Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27555g27925810371e-143
ADL084W2332134896e-61
Sklu_2260.42692194771e-58
Kwal_47.181722732154562e-55
Scas_704.423112224035e-47
YIL044C (AGE2)2981623954e-46
CAGL0L00825g2652223918e-46
Scas_677.6357761753e-14
Kwal_23.4569370741753e-14
KLLA0E06787g515681745e-14
CAGL0G05445g354741728e-14
ABL164C360741711e-13
ACL055W4711201692e-13
Sklu_2267.4359671664e-13
YDR524C (AGE1)4821121665e-13
Kwal_33.131018731141641e-12
KLLA0D18942g357671612e-12
YDL226C (GCS1)352691594e-12
AGL279C451661595e-12
Kwal_47.172483111321566e-12
Kwal_27.10676466721587e-12
Sklu_2181.34141251551e-11
Scas_707.333961281542e-11
YER122C (GLO3)493721515e-11
Scas_685.258771171517e-11
CAGL0H01617g349511481e-10
CAGL0G03707g486671491e-10
CAGL0L06028g5051261481e-10
YNL204C (SPS18)300731452e-10
AFR725C873541472e-10
Scas_672.9485671462e-10
YGL181W (GTS1)396811401e-09
Scas_602.104471311356e-09
KLLA0C17138g383811241e-07
CAGL0C02277g82340681.2
Scas_709.5858824635.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27555g
         (275 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27555g complement(2554571..2555410) some similarities with...   404   e-143
ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH] complement(...   192   6e-61
Sklu_2260.4 YIL044C, Contig c2260 5970-6779                           188   1e-58
Kwal_47.18172                                                         180   2e-55
Scas_704.42                                                           159   5e-47
YIL044C (AGE2) [2623] chr9 complement(272949..273845) GTPase-act...   156   4e-46
CAGL0L00825g complement(102709..103506) similar to sp|P40529 Sac...   155   8e-46
Scas_677.6                                                             72   3e-14
Kwal_23.4569                                                           72   3e-14
KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces c...    72   5e-14
CAGL0G05445g complement(514769..515833) similar to sp|P35197 Sac...    71   8e-14
ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C (S...    70   1e-13
ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH] complement(2...    70   2e-13
Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement         69   4e-13
YDR524C (AGE1) [1336] chr4 complement(1487530..1488978) ADP-ribo...    69   5e-13
Kwal_33.13101                                                          68   1e-12
KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces...    67   2e-12
YDL226C (GCS1) [649] chr4 complement(51116..52174) GTPase-activa...    66   4e-12
AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH] (182187..18...    66   5e-12
Kwal_47.17248                                                          65   6e-12
Kwal_27.10676                                                          65   7e-12
Sklu_2181.3 YGL181W, Contig c2181 6465-7709                            64   1e-11
Scas_707.33                                                            64   2e-11
YER122C (GLO3) [1552] chr5 complement(402867..404348) GTPase-act...    63   5e-11
Scas_685.25                                                            63   7e-11
CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces c...    62   1e-10
CAGL0G03707g complement(355469..356929) similar to sp|P38682 Sac...    62   1e-10
CAGL0L06028g complement(675584..677101) weakly similar to sp|P40...    62   1e-10
YNL204C (SPS18) [4399] chr14 complement(258374..259276) Sporulat...    60   2e-10
AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH] (1771660..1...    61   2e-10
Scas_672.9                                                             61   2e-10
YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger...    59   1e-09
Scas_602.10                                                            57   6e-09
KLLA0C17138g 1497245..1498396 some similarities with sp|P40956 S...    52   1e-07
CAGL0C02277g complement(230496..232967) weakly similar to sp|P18...    31   1.2  
Scas_709.58                                                            29   5.7  

>KLLA0F27555g complement(2554571..2555410) some similarities with
           sp|P40529 Saccharomyces cerevisiae YIL044c AGE2,
           hypothetical start
          Length = 279

 Score =  404 bits (1037), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 204/258 (79%), Positives = 204/258 (79%)

Query: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60
           MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV
Sbjct: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60

