Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27599g52251427410.0
Sklu_2260.352351521690.0
Kwal_47.1816352251420780.0
CAGL0J02882g53052120520.0
Scas_715.4452852120150.0
ADL086C55251220010.0
YER052C (HOM3)52751419570.0
Scas_34.1*2392409111e-121
YDL010W23158830.032
CAGL0E01595g468137820.069
CAGL0H01441g42748780.16
AAL061C42054720.96
Sklu_2326.360397701.9
Scas_588.1442353691.9
Kwal_26.7931595132701.9
CAGL0D03894g48540692.1
YHR033W42340692.3
ADL175W474138692.4
YKR002W (PAP1)56894683.2
KLLA0C10296g41848664.4
Scas_668.2958190657.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27599g
         (514 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...  1060   0.0  
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement        840   0.0  
Kwal_47.18163                                                         805   0.0  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...   795   0.0  
Scas_715.44                                                           780   0.0  
ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH] (533181..53...   775   0.0  
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...   758   0.0  
Scas_34.1*                                                            355   e-121
YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted ...    37   0.032
CAGL0E01595g 152176..153582 similar to sp|Q08271 Saccharomyces c...    36   0.069
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...    35   0.16 
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...    32   0.96 
Sklu_2326.3 YKR002W, Contig c2326 3873-5684 reverse complement         32   1.9  
Scas_588.14                                                            31   1.9  
Kwal_26.7931                                                           32   1.9  
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...    31   2.1  
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...    31   2.3  
ADL175W [1566] [Homologous to ScYOL132W - SH] complement(387433....    31   2.4  
YKR002W (PAP1) [3258] chr11 (442875..444581) Poly(A) polymerase,...    31   3.2  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...    30   4.4  
Scas_668.29                                                            30   7.4  

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/514 (100%), Positives = 514/514 (100%)

Query: 1   MIETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRL 60
           MIETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRL
Sbjct: 1   MIETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRL 60

Query: 61  LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS 120
           LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS
Sbjct: 61  LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS 120

Query: 121 QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS 180
           QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS
Sbjct: 121 QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS 180

Query: 181 FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA 240
           FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA
Sbjct: 181 FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH 300
           LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH 300

Query: 301 IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV 360
           IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV
Sbjct: 301 IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV 360

Query: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE 420
           VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE
Sbjct: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE 420

Query: 421 ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV 480
           ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV
Sbjct: 421 ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV 480

Query: 481 IDESNAVRALQSIHAKLLDSPQNENFESAVNERL 514
           IDESNAVRALQSIHAKLLDSPQNENFESAVNERL
Sbjct: 481 IDESNAVRALQSIHAKLLDSPQNENFESAVNERL 514

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/515 (76%), Positives = 459/515 (89%), Gaps = 1/515 (0%)

Query: 1   MIETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRL 60
           M E SNW+VQKFGGTS+GKF +QIV +I+KVY+ +Y+NNVAVVCSARSSYTKAEGTTSRL
Sbjct: 1   MFEKSNWIVQKFGGTSVGKFPEQIVEQIVKVYTTQYENNVAVVCSARSSYTKAEGTTSRL 60

Query: 61  LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS 120
           L AC+LA+NN+  + +VL LV  DHV+NA+E +KD T+Q+ L++DT  E+++V +YL AS
Sbjct: 61  LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS 120

Query: 121 QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS 180
           Q+LGEVS+RT+DLVMS GEKLSCL++ ALC D GV A+YVDLSF+VP+DYECK+G+LDN+
Sbjct: 121 QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN 180

Query: 181 FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA 240
           FYTFLV AF+E L P+LK    G  ++PVITGFFG+VPMGLLNGVGRGYTDLCAALIAV 
Sbjct: 181 FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH 300
           LNADELQVWKEVDGIFTADPRKVPQARLL +VTP+EA+ELTYYGSEVIHPFTMEQVIR  
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300

Query: 301 IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV 360
           IPIRIKNVQNP G GT+IYP + AKKGESTPPHPPV LTSS FE+K++GATAITTK+DIV
Sbjct: 301 IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV 360

