6/103 (5%)

Query: 100 AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAP 159
           A+  ++ +++   +G  + + A+L  G++I+ +        +  +N+ + ++  G G+AP
Sbjct: 431 AIVKYKTILRKIRRGICTNYIARLQEGEQIRYKLQNNHIIKKEFLNKPMILVGPGVGLAP 490

Query: 160 MYQIMKSIFANDSDKTKVSLVYGNQ-TEEDILLKKELDAFVER 201
           +  ++K+  + D     + L++G +  ++D + K  L+ +  +
Sbjct: 491 LLSVVKAEISKD-----IKLLFGCRYKDKDYIYKDMLEDWFRK 528

>Kwal_27.12528
          Length = 614

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 90  SYTPTSLDSD---AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNE 146
           S  P+S++ +   A+  ++ +++   +G  + +   L  GD ++    +     +P M  
Sbjct: 409 SSAPSSIEVELTVAIVKYKTILRKIRRGLCTDYLQGLKEGDNVRYALQRNRL-LKPKMKS 467

Query: 147 EIG-MIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQ-TEEDILLKKELDAF 198
               +I+ G G+APM  ++KS F  +       L +GN+  E+D L + +L  +
Sbjct: 468 RPAILISPGVGLAPMRCLIKSDFFEEP-----HLFFGNRFKEKDFLYQDDLQNW 516

>Scas_718.19
          Length = 616

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 10/77 (12%)

Query: 100 AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGP-----KGFYHYQPNMNEEIGMIAGG 154
           A+  +  +++   KG  + + A L  GD ++ +       +  YH +P +     +++ G
Sbjct: 424 AIVKYRTILRKIRKGVCTDYIAHLKEGDHLRYKIQHNNLVRDNYHGRPMI-----LVSPG 478

Query: 155 TGIAPMYQIMKSIFAND 171
            GIAP+  I+K+  + D
Sbjct: 479 VGIAPLMSIVKAKLSED 495

>KLLA0B14476g 1271319..1272506 similar to sp|P39676 Saccharomyces
           cerevisiae YGR234w YHB1 flavohemoglobin singleton, start
           by similarity
          Length = 395

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 54/104 (51%), Gaps = 11/104 (10%)

Query: 73  GQHISVQAN----INGKDILRSYTPTSLDSDAVGHFELLIKSYEK--GNISKHFAQ-LNI 125
           GQ+++V+ +     N  D LR Y+  S  ++    F +  +  E+  G +S++  + +N+
Sbjct: 187 GQYLTVKTHPTTHDNEYDALRHYSICSESTEDGLKFAVKYEHGEEQDGLVSEYMHKFINV 246

Query: 126 GDKIKVRGPKGFYHYQPNM--NEEIG--MIAGGTGIAPMYQIMK 165
           GD+I++  P G +     +   EE+   +I+ G G  P+  +++
Sbjct: 247 GDQIELSAPAGDFEMNKELIKQEEVPLVLISAGVGATPLVAMLE 290

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 3/64 (4%)

Query: 213 DKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPPPMVSSIKRNAVTLGYEKAKPIS 272
           D +   WTG  G       K R PA +    +   G PP  ++    A T+  E A+ ++
Sbjct: 908 DVSTPTWTGKFGQAGRVKKKRRQPATSSAAIITALGNPPPATT---PASTMSEEHARSLA 964

Query: 273 KMGD 276
           +M D
Sbjct: 965 QMRD 968

>ACL098C [951] [Homologous to ScYKL017C (HCS1) - SH]
           (166422..168395) [1974 bp, 657 aa]
          Length = 657

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 20/43 (46%)

Query: 208 VYYLLDKAPEAWTGGVGYITVDTMKERLPAPAEGVQLLVCGPP 250
           +  L D+       G   I VDT+ ERL  P  G +LL  G P
Sbjct: 222 IRQLYDRGHRVLVCGPSNIAVDTVLERLSRPIPGAELLRVGHP 264

>KLLA0B12155g complement(1062000..1063874) similar to sgd|S0006252
           Saccharomyces cerevisiae YPR048w TAH18, start by
           similarity
          Length = 624

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/136 (20%), Positives = 60/136 (44%), Gaps = 15/136 (11%)

Query: 89  RSYTPTSLDSD-------AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQ 141
           R Y+ +S  SD       A+  ++ L++   KG  + +   L   D ++ +       ++
Sbjct: 414 RFYSISSAPSDPNVELTIAIVRYKTLLRKVRKGLCTNYLLTLTENDTVRYKLQNNHLLHE 473

Query: 142 PNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQT-EEDILLKKELDAFVE 200
             + + I M + G G+APM  +++S    D       L +GN+  ++D L +  L  +  
Sbjct: 474 DIIGKPIIMTSPGVGLAPMKCLIESNLFKDQ-----YLFFGNRMKDKDFLYEDTLSMW-- 526

Query: 201 RKPDQFKVYYLLDKAP 216
           +K  +  ++    + P
Sbjct: 527 KKEGKINLFTCFSRDP 542

>Scas_678.18
          Length = 686

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 15/131 (11%)

Query: 128 KIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKS-IFANDSDKT----KVSLVYG 182
           K+ +   K  +    N +  + MI  GTG+AP    ++  +   +SD++    K  L YG
Sbjct: 509 KLPIHVRKSTFRLPTNPSAPVIMIGPGTGVAPFRGFVRDRVNLLESDRSIKLGKHLLFYG 568