Query: 61  KSVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGTYVPDQSKIGQFIRTKYELKKWVG 120
           KSVDLDTWTEEHLEAVLEFG            LGGGTYVPDQSKIGQFIRTKYELKKWVG
Sbjct: 61  KSVDLDTWTEEHLEAVLEFGNNKKFNEYYENKLGGGTYVPDQSKIGQFIRTKYELKKWVG 120

Query: 121 DDPIVDVKSSKHTAEAKDRVAQKAAAVRNXXXXXXXXXXXXXXXXXXXXXXTDKNVPQIS 180
           DDPIVDVKSSKHTAEAKDRVAQKAAAVRN                      TDKNVPQIS
Sbjct: 121 DDPIVDVKSSKHTAEAKDRVAQKAAAVRNSPSSDSPRSLDLDLGLNLNSVVTDKNVPQIS 180

Query: 181 SEKPSATNTNVYRPPDRPDLKKSILSLYANRKXXXXXXXXXXXXXXXXXXXXKNMSTSNS 240
           SEKPSATNTNVYRPPDRPDLKKSILSLYANRK                    KNMSTSNS
Sbjct: 181 SEKPSATNTNVYRPPDRPDLKKSILSLYANRKSTSPHSQSQSPSQSSLHLPTKNMSTSNS 240

Query: 241 LSSGGKLTSNPWAVPRAV 258
           LSSGGKLTSNPWAVPRAV
Sbjct: 241 LSSGGKLTSNPWAVPRAV 258

>ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH]
           complement(536243..536944) [702 bp, 233 aa]
          Length = 233

 Score =  192 bits (489), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 125/213 (58%), Gaps = 27/213 (12%)

Query: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60
           MTSVEV++VL  LLRDP N +C DCK + HPRWASWSLGVFVCI+CAGFHRS+GTH+SKV
Sbjct: 1   MTSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKV 60

Query: 61  KSVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGTYVPDQSKIGQFIRTKYELKKWVG 120
           KSVDLDTW EEHL+ V+ FG            LGGG+YVPDQSK+GQFI+TKYE++KW  
Sbjct: 61  KSVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSYVPDQSKMGQFIKTKYEVRKWYL 120

Query: 121 DDPIVDVKSSKHTAEAKDR----VAQKAAAVRNXXXXXXXXXXXXXXXXXXXXXXTDKNV 176
           ++   +    +    A       V    A V                             
Sbjct: 121 EEGACEPALPEAAPAAASPLPVSVPMSPAGVGREASAS---------------------- 158

Query: 177 PQISSEKPSATNTNVYRPPDRPDLKKSILSLYA 209
           P ++   P+  +  VY    RPDLKKSILSLYA
Sbjct: 159 PALAVS-PAPASPPVYSANARPDLKKSILSLYA 190

>Sklu_2260.4 YIL044C, Contig c2260 5970-6779
          Length = 269

 Score =  188 bits (477), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 130/219 (59%), Gaps = 12/219 (5%)

Query: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60
           M+S +VKKVL TLLRDP+N RC DCKV++HPRW SWSLGVFVCIKCAG HRS+GTHISKV
Sbjct: 1   MSSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGTYVPDQSKIGQFIRTKYELKKWVG 120
           KSVDLDTW E+HL+ V+ +G            L  G++ PD SK+  FIRTKYELKKW G
Sbjct: 61  KSVDLDTWQEQHLQQVIRWGNNKRANLYYEAKL-QGSHTPDPSKLQSFIRTKYELKKWCG 119

Query: 121 DDPIVDVKSSKHTAEAKDRVAQKA--AAVRNXXXXXXXXXX-----XXXXXXXXXXXXTD 173
           +    +V S+  T  A + VA+ A  A VR                              
Sbjct: 120 E--ADEVLSATETTTAPNPVAETAPPALVREFSTGIPATTAPPVTTSSTSSSCSSSLLDL 177

Query: 174 KNVPQISSEKPSATNTNVYRPPDRPDLKKSILSLYANRK 212
              P  SS +   T+T+ Y    RP+LKKSILSLYA  K
Sbjct: 178 NLTPVASSTQQRVTHTHSYS--TRPELKKSILSLYAKPK 214

>Kwal_47.18172
          Length = 273

 Score =  180 bits (456), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 117/215 (54%), Gaps = 7/215 (3%)