Query: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE 420
           V+NIHSNKKTLSHGFLA++FS LDKYKLVVDLISTSEVHVSMALPVPD++S +AL+ AVE
Sbjct: 361 VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE 420

Query: 421 ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV 480
           EL RLG++D+ KKMAIVSLVGKQMKQF+GIAGTMFTTLAEQ+INIEMISQGANEINISCV
Sbjct: 421 ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV 480

Query: 481 IDESNAVRALQSIHAKLLDSPQNE-NFESAVNERL 514
           IDE ++++ALQSIHAKLLD      +FE AVNERL
Sbjct: 481 IDEQDSIKALQSIHAKLLDENSGSLDFEHAVNERL 515

>Kwal_47.18163
          Length = 522

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/514 (74%), Positives = 445/514 (86%)

Query: 1   MIETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRL 60
           M   +NW+VQKFGGTS+GKF +QIVNEI+KVY+ +Y NNVAVVCSARSS TKAEGTTSRL
Sbjct: 1   MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYTTKYKNNVAVVCSARSSDTKAEGTTSRL 60

Query: 61  LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS 120
           L ACDL  N++  + +VL  V  DH++NA++ +    +Q+ LI DT  E+++V +YL+AS
Sbjct: 61  LRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKYLNAS 120

Query: 121 QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS 180
           QVLGEVS RT+DLVMS GEKLSCL++ ALC + GV A+YVDLS ++P DYEC++GTLD S
Sbjct: 121 QVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGTLDTS 180

Query: 181 FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA 240
           FYTFLV AF+EKL+P+L+    GT ++PVITGFFG+VPMGLLNGVGRGYTDLCAALIAV 
Sbjct: 181 FYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH 300
           LNADELQVWKEVDGIFTADPRKVPQARLL +VTP+EA+ELTYYGSEVIHPFTMEQVIR  
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300

Query: 301 IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV 360
           IPIRIKNVQNP G+GT+IYP + AKKGESTPPHPPV L++S FE KK+GATAIT+KSDIV
Sbjct: 301 IPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSKSDIV 360

Query: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE 420
           VV+IHSNKKTLSHGFLA++F+TLDKYKLVVDLISTSEVHVSMALPVPD DS KAL+ AVE
Sbjct: 361 VVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALKKAVE 420

Query: 421 ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV 480
           ELK LG V++ KK+ IVSLVGKQMKQF+GIAGTMFTTLAEQ INIEMISQGANEINISCV
Sbjct: 421 ELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 480

Query: 481 IDESNAVRALQSIHAKLLDSPQNENFESAVNERL 514
           IDE +A++ALQSIH+KLLD   +     AVNE+L
Sbjct: 481 IDEEDALKALQSIHSKLLDLDSDVGLGKAVNEKL 514

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/521 (74%), Positives = 446/521 (85%), Gaps = 16/521 (3%)

Query: 4   TSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQE-----YDNNVAVVCSARSSYTKAEGTTS 58
           TSNWVVQKFGGTS+GKF  QIV+EI+K YS       +DN+VAVVCSARSSYTK EGTTS
Sbjct: 8   TSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGTTS 67

Query: 59  RLLLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLD 118
           RLL  CDLAS +  EY ++++ + +DHV+NAE  ++D  +   LI+DT +E+ +V +YL 
Sbjct: 68  RLLKCCDLASQDQ-EYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKYLS 126

Query: 119 ASQVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLD 178
           AS+VLGEVS RT+DLVMS GEKLSCL++TALC D G  A+YVDLS +VPSDY+    TLD
Sbjct: 127 ASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTT--TLD 184

Query: 179 NSFYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIA 238
            SFYTFLV A +EKL P +   E   +I+PV TGFFG +PMGLLNGVGRGYTDLCAALIA
Sbjct: 185 TSFYTFLVQALKEKLEPFVNSKE---RIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIA 241

Query: 239 VALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIR 298
           VALNADELQVWKEVDGIFTADPRKVPQARLLD+VTP+EA+ELTYYGSEVIHPFTMEQVIR
Sbjct: 242 VALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIR 301

