Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27577g1721707235e-99
ADL085C273752731e-29
Kwal_47.18167227772603e-28
AFL223W165631772e-16
KLLA0F23672g123631672e-15
Kwal_26.8461123631672e-15
Scas_666.12121581645e-15
Scas_571.1d609791746e-15
CAGL0L03828g121611637e-15
Scas_571.2602791721e-14
CAGL0K03069g194601642e-14
Sklu_2444.3564621684e-14
KLLA0D02640g589841613e-13
KLLA0A12111g236631574e-13
CAGL0K10736g593811588e-13
YNL111C (CYB5)120581489e-13
KLLA0B14795g556621543e-12
Kwal_23.2823560791533e-12
Sklu_2258.5580551517e-12
YML054C (CYB2)591841491e-11
Kwal_27.10332378701437e-11
Kwal_14.807578531412e-10
Scas_717.14189491362e-10
AAL183W377801393e-10
KLLA0D01639g381801393e-10
Kwal_26.8046198541301e-09
Scas_696.36426561322e-09
YMR272C (SCS7)384691261e-08
AAL078W592751093e-06
KLLA0E18535g148571053e-06
YMR073C201481073e-06
Kwal_23.569351359995e-05
CAGL0I00418g49054943e-04
AAR153C47855915e-04
Sklu_2032.352275890.001
KLLA0C10692g52052870.002
KLLA0C05566g47755860.002
CAGL0F03399g38044850.003
Scas_563.649755860.003
Sklu_2299.348055850.004
YGL055W (OLE1)51043770.034
Kwal_14.184528837720.14
Kwal_47.1673479265690.36
ABL085W75761670.78
AGR088W288760651.6
YJR143C (PMT4)76259632.3
AEL043W95333606.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27577g
         (170 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0 P...   283   5e-99
ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 2...   109   1e-29
Kwal_47.18167                                                         104   3e-28
AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH] complement(...    73   2e-16
KLLA0F23672g 2212223..2212594 some similarities with sp|P40312 S...    69   2e-15
Kwal_26.8461                                                           69   2e-15
Scas_666.12                                                            68   5e-15
Scas_571.1d                                                            72   6e-15
CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces c...    67   7e-15
Scas_571.2                                                             71   1e-14
CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04...    68   2e-14
Sklu_2444.3 , Contig c2444 10960-12654                                 69   4e-14
KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871....    67   3e-13
KLLA0A12111g 1053506..1054216 some similarities with sp|P09437 H...    65   4e-13
CAGL0K10736g 1045298..1047079 highly similar to sp|P00175 Saccha...    65   8e-13
YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrom...    62   9e-13
KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces...    64   3e-12
Kwal_23.2823                                                           64   3e-12
Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement        63   7e-12
YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrom...    62   1e-11
Kwal_27.10332                                                          60   7e-11
Kwal_14.807                                                            59   2e-10
Scas_717.14                                                            57   2e-10
AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH] complement(137...    58   3e-10
KLLA0D01639g complement(146344..147489) similar to sp|Q03529 Sac...    58   3e-10
Kwal_26.8046                                                           55   1e-09
Scas_696.36                                                            55   2e-09
YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide ...    53   1e-08
AAL078W [109] [Homologous to ScYGL055W - NSH] complement(209600....    47   3e-06
KLLA0E18535g 1641507..1641953 some similarities with ca|CA1511|I...    45   3e-06
YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protei...    46   3e-06
Kwal_23.5693                                                           43   5e-05
CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomy...    41   3e-04
AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH] (619953..621...    40   5e-04
Sklu_2032.3 , Contig c2032 4286-5854                                   39   0.001
KLLA0C10692g complement(916718..918280) weakly similar to sp|P21...    38   0.002
KLLA0C05566g complement(497877..499310) similar to sp|P21147 Sac...    38   0.002
CAGL0F03399g complement(333955..335097) highly similar to sp|Q03...    37   0.003
Scas_563.6                                                             38   0.003
Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement         37   0.004
YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desatur...    34   0.034
Kwal_14.1845                                                           32   0.14 
Kwal_47.16734                                                          31   0.36 
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...    30   0.78 
AGR088W [4398] [Homologous to ScYLR087C (CSF1) - SH] complement(...    30   1.6  
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...    29   2.3  
AEL043W [2463] [Homologous to ScYCR017C (CWH43) - SH] complement...    28   6.2  