Query: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60
           M+S  VKKVL+ LLRDP N  C DCK A HPRWASWSLGVF+CI+CAG HRS+GTHISKV
Sbjct: 1   MSSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKV 60

Query: 61  KSVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGTYVPDQSKIGQFIRTKYELKKWVG 120
           KSVDLDTW EEHL  V+EFG            L G  + PD SK+  FIR+KYELKKW+G
Sbjct: 61  KSVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSGN-HTPDASKLSDFIRSKYELKKWLG 119

Query: 121 DDPIVDVKSSKH----TAEAKDRVAQKAAAVRNXXXXXXXXXXXXXXXXXXXXXXTDKNV 176
                   +S      T    +R  +K    +                       +  ++
Sbjct: 120 SSANATTPASGSNSVVTNSKPERTQEKTQVSQQTHNSQTSLLSQTTSVSIGSGSSSQVDL 179

Query: 177 PQISSEKPSATNTN--VYRPPDRPDLKKSILSLYA 209
                  P+ T T+        RPDLKKSILSLY+
Sbjct: 180 NLAPPRAPTRTTTSQAARELNGRPDLKKSILSLYS 214

>Scas_704.42
          Length = 311

 Score =  159 bits (403), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 95/222 (42%), Positives = 119/222 (53%), Gaps = 14/222 (6%)

Query: 2   TSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVK 61
           TS  VKK LT LLRDP N+ C DCK+ +HPRWASWSLGVFVCIKCAG HRS+GTHI+KVK
Sbjct: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62

Query: 62  SVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGTY----VPDQSKIGQFIRTKYELKK 117
           SVDLDTW EEHLE +++              L   +     + D +K+  FIRTKYELKK
Sbjct: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKK 122

Query: 118 WVGDDPIVDVKSSKHTAEAKDRVAQKAAAVRNXXXX------XXXXXXXXXXXXXXXXXX 171
           WVG    V       T E   +++ ++ +  N                            
Sbjct: 123 WVGTPREVSEPPMSTTHEQVAKLSLESTSNPNSNSSSLLDIGSAAKKSVSANTNLKSTSL 182

Query: 172 TDKNVPQISSEKPSATNTNVYRP----PDRPDLKKSILSLYA 209
            +   P  S+E    T+++  R       RPDLKKSILSLY+
Sbjct: 183 LNLATPSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLYS 224

>YIL044C (AGE2) [2623] chr9 complement(272949..273845)
           GTPase-activating protein for Arf1p, has overlapping
           function with Gcs1p in transport from the trans-Golgi
           network (TGN), involved in endocytosis [897 bp, 298 aa]
          Length = 298

 Score =  156 bits (395), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 99/162 (61%), Gaps = 15/162 (9%)

Query: 2   TSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVK 61
           TSV VKK L+ LLRDP N+ C DCK   HPRWASWSLGVF+CIKCAG HRS+GTHISKVK
Sbjct: 3   TSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVK 62

Query: 62  SVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGT---YVPDQSKIGQFIRTKYELKKW 118
           SVDLDTW EEHL  +++F             L        + D S +  FI+ KYE KKW
Sbjct: 63  SVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRKITDTSSLQNFIKNKYEYKKW 122

Query: 119 VGD-----------DPIVDVKSSKHTAEAKD-RVAQKAAAVR 148
           +GD           +P++   S+ H+  A + R+ Q + +++
Sbjct: 123 IGDLSSIEGLNDSTEPVLHKPSANHSLPASNARLDQSSNSLQ 164

>CAGL0L00825g complement(102709..103506) similar to sp|P40529
           Saccharomyces cerevisiae YIL044c AGE2, hypothetical
           start
          Length = 265

 Score =  155 bits (391), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 90/222 (40%), Positives = 114/222 (51%), Gaps = 18/222 (8%)

Query: 1   MTSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKV 60
           MTSV VKK LTTLLRDP N  C DCK  +HPRWASWSLGVF+CIKCAG HRS+GTHISKV
Sbjct: 1   MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKV 60

Query: 61  KSVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXL------GGGTYVPDQSKIGQFIRTKYE 114
           KSVDLDTW EEHL+ +++              L       G +   D + + +FIR KYE
Sbjct: 61  KSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGKSLGNDINLLQEFIRQKYE 120