Query: 299 THIPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSD 358
             IPIRIKNVQNPKGNGTIIYP + AKKGESTPPHPP AL+S+ FE K++GATAITTK+D
Sbjct: 302 AKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKND 361

Query: 359 IVVVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCA 418
           IVV+N+HSNKKTLSHGFLA++F+ LDKYKLVVDLISTSEVHVSMALP+PDSDS+KALR A
Sbjct: 362 IVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSA 421

Query: 419 VEELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINIS 478
           VE+LK LG+VD+IKKM+IVSLVGKQMKQF+GIAGTMFTTLAEQ INIEMISQGANEINIS
Sbjct: 422 VEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINIS 481

Query: 479 CVIDESNAVRALQSIHAKLLDS-PQN----ENFESAVNERL 514
           CVIDE ++++ALQSIH KLLD  P+N    E FE AV+ERL
Sbjct: 482 CVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKAVDERL 522

>Scas_715.44
          Length = 528

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/521 (72%), Positives = 445/521 (85%), Gaps = 17/521 (3%)

Query: 5   SNWVVQKFGGTSIGKFSKQIVNEIIKVYS----QEYDNNVAVVCSARSSYTKAEGTTSRL 60
           SNWVVQKFGGTS+GKF  QIV++IIK YS    + Y+NNVAVVCSARSSYTKAEGTTSRL
Sbjct: 6   SNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGTTSRL 65

Query: 61  LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS 120
           L  CDLAS    E+ +++++++ DH+ NAE  V+D  +Q  LI DT +E+ +V++YLDAS
Sbjct: 66  LRCCDLASQE-MEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYLDAS 124

Query: 121 QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS 180
           ++LGEVSTRT+DLVMS+GEKLSCL++TAL  D G  A+YVDL+ IVPSDY      LDNS
Sbjct: 125 KILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--VLDNS 182

Query: 181 FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA 240
           FYTFL  AF+EKL P ++  E   ++IPV TGFFG+VPMGLLNGVGRGYTDLCAALIAVA
Sbjct: 183 FYTFLFQAFKEKLQPFIESKE---RVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVA 239

Query: 241 LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH 300
           +NADELQVWKEVDGIFTADPRKVPQARLL +VTP+EA+ELTYYGSEVIHPFTMEQVI+  
Sbjct: 240 VNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAK 299

Query: 301 IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV 360
           IPIRIKNVQNP+G GTIIYP + AKKGESTPPHPP  L+SS FE +K+GATAITTK+DIV
Sbjct: 300 IPIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIV 359

Query: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE 420
           V+NIHSNKKTLSHGFLA++F+ LDK+KLVVDLISTSEVHVSMALP+PDS+S K+LR AVE
Sbjct: 360 VINIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVE 419

Query: 421 ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV 480
           +L+ LG VDV KKMAIVSLVGKQMKQF+GIAGTMFTTLAEQ INIEMISQGANEINISCV
Sbjct: 420 KLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 479

Query: 481 IDESNAVRALQSIHAKLLDSPQNE-------NFESAVNERL 514
           IDE+++++ALQSIHAKLLD+ +         NFE A+NERL
Sbjct: 480 IDETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERL 520

>ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH]
           (533181..534839) [1659 bp, 552 aa]
          Length = 552

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/512 (72%), Positives = 444/512 (86%)

Query: 3   ETSNWVVQKFGGTSIGKFSKQIVNEIIKVYSQEYDNNVAVVCSARSSYTKAEGTTSRLLL 62
           + +NWVVQKFGGTSIGKF   IVN+I+KV+S +Y  NVAVVCSARSSYTK+EGTTSRLL+
Sbjct: 32  QKTNWVVQKFGGTSIGKFPTNIVNDIVKVFSHDYGKNVAVVCSARSSYTKSEGTTSRLLM 91

Query: 63  ACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDASQV 122
           ACD A++ +  +++++ ++  DHV NA   +KD  I+  L+E T  E++ V RYL ASQ+
Sbjct: 92  ACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQASQI 151