>KLLA0F27577g 2556662..2557180 some similarities with sp|Q9M5B0
           Petunia hybrida Cytochrome b5 DIF-F, hypothetical start
          Length = 172

 Score =  283 bits (723), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 140/170 (82%)

Query: 1   MRDPLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDI 60
           MRDPLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDI
Sbjct: 1   MRDPLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDI 60

Query: 61  GHSMESLAYDLDPGALKGTLYLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWITSIYQ 120
           GHSMESLAYDLDPGALKGTLYLP                              WITSIYQ
Sbjct: 61  GHSMESLAYDLDPGALKGTLYLPNSKSNHNSDNEDDSSLPYFLSASFLPSSLLWITSIYQ 120

Query: 121 AIRKFFLLERDTRIWLFSTIIFFCVLTLGFIHWGHDHNIIDNNDYGVPAW 170
           AIRKFFLLERDTRIWLFSTIIFFCVLTLGFIHWGHDHNIIDNNDYGVPAW
Sbjct: 121 AIRKFFLLERDTRIWLFSTIIFFCVLTLGFIHWGHDHNIIDNNDYGVPAW 170

>ADL085C [1656] [Homologous to NOHBY] (535296..536117) [822 bp, 273
           aa]
          Length = 273

 Score =  109 bits (273), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (82%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSME 65
           I+++EV++H+SR DCW +IHG+VYDIT  L  HPGG ++LLKYAG+D+TL FDD+GHSME
Sbjct: 93  ISIEEVSQHTSRDDCWFIIHGRVYDITGLLENHPGGTKILLKYAGRDATLPFDDVGHSME 152

Query: 66  SLAYDLDPGALKGTL 80
           SL YD+ PG+  G +
Sbjct: 153 SLIYDMAPGSYLGEV 167

>Kwal_47.18167
          Length = 227

 Score =  104 bits (260), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 59/77 (76%)

Query: 4   PLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHS 63
           P I+ DEVA H+   DCW  IHGKVYD++S+L +HPGGAQV+LK AGKD+T+ FD++GHS
Sbjct: 32  PFISSDEVATHTDADDCWISIHGKVYDVSSYLPQHPGGAQVMLKLAGKDATVPFDEVGHS 91

Query: 64  MESLAYDLDPGALKGTL 80
           +ESL Y L P A  G L
Sbjct: 92  IESLIYGLGPRACVGIL 108

>AFL223W [2972] [Homologous to ScYNL111C (CYB5) - SH]
           complement(19601..20098) [498 bp, 165 aa]
          Length = 165

 Score = 72.8 bits (177), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 45/63 (71%)

Query: 5   LITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSM 64
           L T  E+A H+S +D W +I+GKVYD T F  +HPGG +VL+  AG+D+T  F DIGHS 
Sbjct: 43  LYTYQEIAEHNSENDLWLIINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIGHSD 102

Query: 65  ESL 67
           +++
Sbjct: 103 DAV 105

>KLLA0F23672g 2212223..2212594 some similarities with sp|P40312
          Saccharomyces cerevisiae YNL111c CYB5 cytochrome b5
          singleton, hypothetical start
          Length = 123

 Score = 68.9 bits (167), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 44/63 (69%)

Query: 5  LITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSM 64
          L+T  EV+ H +  D W +I GKVYD T F+ +HPGG ++L+   G+D+T  F+DIGHS 
Sbjct: 4  LLTYKEVSEHKTVDDLWMIIDGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDIGHSD 63

Query: 65 ESL 67
          +++
Sbjct: 64 DAI 66

>Kwal_26.8461
          Length = 123

 Score = 68.9 bits (167), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%)

Query: 5  LITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSM 64
          L +  E+A H++  D W +I GKVYD T F+ +HPGG +VL+   G+D+T  F DIGHS 
Sbjct: 4  LYSYKEIAEHNTEKDLWMIIDGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADIGHSD 63

Query: 65 ESL 67
          +++
Sbjct: 64 DAV 66

>Scas_666.12
          Length = 121

 Score = 67.8 bits (164), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 42/58 (72%)