Query: 115 LKKWVG-------DDPIVDVKSSKHTAEAKDRVAQKAAAVRNXXXXXXXXXXXXXXXXXX 167
            K+W+        D P+V   +S  ++      +   +                      
Sbjct: 121 RKRWMDSSVDLSRDQPVVSQANSSSSSLVSTMSSSNESTNNTVAVEEKLKPQSTHSSSLL 180

Query: 168 XXXXTDKNVPQISSEKPSATNTNVYRPPDRPDLKKSILSLYA 209
                 + V      +P+  +T     P R DLKKSILSLY+
Sbjct: 181 NLQGRKEIVENKRPARPTQQDT-----PQRNDLKKSILSLYS 217

>Scas_677.6
          Length = 357

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 1/76 (1%)

Query: 5  EVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVD 64
          + ++ L  L +   N +C DC  A +P+WAS   GVF+C++CAG HRS+G HIS V+S+ 
Sbjct: 9  DTRRRLLQLQKIGANKKCVDCH-APNPQWASPKFGVFICLECAGTHRSLGVHISFVRSIT 67

Query: 65 LDTWTEEHLEAVLEFG 80
          +D +  E LE + + G
Sbjct: 68 MDQFKPEELERMEKGG 83

>Kwal_23.4569
          Length = 370

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 1/74 (1%)

Query: 7  KKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLD 66
          ++ L  L +   N +C DC+ A +P+WAS   G+F+C++CAG HR +G HIS V+S+ +D
Sbjct: 12 RRRLLQLQKVGSNKKCVDCE-APNPQWASPKFGIFICLECAGLHRGLGVHISFVRSITMD 70

Query: 67 TWTEEHLEAVLEFG 80
           +  E LE + + G
Sbjct: 71 QFKPEELERMEKGG 84

>KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces
          cerevisiae YER122c GLO3 zinc finger protein, start by
          similarity
          Length = 515

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 6  VKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDL 65
          V KV   L    EN  C DC  A +P W S   GV +CI C+G HR+MGTHI+ VKS +L
Sbjct: 17 VTKVFARLTTKSENRACFDCG-AKNPTWTSVPFGVLLCIDCSGEHRNMGTHITFVKSSNL 75

Query: 66 DTWTEEHL 73
          D WT  +L
Sbjct: 76 DKWTVNNL 83

>CAGL0G05445g complement(514769..515833) similar to sp|P35197
          Saccharomyces cerevisiae YDL226c GCS1 ADP-ribosylation
          factor GTPase-activating protein, start by similarity
          Length = 354

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 48/74 (64%), Gaps = 1/74 (1%)

Query: 7  KKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLD 66
          ++ L  L +   N +C DC  A +P+WAS   G+F+C++CAG HRS+G HIS V+S+ +D
Sbjct: 11 RRRLLQLQKIGANKKCVDCG-APNPQWASPKFGIFICLECAGTHRSLGVHISFVRSITMD 69

Query: 67 TWTEEHLEAVLEFG 80
           + +E L  + E G
Sbjct: 70 QFKQEELVRMEEGG 83

>ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C
          (SPS18) - SH] (91566..92648) [1083 bp, 360 aa]
          Length = 360

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%)

Query: 7  KKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLD 66
          ++ L  L +   N +C DC  A +P+WAS   G+F+C++CAG HR +G HIS V+S+ +D
Sbjct: 11 RRRLLQLQKLGGNKKCADCG-APNPQWASPKFGIFICLECAGIHRGLGVHISFVRSITMD 69

Query: 67 TWTEEHLEAVLEFG 80
           +  E LE +   G
Sbjct: 70 QFKPEELERMEHGG 83

>ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH]
           complement(267925..269340) [1416 bp, 471 aa]
          Length = 471

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 61/120 (50%), Gaps = 9/120 (7%)

Query: 2   TSVEVKKVLTTLLRDPEN-NRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSM-----GT 55
           +S  V++ L  L+  PEN NRCG+C  AT+P W S +LG F+C +CA  HR +     G 
Sbjct: 5   SSRTVERELKALVSSPENANRCGECG-ATYPTWCSVNLGAFLCGRCAAVHRKVLTGEQGG 63