Query: 123 LGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNSFY 182
           LGEVS RT+DLVMS+GEKLSCL++TALC+D GV A YVD S IVP+D+ C EG+LDNSFY
Sbjct: 152 LGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNSFY 211

Query: 183 TFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVALN 242
             LV AF+E+L+ I++  + G +I+PVITGFFG++PMGLLNGVGRGYTDLCAAL+AVALN
Sbjct: 212 ALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAVALN 271

Query: 243 ADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTHIP 302
           ADELQVWKEVDGIFTADPRKVPQARLL+TVTP+EAAELTYYGSEVIHPFTMEQVIR  IP
Sbjct: 272 ADELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAKIP 331

Query: 303 IRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIVVV 362
           IRIKNVQNP G+GT+IY  + AKKGESTPPHPP++++SS FE +K+GATAITTK+DIVV+
Sbjct: 332 IRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIVVL 391

Query: 363 NIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVEEL 422
           NIHSNKKTLSHGFLA++F+ LD YKL+VDLISTSEVHVSMALPVPDSDS ++LR AVEEL
Sbjct: 392 NIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVEEL 451

Query: 423 KRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCVID 482
           K+LGTVD+IKKMAIVSLVGKQMK F+GIAG MFTTL+EQ+INIEMISQGANEINISCVID
Sbjct: 452 KKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCVID 511

Query: 483 ESNAVRALQSIHAKLLDSPQNENFESAVNERL 514
           E N+VRALQSIHAKLL+     +  + +N RL
Sbjct: 512 EKNSVRALQSIHAKLLEPLAPTSSGAVLNGRL 543

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/514 (71%), Positives = 441/514 (85%), Gaps = 10/514 (1%)

Query: 5   SNWVVQKFGGTSIGKFSKQIVNEIIKVYSQE--YDNNVAVVCSARSSYTKAEGTTSRLLL 62
           SNWVVQKFGGTS+GKF  QIV++I+K YS+    +NNVAVVCSARSSYTKAEGTTSRLL 
Sbjct: 12  SNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGPNNNVAVVCSARSSYTKAEGTTSRLLK 71

Query: 63  ACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDASQV 122
            CDLAS  + E++++++++ +DH+ NA+  + +  +Q  L++DT +E+ +V++YL+AS+V
Sbjct: 72  CCDLASQES-EFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLNASKV 130

Query: 123 LGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNSFY 182
           LGEVS+RT+DLVMS GEKLSCL++TALC D G  A+YVDLS IVPSD+      LDNSFY
Sbjct: 131 LGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSA--SALDNSFY 188

Query: 183 TFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVALN 242
           TFLV A +EKL+P +   E   +I+PV TGFFG+VP GLLNGVGRGYTDLCAALIAVA+N
Sbjct: 189 TFLVQALKEKLAPFVSAKE---RIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAVN 245

Query: 243 ADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTHIP 302
           ADELQVWKEVDGIFTADPRKVP+ARLLD+VTP+EA+ELTYYGSEVIHPFTMEQVIR  IP
Sbjct: 246 ADELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 305

Query: 303 IRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIVVV 362
           IRIKNVQNP GNGTIIYP + AKKGESTPPHPP  L+SS +E +K+GATAITTK+DI V+
Sbjct: 306 IRIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVI 365

Query: 363 NIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVEEL 422
           NIHSNKKTLSHGFLA++F+ LDKYKLVVDLISTSEVHVSMALP+PD+DSLK+LR A E+L
Sbjct: 366 NIHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEKL 425

Query: 423 KRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCVID 482
           + LG+VD+ KK++IVSLVGK MKQ++GIAGTMFTTLAE+ INIEMISQGANEINISCVI+
Sbjct: 426 RILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVIN 485

Query: 483 ESNAVRALQSIHAKLLDSPQN--ENFESAVNERL 514
           ES++++ALQ IHAKLL    N    FE A++ERL
Sbjct: 486 ESDSIKALQCIHAKLLSERTNTSNQFEHAIDERL 519

>Scas_34.1*
          Length = 239

 Score =  355 bits (911), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 166/240 (69%), Positives = 201/240 (83%), Gaps = 1/240 (0%)