Query: 10 EVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSMESL 67
          ++A H+   D W +I GKVYD++ FL +HPGG +++ + AG+D+T  F DIGHS ++L
Sbjct: 9  QIAEHNKPDDAWIIIEGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIGHSDDAL 66

>Scas_571.1d
          Length = 609

 Score = 71.6 bits (174), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 53/79 (67%), Gaps = 5/79 (6%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSME 65
           I+ DEV +H+S +DCW VI+G+VYD+TSF+  HPGG+ ++   AGKD +  F+ + H+  
Sbjct: 95  ISTDEVTKHNSENDCWIVINGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAIFNPL-HAPN 153

Query: 66  SLAYDLDP----GALKGTL 80
           ++   L P    G L+GT+
Sbjct: 154 AIERFLPPECYLGPLQGTM 172

>CAGL0L03828g 440663..441028 similar to sp|P40312 Saccharomyces
          cerevisiae YNL111c CYB5, start by similarity
          Length = 121

 Score = 67.4 bits (163), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 42/61 (68%)

Query: 7  TMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSMES 66
          T  +V+ H+   DCW +I G VYD++ FL +HPGG +++ ++ G D+T  F DIGHS ++
Sbjct: 6  TYKQVSEHNKEGDCWIIIDGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIGHSDDA 65

Query: 67 L 67
          L
Sbjct: 66 L 66

>Scas_571.2
          Length = 602

 Score = 70.9 bits (172), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 37/79 (46%), Positives = 49/79 (62%), Gaps = 1/79 (1%)

Query: 5   LITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSM 64
           +I   EVARH++ +DCW VI+G VYD+TSF+  HPGGA ++   AGKD T  F+ I H+ 
Sbjct: 88  VIDPSEVARHNTPADCWIVINGVVYDLTSFIPVHPGGADIIKSNAGKDVTAIFEPI-HAP 146

Query: 65  ESLAYDLDPGALKGTLYLP 83
             +   L P    GTL  P
Sbjct: 147 GVIEKYLPPKCRIGTLKKP 165

>CAGL0K03069g complement(284361..284945) weakly similar to sp|Q04772
           Saccharomyces cerevisiae YMR073c, hypothetical start
          Length = 194

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 2/60 (3%)

Query: 1   MRDPL-ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLL-KYAGKDSTLQFD 58
           +R PL I   E+ARH++  DCWTVI+GKVY I+S+L  HPGGA++L+ K +G+DST+ F+
Sbjct: 113 IRPPLCIDAHELARHNTAEDCWTVINGKVYSISSYLSFHPGGAKILIDKSSGQDSTVLFN 172

>Sklu_2444.3 , Contig c2444 10960-12654
          Length = 564

 Score = 69.3 bits (168), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 44/62 (70%), Gaps = 1/62 (1%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSME 65
           IT+DEV  H++  DCW V++G VYDIT F+  HPGGA  L++ AG+D+T +F  I HS E
Sbjct: 88  ITVDEVKLHNNIDDCWIVLNGDVYDITEFIKIHPGGAARLMEVAGRDATEKFHMI-HSDE 146

Query: 66  SL 67
            L
Sbjct: 147 VL 148

>KLLA0D02640g complement(225482..227251) gi|5262950|emb|CAB45871.1
           Kluyveromyces lactis cytochrome b2, start by similarity
          Length = 589

 Score = 66.6 bits (161), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 5/84 (5%)

Query: 1   MRDPLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDI 60
           M  P ++  EVA+HSS  DCW VI G VY++T F+  HPGG  ++   AGKD T  F  I
Sbjct: 85  MTKPKVSPTEVAKHSSPKDCWVVIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKIFAPI 144

Query: 61  GHSMESLAYDLDP----GALKGTL 80
            H+ + +   + P    G L GT+
Sbjct: 145 -HAPDVIEKYIAPENRIGPLDGTM 167

>KLLA0A12111g 1053506..1054216 some similarities with sp|P09437
           Hansenula anomala Cytochrome B2, mitochondrial precursor
           (EC 1.1.2.3) (L-lactate dehydrogenase [Cytochrome])
           (L-lactate ferricytochrome C oxidoreductase) (L-LCR),
           hypothetical start
          Length = 236