Query: 56  HISKVKSVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGTY--VPDQSKIGQFIRTKY 113
             S VKS+ LD WT + LE +   G                 Y    D+S++  FIR KY
Sbjct: 64  PESHVKSLTLDRWTVDELEEITNSGGNRRNHHTWNVRNVAFPYDGDDDRSRVEDFIRNKY 123

>Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement
          Length = 359

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 7  KKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLD 66
          ++ L  L +   N +C DC  A +P+WAS   G+F+C++CAG HR +G HIS V+S+ +D
Sbjct: 12 RRRLLQLQKIGSNKKCIDCN-APNPQWASPKFGIFICLECAGIHRGLGVHISFVRSITMD 70

Query: 67 TWTEEHL 73
           +  E L
Sbjct: 71 QFKPEEL 77

>YDR524C (AGE1) [1336] chr4 complement(1487530..1488978)
           ADP-ribosylation factor (ARF) GTPase activating protein
           (GAP) with effector functions, involved in endocytosis
           and protein secretion [1449 bp, 482 aa]
          Length = 482

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 6/112 (5%)

Query: 16  DPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLDTWTEEHLEA 75
           D  N +C DC       W S +L   +CIKC+G HRS+G+HISK++S+ LD +T   L  
Sbjct: 180 DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMH 239

Query: 76  VLEFGXXXXXXXXXXXX------LGGGTYVPDQSKIGQFIRTKYELKKWVGD 121
           +L+                    +   T   D S+  +FI  KY+ KK+V D
Sbjct: 240 LLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSERSKFIIDKYQFKKFVID 291

>Kwal_33.13101
          Length = 873

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 6/114 (5%)

Query: 16  DPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLDTWTEEHLEA 75
           D  N  C DC  +    W S +L   +CI+C+  HRS+G+HISKV+S+ LD++T   ++ 
Sbjct: 575 DASNTTCCDCGDSNQVEWISINLLCVLCIQCSAVHRSLGSHISKVRSLLLDSFTSREIKE 634

Query: 76  VLEFGXXXXXXXXXXXXLGGGTYVPDQSKIG--QFIRTKYELKKWVG----DDP 123
           +L++             L   + +P  S     +FI  KY  KK+V     D+P
Sbjct: 635 LLKYVSNKNLNSIYEAELTQKSIIPGSSVADRTRFITDKYVSKKYVSPLQEDEP 688

>KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces
          cerevisiae YDL226c GCS1 ADP-ribosylation factor
          GTPase-activating protein (ARF-GAP), start by
          similarity
          Length = 357

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 7  KKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLD 66
          ++ L  L +   N +C DC  A +P+WAS   GVF+C++CAG HR +G HIS V+S+ +D
Sbjct: 11 RRRLLQLQKVGGNKKCLDCG-AHNPQWASPKFGVFICLECAGIHRGLGVHISFVRSITMD 69

Query: 67 TWTEEHL 73
           +  + L
Sbjct: 70 QFKSDEL 76

>YDL226C (GCS1) [649] chr4 complement(51116..52174)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in endocytosis,
          exocytosis, secretion, and mitochondrial and vacuolar
          organization, member of the Gcs1p/Glo3p/Sps18p family
          [1059 bp, 352 aa]
          Length = 352

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 5  EVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVD 64
          + ++ L  L +   N +C DC  A +P+WA+   G F+C++CAG HR +G HIS V+S+ 
Sbjct: 9  DTRRRLLQLQKIGANKKCMDCG-APNPQWATPKFGAFICLECAGIHRGLGVHISFVRSIT 67

Query: 65 LDTWTEEHL 73
          +D +  E L
Sbjct: 68 MDQFKPEEL 76

>AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH]
          (182187..183542) [1356 bp, 451 aa]
          Length = 451

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 8  KVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLDT 67
          ++ + L   PEN  C DC    +P W S   G+ +CI+C+G HR +G HI+ VKS +LD 
Sbjct: 17 EIFSKLNSKPENRTCFDCG-NKNPTWTSVPFGIMLCIQCSGEHRKLGVHITFVKSSNLDK 75