Query: 57  TSRLLLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRY 116
           TSRLL AC+LA+NN+  + +VL LV  DHV+NA+E +KD T+Q+ L++DT  E+++V +Y
Sbjct: 1   TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY 60

Query: 117 LDASQVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGT 176
           L ASQ+LGEVS+RT+DLVMS GEKLSCL++ ALC D GV A+YVDLSF+VP+DYECK+G+
Sbjct: 61  LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS 120

Query: 177 LDNSFYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAAL 236
           LDN+FYTFLV AF+E L P+LK    G  ++PVITGFFG+VPMGLLNGVGRGYTDLCAAL
Sbjct: 121 LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 180

Query: 237 IAVALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQV 296
           IAV LNADELQVWKEVDGIFTADPR+  +   L +VTP E A LTYYGS VIHPFTMEQV
Sbjct: 181 IAVGLNADELQVWKEVDGIFTADPRRFLKQDCLSSVTP-ERALLTYYGSGVIHPFTMEQV 239

>YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted to
           have structural similarity to disulfide oxidoreductases
           [696 bp, 231 aa]
          Length = 231

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 207 IPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVP 264
           I ++TG  G VP  L+NGV RG  +    L       + LQVW   DG F+ + R+ P
Sbjct: 174 IKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQREKP 228

>CAGL0E01595g 152176..153582 similar to sp|Q08271 Saccharomyces
           cerevisiae YOL132w, start by similarity
          Length = 468

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 55/137 (40%), Gaps = 13/137 (9%)

Query: 74  YKNVLDLVERDHVANAEESVKDITIQ-ETLIEDTKREINIVRRYLDASQVLGEVSTRTLD 132
           Y N L     + V N EES  +  I  + LI D K  I I     D    +G  +   L+
Sbjct: 149 YNNTLGFFAGNEVINDEESATNSPIYVKKLIGDIKEYIAIT---CDRLIPVGYSAADDLN 205

Query: 133 LVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYE-CKEGTLDNSFYTFLVTAFRE 191
             +SL + L C            N  Y  + F   + Y+ C E T+  S Y  L+ A+R 
Sbjct: 206 YRVSLSQYLEC--------STNSNKVYDSVDFYGVNSYQWCGEQTIRTSGYDKLIEAYRN 257

Query: 192 KLSPILKETENGTKIIP 208
              P++       +++P
Sbjct: 258 YTKPVMLSEFGCNRVLP 274

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPD 275
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+ +  + PD
Sbjct: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAKPI-LIVPD 200

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 222 LNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPD 275
           ++GV  G  D  +A+ A  + AD L +  +VD ++T +PR  P A+ +  V PD
Sbjct: 145 ISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAKPI-LVVPD 197

>Sklu_2326.3 YKR002W, Contig c2326 3873-5684 reverse complement
          Length = 603

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 9/97 (9%)

Query: 302 PIRIKNVQNPKGNGTIIYPSDQAKKGES-TPPHPPVALTSSIFESKKKGATAITTKSDIV 360
           P++++ V NP+     IY  D++ K    TP +P +  T +I ES KK   A   +   V
Sbjct: 281 PLQVR-VWNPR-----IYAQDRSHKMPVITPAYPSMCATHNISESTKKVILAELERGVQV 334

Query: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSE 397
              I SNKK  +  F    F    KYK  + ++++++
Sbjct: 335 SNEIFSNKKVWADLFQKHDF--FFKYKFYLTVMASTK 369

>Scas_588.14
          Length = 423

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAEL 280
           G  D  +A+ +  + AD L +  +VD ++T +PR  P+A+ +  V PD A  L
Sbjct: 150 GDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPEAKPI-LVVPDLAKGL 201

>Kwal_26.7931
          Length = 595

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 62/132 (46%), Gaps = 14/132 (10%)

Query: 302 PIRIKNVQNPKGNGTIIYPSDQAKKGES-TPPHPPVALTSSIFESKKKGATAITTKSDIV 360
           P++++ V NP+     IY  D++ +    TP +P +  T +I +S KK   A   +   V
Sbjct: 281 PLQVR-VWNPR-----IYAQDRSHRMPVITPAYPSMCATHNINDSTKKVILAELERGAHV 334