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 4/63 (6%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSME 65
           +++ EV  H+   DCW VI G VYDIT FL KHPGG   L+++AG+D+T +F    H M 
Sbjct: 81  VSVKEVKSHNRIDDCWIVIDGDVYDITGFLSKHPGGVTRLMEFAGRDATERF----HQMH 136

Query: 66  SLA 68
           S A
Sbjct: 137 SSA 139

>CAGL0K10736g 1045298..1047079 highly similar to sp|P00175
           Saccharomyces cerevisiae YML054c CYB2 lactate
           dehydrogenase cytochrome b2, hypothetical start
          Length = 593

 Score = 65.5 bits (158), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 34/81 (41%), Positives = 47/81 (58%), Gaps = 5/81 (6%)

Query: 4   PLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHS 63
           P I+  EV +H++  DCW VI G VYD+T+F+  HPGG  ++   AGKD T  FD I H 
Sbjct: 88  PKISPSEVIKHNTPEDCWVVIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAIFDPI-HP 146

Query: 64  MESLAYDLDP----GALKGTL 80
            +++   + P    G L G L
Sbjct: 147 PDAIEKYIKPEQHIGPLDGKL 167

>YNL111C (CYB5) [4482] chr14 complement(416940..417302) Cytochrome
          b5 [363 bp, 120 aa]
          Length = 120

 Score = 61.6 bits (148), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 10 EVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSMESL 67
          EVA H+   + W +I  KVYD++ F  +HPGG ++++   G+D+T  F DIGHS E+L
Sbjct: 9  EVAEHNGPENFWIIIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGHSDEAL 66

>KLLA0B14795g 1299429..1301099 similar to sp|P00175 Saccharomyces
           cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
           b2 singleton, start by similarity
          Length = 556

 Score = 63.9 bits (154), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSME 65
           +++ EV  H+   DCW VI  +VYDIT FL +HPGG   L+++AG+D+T +F  + HS  
Sbjct: 81  VSVKEVKMHNRIDDCWIVIDNEVYDITKFLSQHPGGVARLMEFAGRDATERFYQM-HSSA 139

Query: 66  SL 67
           +L
Sbjct: 140 TL 141

>Kwal_23.2823
          Length = 560

 Score = 63.5 bits (153), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 9/79 (11%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQF-----DDI 60
           I + EV  H+  +DCW V++ +VYD+TSF+  HPGG Q +L+ AG D+T +F     +D+
Sbjct: 81  IPVSEVMLHNKLNDCWIVLNDEVYDVTSFIAAHPGGVQRILEVAGSDATEKFYQIHSEDV 140

Query: 61  GHSM-ESLAYDLDPGALKG 78
            + M E L Y    G LKG
Sbjct: 141 LNKMKEKLVY---VGKLKG 156

>Sklu_2258.5 YML054C, Contig c2258 8274-10016 reverse complement
          Length = 580

 Score = 62.8 bits (151), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 27/55 (49%), Positives = 34/55 (61%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDI 60
           I   +VA+H+   DCW VI G VYD+T F+H HPGG  ++   AGKD T  F  I
Sbjct: 81  IDPQDVAKHNDPKDCWVVIDGYVYDLTEFIHSHPGGPTIIENNAGKDVTAIFGPI 135

>YML054C (CYB2) [3916] chr13 complement(165533..167308) Cytochrome
           b2 [L-(+)-lactate cytochrome c oxidoreductase],
           catalyzes the conversion of L-lactate to pyruvate [1776
           bp, 591 aa]
          Length = 591

 Score = 62.0 bits (149), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 5/84 (5%)

Query: 1   MRDPLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDI 60
           M    I+  EVA+H+   DCW VI+G VYD+T FL  HPGG  V+   AGKD T  F+ +
Sbjct: 86  MNKQKISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFEPL 145

Query: 61  GHSMESLAYDLDP----GALKGTL 80
            H+   +   + P    G L+G++
Sbjct: 146 -HAPNVIDKYIAPEKKLGPLQGSM 168

>Kwal_27.10332
          Length = 378

 Score = 59.7 bits (143), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 2/70 (2%)