Query: 68 WTEEHL 73
          WT  +L
Sbjct: 76 WTINNL 81

>Kwal_47.17248
          Length = 311

 Score = 64.7 bits (156), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 19/132 (14%)

Query: 3   SVEVKKVLTTLLRDPEN-NRCGDCKVATHPRWASWSLGVFVCIKCAGFHRS-MGTH---- 56
           S   ++ L  +L  PEN N+CG+C   T P W S +LGVF+C +CA  HR+ +G      
Sbjct: 7   SKAAERELKNILNSPENGNKCGECG-NTFPTWCSINLGVFLCGRCASVHRNILGNRDDEI 65

Query: 57  ISKVKSVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGTYVP-------DQSKIGQFI 109
            S V+S+ +D W+   L+ + E G            L     VP       D+S + QF+
Sbjct: 66  YSDVRSLTMDRWSTRDLDEIAESG-----GNRRNRMLWNPQNVPFPFDGDEDKSAVEQFV 120

Query: 110 RTKYELKKWVGD 121
           R KY L K+  D
Sbjct: 121 REKYVLCKFRTD 132

>Kwal_27.10676
          Length = 466

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 2  TSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVK 61
          T  E  KV   L    +N  C DC    +P W S   GV +CI+C+  HR++G HI+ VK
Sbjct: 11 TKEETTKVFQKLASKQDNRACFDCGTK-NPTWTSVPFGVMLCIQCSAVHRNLGVHITFVK 69

Query: 62 SVDLDTWTEEHL 73
          S +LD WT  +L
Sbjct: 70 SSNLDKWTVNNL 81

>Sklu_2181.3 YGL181W, Contig c2181 6465-7709
          Length = 414

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 61/125 (48%), Gaps = 17/125 (13%)

Query: 6   VKKVLTTLLRDPEN-NRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSM------GTHIS 58
           V+K L  L+  PEN NRCG+C  A +P W S +LGVF+C +CA  HR +        H S
Sbjct: 9   VEKELKDLVNLPENGNRCGECG-APYPTWCSVNLGVFLCGRCASVHRKVLGNRDDDAH-S 66

Query: 59  KVKSVDLDTWTEEHLEAVLEFGXXXXXXX-----XXXXXLGGGTYVPDQSKIGQFIRTKY 113
            VKS+ LD W E  L+ V   G                   G     D+S + +FIR KY
Sbjct: 67  DVKSLTLDRWKESDLDCVNNGGGNRRNKSVWNPKDHPFPFDGDD---DKSAVEKFIRDKY 123

Query: 114 ELKKW 118
            L K+
Sbjct: 124 ILGKF 128

>Scas_707.33
          Length = 396

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 61/128 (47%), Gaps = 15/128 (11%)

Query: 6   VKKVLTTLLRDPEN-NRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTH-----ISK 59
           ++  L  LL  PEN N+CG+C  +T P W S +LGVF+C +CA  HR +         S 
Sbjct: 21  IENELRDLLNAPENANKCGECG-STFPTWCSINLGVFLCGRCASVHRKILNGREDDVFSN 79

Query: 60  VKSVDLDTWTEEHLEAVLEFGXXXXXX-----XXXXXXLGGGTYVPDQSKIGQFIRTKYE 114
           +KS+ LD W  + ++ + E G                   G     D+S +  FIR KY 
Sbjct: 80  LKSLSLDKWNNDDMDILAELGGNKGNHKFWNPKHEPFPFDGDD---DKSIVEHFIRDKYI 136

Query: 115 LKKWVGDD 122
           L K+  D+
Sbjct: 137 LGKFRYDE 144

>YER122C (GLO3) [1552] chr5 complement(402867..404348)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in retrograde
          transport between Golgi and ER as well as endocytosis
          [1482 bp, 493 aa]
          Length = 493

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 2  TSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVK 61
          T    ++V   L  + EN  C DC    +P W S   GV +CI+C+  HR+MG HI+ VK
Sbjct: 11 TEQTTQQVFQKLGSNMENRVCFDCG-NKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVK 69