Query: 183 NQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITV-DTMKER----LPA 237
            + E+D L ++E   +     + F++     + P     G   I V D ++E+       
Sbjct: 569 CRNEDDYLYREEWIQYATILGESFEMNVAFSRVP-----GTPKIYVQDKLREQSKLIWQL 623

Query: 238 PAEGVQLLVCG 248
             +G  L VCG
Sbjct: 624 IQDGAFLYVCG 634

>CAGL0L07348g complement(810166..813456) highly similar to sp|P15436
           Saccharomyces cerevisiae YDL102w CDC2 DNA-directed DNA
           polymerase delta, hypothetical start
          Length = 1096

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 9/46 (19%)

Query: 178 SLVYGNQTEEDILLKKELDAFVERKPD--------QFKVYYLLDKA 215
           S V+ N+TEED LL+K  D  ++  PD         F + YLL++A
Sbjct: 370 SQVFDNETEED-LLRKWRDFIIQVDPDVIIGYNTTNFDIPYLLNRA 414

>CAGL0H08580g complement(841038..842903) highly similar to tr|Q12181
           Saccharomyces cerevisiae YPR048w TAH18, hypothetical
           start
          Length = 621

 Score = 29.3 bits (64), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 49/98 (50%), Gaps = 6/98 (6%)

Query: 100 AVGHFELLIKSYEKGNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAP 159
           A+  ++ +++    G  +   ++L +GDKI+ +  +     +   +    M+  G G+AP
Sbjct: 429 AIVKYKTILRKIRTGVCTDFISKLKVGDKIRYKIQQNDLIKEEYRSNPFVMVGPGVGLAP 488

Query: 160 MYQIMKSIFANDSDKTKVSLVYGNQ-TEEDILLKKELD 196
           +   ++S  +      ++SL +G +  ++D L  KEL+
Sbjct: 489 LLSAVRSKVS-----PEMSLYFGCRFKDKDYLHGKELE 521

>CAGL0D04114g complement(406872..408935) highly similar to sp|P16603
           Saccharomyces cerevisiae YHR042w NCP1 NADPH-cytochrome
           P450 reductase, hypothetical start
          Length = 687

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 53/128 (41%), Gaps = 5/128 (3%)

Query: 126 GDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSI--FANDSDKTKVS---LV 180
           G K+ V   +  +    N +  + MI  GTG+AP    ++    F    +  ++    L 
Sbjct: 514 GYKLPVHVRRSTFRLPTNPSTPVIMIGPGTGVAPFRGFVRERVKFVEQQENVQLGKHLLF 573

Query: 181 YGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGGVGYITVDTMKERLPAPAE 240
           YG++  +D L ++E   + ++    F++     + P      V     +  +E L    E
Sbjct: 574 YGSRNTDDYLYREEWPEYAKKLGASFEMIVGHSRIPGQPKVYVQDKIREHAQEVLKLIHE 633

Query: 241 GVQLLVCG 248
           G  L +CG
Sbjct: 634 GAFLYICG 641

>CAGL0F09185g complement(905569..906258) similar to sp|P40099
           Saccharomyces cerevisiae YER183c FAU1, hypothetical
           start
          Length = 229

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 5/64 (7%)

Query: 89  RSYTPTSLDSDAVGHFELLIKSYEKGNISKH----FAQLNIGDKIKVRGPKGFYHY-QPN 143
           + Y P    +   GH +L   S   GN+  H    F +++  D +    PKG Y+  +P+
Sbjct: 74  KVYLPRCTHTKLTGHVQLRNDSKNPGNMKDHPHLTFHEMDSHDHVLSLSPKGKYNLKEPD 133

Query: 144 MNEE 147
           + +E
Sbjct: 134 IEDE 137

>YKR044W (UIP5) [3296] chr11 (521657..522988) Member of the
           legume-like lectin family [1332 bp, 443 aa]
          Length = 443

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 170 NDSDKTKVSLVYGNQTEEDILLKKELDAFVERKPDQFKVYYLLDKAPEAWTGG 222
           ND D + +   Y    E ++ L++E    ++R+PD+F  + ++   P   TG 
Sbjct: 323 NDMDAS-IEDTYDYAKEAELFLEQEFGEVLDREPDEFTKWKMIKAQPNIKTGS 374

>Kwal_55.20425
          Length = 1036

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 30/68 (44%)

Query: 114 GNISKHFAQLNIGDKIKVRGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSD 173
           G  SK+ ++L +G ++ V          P+  + + M   GTG+AP   I++  F     
Sbjct: 852 GQASKYLSELAVGSELVVSVKPSVMKLPPSPEQPVIMSGLGTGLAPFKAIVEEKFWQQQQ 911

Query: 174 KTKVSLVY 181
              +  VY
Sbjct: 912 GHTIGKVY 919

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,402,482
Number of extensions: 418209
Number of successful extensions: 1138
Number of sequences better than 10.0: 49
Number of HSP's gapped: 1097
Number of HSP's successfully gapped: 49
Length of query: 277
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 177
Effective length of database: 13,134,309
Effective search space: 2324772693
Effective search space used: 2324772693
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)