Query: 4  PLITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIG 61
          PL +  +V  H+S  DCW  +   K+YD+T FL  HPGG  ++++YAGKD T +  D   
Sbjct: 7  PLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDGPL 66

Query: 62 HSMESLAYDL 71
          HS   +AY++
Sbjct: 67 HSHSFVAYEV 76

>Kwal_14.807
          Length = 578

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFD 58
           I   EVA+HS   DCW VI+G VYD++ F+  HPGG  ++   AGKD +  F+
Sbjct: 79  IRPQEVAKHSKPDDCWVVINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAIFN 131

>Scas_717.14
          Length = 189

 Score = 57.0 bits (136), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 36/49 (73%), Gaps = 1/49 (2%)

Query: 11  VARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKY-AGKDSTLQFD 58
           + RH+SR+DCWT+  GKVY ++ +L  HPGG  ++ +  AGKDST+ F+
Sbjct: 118 LQRHTSRTDCWTIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLFN 166

>AAL183W [4] [Homologous to ScYMR272C (SCS7) - SH]
          complement(13713..14846) [1134 bp, 377 aa]
          Length = 377

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 4  PLITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQF-DDIG 61
          PL +   + +H+ R+ CW +V + K+YD++ FL +HPGG Q +L YAGKD T    D + 
Sbjct: 7  PLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDKLI 66

Query: 62 HSMESLAYD-LDPGALKGTL 80
          H     AY+ LD   L G L
Sbjct: 67 HEHTEAAYEILDESYLVGYL 86

>KLLA0D01639g complement(146344..147489) similar to sp|Q03529
          Saccharomyces cerevisiae YMR272c SCS7 required for
          hydroxylation of ceramide singleton, start by
          similarity
          Length = 381

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 49/80 (61%), Gaps = 3/80 (3%)

Query: 4  PLITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIG 61
          PL +  ++ +H+ ++DCW  ++  K+Y++T FL +HPGGA+ +L YAG D T +  D + 
Sbjct: 8  PLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDVMKDVLT 67

Query: 62 HSMESLAYD-LDPGALKGTL 80
          H     AY+ +D   L G L
Sbjct: 68 HEHSESAYEIMDESYLVGYL 87

>Kwal_26.8046
          Length = 198

 Score = 54.7 bits (130), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 6   ITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLK-YAGKDSTLQFD 58
           I   ++A+H +  DCW VI+ KVY I+S+L  HPGG  +L+K  AGKD T  F+
Sbjct: 123 INKAQLAQHKAPEDCWCVINQKVYCISSYLDFHPGGVDILMKGAAGKDCTSMFN 176

>Scas_696.36
          Length = 426

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 5   LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDD 59
           L + D+VA+H++  DCW TV   K+YD++ FL  HP G + +LK+AGKD T    D
Sbjct: 57  LFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112

>YMR272C (SCS7) [4226] chr13 complement(809622..810776) Ceramide
          hydroxylase that hydroxylates the C-26 fatty-acyl
          moiety of inositol-phosphorylceramide [1155 bp, 384 aa]
          Length = 384

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 5  LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDST-LQFDDIGH 62
          L +   V  H++ +DCW T  + K+YD+T FL +HPGG + +L YAGKD T +  D   H
Sbjct: 11 LFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEIMKDSDVH 70

Query: 63 SMESLAYDL 71
               AY++
Sbjct: 71 EHSDSAYEI 79

>AAL078W [109] [Homologous to ScYGL055W - NSH]
           complement(209600..211378) [1779 bp, 592 aa]
          Length = 592

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 5/75 (6%)

Query: 2   RDPLITMDE---VAR--HSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQ 56
           R P+IT ++   VAR  +  +      I G ++D+T F+H HPGG  +++   GKD+T  
Sbjct: 465 RLPMITPEQFATVARKDYEEKEKALVAIEGIIHDVTPFMHDHPGGMALVVASVGKDATPA 524

Query: 57  FDDIGHSMESLAYDL 71
           F+   ++  + A +L
Sbjct: 525 FNGAVYAHSTAARNL 539

>KLLA0E18535g 1641507..1641953 some similarities with
           ca|CA1511|IPF9972.3eoc Candida albicans unknown
           function, 3-prime end, hypothetical start
          Length = 148

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%)