Query: 62 SVDLDTWTEEHL 73
          S  LD WT  +L
Sbjct: 70 SSTLDKWTINNL 81

>Scas_685.25
          Length = 877

 Score = 62.8 bits (151), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 38/117 (32%), Positives = 52/117 (44%), Gaps = 22/117 (18%)

Query: 17  PENNRCGDCKVATHP-RWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLDTWTE----- 70
           P N RC DC  +     W S +L   VCIKC+G HRSMG HISK++S+ LD +T      
Sbjct: 590 PSNQRCCDCNTSDGTVEWISLNLLCLVCIKCSGVHRSMGAHISKIRSLTLDNFTSKEMIY 649

Query: 71  --------EHLEAVLEFGXXXXXXXXXXXXLGGGTYVPDQSKIGQFIRTKYELKKWV 119
                   E + ++ E G                      S+  Q+I  KY  KK++
Sbjct: 650 LIKNYISNEKVNSIYESGTNNTQTRISSNA--------TDSRRSQYINDKYRFKKFI 698

>CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces
          cerevisiae YDR524c AGE1, hypothetical start
          Length = 349

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%)

Query: 16 DPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLD 66
          D  N RC DC    +  W S +L   VCI+C+G HRS+G+HISKV+S+++D
Sbjct: 18 DESNKRCCDCGSRHNVDWVSINLLCVVCIQCSGVHRSLGSHISKVRSLNMD 68

>CAGL0G03707g complement(355469..356929) similar to sp|P38682
          Saccharomyces cerevisiae YER122c GLO3, hypothetical
          start
          Length = 486

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 7  KKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLD 66
          ++V T L    EN  C DC    +P W S   GV +CI+C+  HR++G HI+ VKS  LD
Sbjct: 14 QQVFTKLGSRLENRVCFDCG-NKNPTWTSVPFGVLLCIQCSAVHRNLGVHITFVKSSTLD 72

Query: 67 TWTEEHL 73
           WT  +L
Sbjct: 73 KWTVNNL 79

>CAGL0L06028g complement(675584..677101) weakly similar to sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1, start by
           similarity
          Length = 505

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 60/126 (47%), Gaps = 18/126 (14%)

Query: 10  LTTLLRDPEN-NRCGDCKVATHPRWASWSLGVFVCIKCAGFHRS-MGTH-------ISKV 60
           L  ++  PEN NRCG+C  A  P W S +LGVF+C +CA  HR  +GT         S V
Sbjct: 20  LKDIVNAPENGNRCGECGSAV-PTWCSTNLGVFLCGRCASVHRKILGTDPDEESGIFSNV 78

Query: 61  KSVDLDTWTEEHLEAVLEFGXXXXXX-----XXXXXXLGGGTYVPDQSKIGQFIRTKYEL 115
           KS+ ++ W  E +++V   G                   G     D+S + +F+R KY +
Sbjct: 79  KSLSMERWEAEDIDSVASSGGNKGNMRKWNPKNEPFPFDGDE---DKSAVERFVREKYII 135

Query: 116 KKWVGD 121
            K+  D
Sbjct: 136 GKYRND 141

>YNL204C (SPS18) [4399] chr14 complement(258374..259276)
          Sporulation-specific zinc finger protein involved in
          activation of sporulation, member of Gcs1p/Glo3p/Sps18p
          family of zinc-finger proteins [903 bp, 300 aa]
          Length = 300

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 4  VEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSV 63
          +E +K L    +   NN C +CK + +P++ S S G+F+C+ CA   R MGT+I  VKS+
Sbjct: 10 MENRKRLLRAKKAAGNNNCFECK-SVNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSI 68

Query: 64 DLDTWTEEHLEAV 76
           +D + E+ +  V
Sbjct: 69 TMDNFEEKDVRRV 81

>AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH]
           (1771660..1774281) [2622 bp, 873 aa]
          Length = 873

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 36/54 (66%)

Query: 16  DPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLDTWT 69
           DP N+ C DC+      W S ++   VCI C+G HRS+G H+SK++S+ LD+++
Sbjct: 559 DPSNSACCDCRSDKQVEWISLNILCVVCINCSGVHRSLGAHVSKMRSLTLDSFS 612