Query: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLIST--SEVHVSMALPVPDSDSLKALRCA 418
             +I SNKK  S  F    F    K+ L V   +T  SE H+  +  V        LR  
Sbjct: 335 SNDIFSNKKPWSELFKKHDFFYRYKFYLTVMASTTGSSEQHLKWSGLVESK-----LRLL 389

Query: 419 VEELKRLGTVDV 430
           V++L+ L  +++
Sbjct: 390 VQKLEVLSGINL 401

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 267
           G  D  +A+ A  ++AD L +  +VD ++T +PR  P A+
Sbjct: 146 GDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 267
           G  D  +A+ A  + AD L +  +VD ++T +PR  P AR
Sbjct: 148 GDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDAR 187

>ADL175W [1566] [Homologous to ScYOL132W - SH]
           complement(387433..388857) [1425 bp, 474 aa]
          Length = 474

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 52/138 (37%), Gaps = 14/138 (10%)

Query: 73  EYKNVLDLVERDHVANAEESVK-DITIQETLIEDTKREINIVRRYLDASQVLGEVSTRTL 131
            Y N L     + V N   S +      + L+ D K+ I    R+      +G  +   L
Sbjct: 149 HYNNTLGFFAGNEVVNDGRSAQTSPPYLKALVGDMKQYI---ARHSPRPIPVGYSAVDDL 205

Query: 132 DLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYE-CKEGTLDNSFYTFLVTAFR 190
              +SL   L C            N ++ D+ F   + Y+ C + T   S Y  LV A+R
Sbjct: 206 KFRVSLARYLECY---------DANNKFNDVDFYGVNSYQWCGQQTFQTSGYDKLVDAYR 256

Query: 191 EKLSPILKETENGTKIIP 208
           E   P+        +++P
Sbjct: 257 EYSKPVFFSEFGCNEVLP 274

>YKR002W (PAP1) [3258] chr11 (442875..444581) Poly(A) polymerase,
           required for mRNA 3' end formation, has a poorly
           conserved RNA recognition (RRM) domain [1707 bp, 568 aa]
          Length = 568

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 9/94 (9%)

Query: 302 PIRIKNVQNPKGNGTIIYPSDQAKKGES-TPPHPPVALTSSIFESKKKGATAITTKSDIV 360
           P++++ V NPK     IY  D++ +    TP +P +  T +I ES KK       +   +
Sbjct: 281 PLQVR-VWNPK-----IYAQDRSHRMPVITPAYPSMCATHNITESTKKVILQEFVRGVQI 334

Query: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLIS 394
             +I SNKK+ ++ F    F    +YK  +++ +
Sbjct: 335 TNDIFSNKKSWANLFEKNDF--FFRYKFYLEITA 366

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPD 275
           G  D  +A+ A    AD L +  +VD ++T +PR  P A+ +  V PD
Sbjct: 148 GDNDTLSAITAALTGADYLFLLTDVDCLYTDNPRANPDAKPI-LVVPD 194

>Scas_668.29
          Length = 581

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 7/90 (7%)

Query: 302 PIRIKNVQNPKGNGTIIYPSDQAKKGES-TPPHPPVALTSSIFESKKKGATAITTKSDIV 360
           P++++ V NPK     IY  D++ +    TP +P +  T +I ES KK       +   V
Sbjct: 281 PLQVR-VWNPK-----IYAQDRSHRMPVITPAYPSMCATHNITESTKKVILEEFARGIQV 334

Query: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVV 390
             +I SNK T +  F    F    K+ L +
Sbjct: 335 TNDIFSNKGTWADLFQKHDFFYKYKFYLTI 364

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,146,678
Number of extensions: 683100
Number of successful extensions: 2335
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2372
Number of HSP's successfully gapped: 29
Length of query: 514
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 408
Effective length of database: 12,926,601
Effective search space: 5274053208
Effective search space used: 5274053208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)