Query: 3   DPLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDD 59
            P + +++ A  +++ + W VI+ KVY I ++L  HPGG  +L + AGKD T  F+ 
Sbjct: 67  QPPLRVNKEALKANKDNFWCVINRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFNK 123

>YMR073C (YMR073C) [4032] chr13 complement(412267..412872) Protein
           containing a heme-binding domain, has a region of
           moderate similarity to a region of flavohemoprotein
           b5+b5R (human b5&b5R), which is an NAD(P)H
           oxidoreductase that may act as an oxygen sensor [606 bp,
           201 aa]
          Length = 201

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 11  VARHSSRSD-CWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQF 57
           V +H    D  W VI+GKVYDI+S+L  HPGG  +L+K+   D  + +
Sbjct: 130 VKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSDDLITY 177

>Kwal_23.5693
          Length = 513

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 13  RHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSMESLAYDL 71
           +H+ R+  +  I G V+D+T F+H HPGG  ++    GKD+T  F+   +S    A +L
Sbjct: 397 QHNRRA--FVAIEGVVHDVTPFIHDHPGGVALVETSIGKDATQAFNGAVYSHSQAARNL 453

>CAGL0I00418g 30058..31530 highly similar to sp|P21147 Saccharomyces
           cerevisiae YGL055w OLE1 stearoyl-CoA desaturase, start
           by similarity
          Length = 490

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%)

Query: 4   PLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQF 57
           P  T +E    +  +D   ++ G V+D++ ++ +HPGG ++L    GKD+T  F
Sbjct: 387 PAWTKEEFLEKNRENDGLVIVGGIVHDVSGYITEHPGGEKLLKNALGKDATKAF 440

>AAR153C [341] [Homologous to ScYGL055W (OLE1) - SH]
           (619953..621389) [1437 bp, 478 aa]
          Length = 478

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 4   PLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFD 58
           P+    E  R S  +    VI G V+D++ ++ +HPGG  ++    GKD+T  F+
Sbjct: 379 PVWDRSEFVRASRENSGLVVISGIVHDVSGYITEHPGGETLIQAALGKDATRAFN 433

>Sklu_2032.3 , Contig c2032 4286-5854
          Length = 522

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 2   RDPLITMDEVAR-----HSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQ 56
           R P ++ +  A+     + +       I G V+D+T F++ HPGG  ++    GKD+T  
Sbjct: 388 RLPYMSPENFAKLAQSEYRTNKRALVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATAA 447

Query: 57  FDDIGHSMESLAYDL 71
           F+   +S    A +L
Sbjct: 448 FNGAVYSHSRAARNL 462

>KLLA0C10692g complement(916718..918280) weakly similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, hypothetical start
          Length = 520

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 20  CWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSMESLAYDL 71
            +  I G V+D+T F++ HPGG  ++    GKD+T  F+   +   + A +L
Sbjct: 409 AYVAIEGIVHDVTPFIYDHPGGVTLVETSIGKDATQAFNGAVYRHSNAARNL 460

>KLLA0C05566g complement(497877..499310) similar to sp|P21147
           Saccharomyces cerevisiae YGL055w OLE1 stearoyl-CoA
           desaturase singleton, start by similarity
          Length = 477

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%)

Query: 4   PLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFD 58
           P+   DE       ++   VI G V+D++ ++ +HPGG  ++    GKD+T  F+
Sbjct: 380 PVWDKDEFMEKLKSNNGLVVISGIVHDVSGYITEHPGGETLIQASLGKDATKAFN 434

>CAGL0F03399g complement(333955..335097) highly similar to
          sp|Q03529 Saccharomyces cerevisiae YMR272c SCS7
          required for hydroxylation of ceramide, hypothetical
          start
          Length = 380

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 5  LITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLK 47
          L     +A+H+S+ DCW   H  K+YD++ +L  HP  A  + K
Sbjct: 13 LFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHK 56

>Scas_563.6
          Length = 497

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 4   PLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFD 58
           P+    E    +  +    VI G ++DI++++ +HPGG  ++ +  GKD+T  F 
Sbjct: 397 PVWDKKEFVEQAQLNKNLVVISGIIHDISNYIPEHPGGESLIKQALGKDATRAFQ 451