>Scas_672.9
          Length = 485

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 7  KKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVKSVDLD 66
          ++V   L    EN  C DC    +P W S   GV +CI+C+  HR++G HI+ VKS  LD
Sbjct: 16 QQVFQKLSSKLENRVCFDCG-NKNPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSTLD 74

Query: 67 TWTEEHL 73
           WT  +L
Sbjct: 75 KWTINYL 81

>YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger
          transcription factor of the Gcs1p/Glo3p/Sps18p family,
          involved in heat resistance, flocculation, timing of
          bud emergence, and regulation of biological rhythms
          [1191 bp, 396 aa]
          Length = 396

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 7/81 (8%)

Query: 6  VKKVLTTLLRDPEN-NRCGDCKVATHPRWASWSLGVFVCIKCAGFHRS-MGTH----ISK 59
          V + L  L+   EN N+CG+C    +P W S +LGVF+C +CA  HR   G+      S 
Sbjct: 13 VDRELKELINSSENANKCGECG-NFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSN 71

Query: 60 VKSVDLDTWTEEHLEAVLEFG 80
          VKS+ +D WT E ++ ++  G
Sbjct: 72 VKSLSMDRWTREDIDELVSLG 92

>Scas_602.10
          Length = 447

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 57/131 (43%), Gaps = 30/131 (22%)

Query: 3   SVEVKKVLTTLLRDPEN-NRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTH---IS 58
           S   ++ L   L   EN N+CG+C +  +P W S +  +F+C +CA  H+ +  H   +S
Sbjct: 5   SDSYQRELNRFLDSSENHNKCGECGLP-NPTWCSTTYNLFLCTRCATVHKKILNHDPDLS 63

Query: 59  KVKSVDLDTWTEEHLEAVLEFGXXXXXXXXXXXXLGGGTYVP-----------DQSKIGQ 107
            +KS+ LD WT + L   +                GG  Y             D +    
Sbjct: 64  IIKSIKLDYWTNDELNKFIN--------------SGGNAYNKRFWNPKDIKNFDDANWEN 109

Query: 108 FIRTKYELKKW 118
           F+R KY LKK+
Sbjct: 110 FLRDKYILKKF 120

>KLLA0C17138g 1497245..1498396 some similarities with sp|P40956
          Saccharomyces cerevisiae YGL181w GTS1 transcription
          factor of the GCS1P/GLO3P/SPS18P family singleton,
          hypothetical start
          Length = 383

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (56%), Gaps = 7/81 (8%)

Query: 6  VKKVLTTLLRDPEN-NRCGDCKVATHPRWASWSLGVFVCIKCAGFHRS-MGTH----ISK 59
          V+  L  LL   EN N+CG+C     P + S +LGVF+C +CA  HR  +G+      S 
Sbjct: 9  VEHDLKFLLNAGENSNKCGECGTP-FPTYCSVNLGVFLCGRCASVHRKVLGSREDGATSI 67

Query: 60 VKSVDLDTWTEEHLEAVLEFG 80
          VKS+ LD W++  ++ V + G
Sbjct: 68 VKSLSLDRWSKRDVQTVADLG 88

>CAGL0C02277g complement(230496..232967) weakly similar to sp|P18494
           Saccharomyces cerevisiae YER040w GLN3 transcription
           factor for positive nitrogen regulation, hypothetical
           start
          Length = 823

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 17/40 (42%)

Query: 16  DPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGT 55
           DP+   C +CK    P W     G  +C  C  F +  GT
Sbjct: 332 DPDAVHCDNCKTYKTPLWRRSPEGKVLCNACGLFQKLHGT 371

>Scas_709.58
          Length = 588

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 18/24 (75%)

Query: 106 GQFIRTKYELKKWVGDDPIVDVKS 129
           G+F+  KYELK+ V D P++ +++
Sbjct: 369 GEFLLCKYELKRHVKDQPMIKLRN 392

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.129    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,692,246
Number of extensions: 205064
Number of successful extensions: 402
Number of sequences better than 10.0: 37
Number of HSP's gapped: 381
Number of HSP's successfully gapped: 39
Length of query: 275
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 175
Effective length of database: 13,134,309
Effective search space: 2298504075
Effective search space used: 2298504075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 61 (28.1 bits)