>Sklu_2299.3 YGL055W, Contig c2299 5338-6780 reverse complement
          Length = 480

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 31/55 (56%)

Query: 4   PLITMDEVARHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFD 58
           P+   +E  +    +    ++ G V+D++ ++ +HPGG  ++   AGKD+T  F+
Sbjct: 380 PVWDKEEFMKSLKSNPGLVIVSGIVHDVSGYITEHPGGETLIQAAAGKDATKAFN 434

>YGL055W (OLE1) [1924] chr7 (398629..400161) Stearoyl-CoA desaturase
           (delta-9 fatty acid desaturase), required for synthesis
           of unsaturated fatty acids [1533 bp, 510 aa]
          Length = 510

 Score = 34.3 bits (77), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 25/43 (58%)

Query: 15  SSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQF 57
           S  +    +I G V+D++ ++ +HPGG  ++    GKD+T  F
Sbjct: 421 SKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAF 463

>Kwal_14.1845
          Length = 288

 Score = 32.3 bits (72), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 24/37 (64%)

Query: 22  TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFD 58
            +I G V+D+++++ +HPGG  ++     KD+T  F+
Sbjct: 206 VIISGIVHDVSNYITEHPGGETLIKAALNKDATKAFN 242

>Kwal_47.16734
          Length = 792

 Score = 31.2 bits (69), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 18/65 (27%)

Query: 32  TSFLHKHPGGAQVLLKYAG----KDSTLQFDDIGHSMESLAYDLDPG---------ALKG 78
           T F   HP  A++L+ + G     + T +FDDIG     L+YD +P          A+ G
Sbjct: 125 TYFFDVHPPFAKMLIAFVGWLVGYNGTFKFDDIG-----LSYDSNPAPFVAYRSLSAILG 179

Query: 79  TLYLP 83
           TL +P
Sbjct: 180 TLTVP 184

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score = 30.4 bits (67), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 10/61 (16%)

Query: 32  TSFLHKHPGGAQVLLKYAG----KDSTLQFDDIGHSMES-----LAYDLDPGALKGTLYL 82
           T F   HP  +++L+ + G     D   +FDDIG+S E+     +AY     A+ GTL +
Sbjct: 90  TYFFDVHPPFSKMLIAFVGWLVGYDGAFKFDDIGYSYETHQVPYIAYR-SLSAILGTLTV 148

Query: 83  P 83
           P
Sbjct: 149 P 149

>AGR088W [4398] [Homologous to ScYLR087C (CSF1) - SH]
           complement(892686..901349) [8664 bp, 2887 aa]
          Length = 2887

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 13  RHSSRSDCWTVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDDIGHSMESLAYDLD 72
            H   + C TV+     D+T + +  PG A+V      ++  L+  ++ HS++ L YD +
Sbjct: 291 EHHEYAKCTTVLKADQMDVT-YSYGMPGTARVTDSDNAENPLLERPELDHSVDILVYDAN 349

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score = 28.9 bits (63), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 10/59 (16%)

Query: 34  FLHKHPGGAQVLLKY----AGKDSTLQFDDIGHSMES-----LAYDLDPGALKGTLYLP 83
           F   HP  A++++ +     G D + +FD+IG+S E+     +AY     A+ GTL +P
Sbjct: 97  FFDVHPPFAKMMIAFIGWLCGYDGSFKFDEIGYSYETHPAPYIAYR-SFNAILGTLTVP 154

>AEL043W [2463] [Homologous to ScYCR017C (CWH43) - SH]
           complement(553712..556573) [2862 bp, 953 aa]
          Length = 953

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 136 LFSTIIFFCVLTLGFIHWGHDHNIIDNNDYGVP 168
           LF++  F C L +G+    H H I+ N  YG P
Sbjct: 15  LFASSAFICALVVGYQL--HFHKIVRNAHYGYP 45

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.143    0.475 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,800,434
Number of extensions: 161824
Number of successful extensions: 520
Number of sequences better than 10.0: 49
Number of HSP's gapped: 513
Number of HSP's successfully gapped: 49
Length of query: 170
Length of database: 16,596,109
Length adjustment: 94
Effective length of query: 76
Effective length of database: 13,342,017
Effective search space: 1013993292
Effective search space used: 1013993292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 58 (26.9 bits)