Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27533g49849023870.0
ADL083C3541072328e-21
Kwal_23.57644621292271e-19
Sklu_2260.63991202205e-19
CAGL0J02904g543962163e-18
Scas_715.46570962121e-17
YER054C (GIP2)548962102e-17
Scas_704.41582991913e-15
CAGL0L00803g8271021801e-13
YIL045W (PIG2)5381141683e-12
YOR178C (GAC1)7931031051e-04
CAGL0H04037g91590910.005
Scas_659.2159481880.011
Scas_521.157981870.016
Kwal_56.2326242964860.019
AGR275C67962860.020
Scas_526.491563830.046
YLR273C (PIG1)648111810.088
KLLA0D09240g74877770.29
CAGL0F04917g68263721.1
KLLA0D15125g28293711.1
ADR012C131960665.3
KLLA0E19030g82128649.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27533g
         (490 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...   924   0.0  
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...    94   8e-21
Kwal_23.5764                                                           92   1e-19
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement        89   5e-19
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...    88   3e-18
Scas_715.46                                                            86   1e-17
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...    86   2e-17
Scas_704.41                                                            78   3e-15
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...    74   1e-13
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...    69   3e-12
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    45   1e-04
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    40   0.005
Scas_659.21                                                            39   0.011
Scas_521.1                                                             38   0.016
Kwal_56.23262                                                          38   0.019
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    38   0.020
Scas_526.4                                                             37   0.046
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    36   0.088
KLLA0D09240g complement(775848..778094) some similarities with s...    34   0.29 
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    32   1.1  
KLLA0D15125g 1275978..1276826 weakly similar to sgd|S0006320 Sac...    32   1.1  
ADR012C [1753] [Homologous to ScYER008C (SEC3) - SH] (725113..72...    30   5.3  
KLLA0E19030g 1684751..1687216 weakly similar to sp|P53148 Saccha...    29   9.1  

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/490 (92%), Positives = 451/490 (92%)

Query: 1   MYQRDAVQNLQSGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDS 60
           MYQRDAVQNLQSGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDS
Sbjct: 1   MYQRDAVQNLQSGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDS 60

Query: 61  QHDEHDPVGNELAGRLNEKLNFNKDADPSKKEDWDVETDPLKKEAWESETDPSLSMQDYF 120
           QHDEHDPVGNELAGRLNEKLNFNKDADPSKKEDWDVETDPLKKEAWESETDPSLSMQDYF
Sbjct: 61  QHDEHDPVGNELAGRLNEKLNFNKDADPSKKEDWDVETDPLKKEAWESETDPSLSMQDYF 120

Query: 121 PVSKPDVPEVEIXXXXXXXXXXXXXEPEDRYLDSRKLSAIFNPPSILLTRSKSLPTSPLE 180
           PVSKPDVPEVEI             EPEDRYLDSRKLSAIFNPPSILLTRSKSLPTSPLE
Sbjct: 121 PVSKPDVPEVEINNNSNDDNDDDDDEPEDRYLDSRKLSAIFNPPSILLTRSKSLPTSPLE 180

Query: 181 GRVSQEQRPPVFKRSKSVHFAQSEKFEVKYFREDESPLFLRNESGEYGTKSGKLRKSRRH 240
           GRVSQEQRPPVFKRSKSVHFAQSEKFEVKYFREDESPLFLRNESGEYGTKSGKLRKSRRH
Sbjct: 181 GRVSQEQRPPVFKRSKSVHFAQSEKFEVKYFREDESPLFLRNESGEYGTKSGKLRKSRRH 240

Query: 241 RSREAVAKVNGXXXXXXMLNMKGSKRSLELVNGNLILQAQTPKLLRLDVFGVRKNQFQTF 300
           RSREAVAKVNG      MLNMKGSKRSLELVNGNLILQAQTPKLLRLDVFGVRKNQFQTF
Sbjct: 241 RSREAVAKVNGDDDDDDMLNMKGSKRSLELVNGNLILQAQTPKLLRLDVFGVRKNQFQTF 300

Query: 301 ANGIYNSMNTPNSGWSNSLHSNNAPFWKYSHGIXXXXXXXXXXXXXXXXXXXXTTGIPNF 360
           ANGIYNSMNTPNSGWSNSLHSNNAPFWKYSHGI                    TTGIPNF
Sbjct: 301 ANGIYNSMNTPNSGWSNSLHSNNAPFWKYSHGINDNDDNDNNNNNNKNEDDANTTGIPNF 360

Query: 361 DFSSPFNTNDSFKKEANLGTFICHLQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDS 420
           DFSSPFNTNDSFKKEANLGTFICHLQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDS
Sbjct: 361 DFSSPFNTNDSFKKEANLGTFICHLQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDS 420

Query: 421 WKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAIDLGKINTIEHIEMCILYQTREGSSWI 480
           WKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAIDLGKINTIEHIEMCILYQTREGSSWI
Sbjct: 421 WKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAIDLGKINTIEHIEMCILYQTREGSSWI 480

Query: 481 DHWDNNSGQN 490
           DHWDNNSGQN
Sbjct: 481 DHWDNNSGQN 490

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score = 94.0 bits (232), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 67/107 (62%), Gaps = 5/107 (4%)

Query: 385 LQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGA 444
           LQDL LD+   ++ G V+V+NI Y+K VIVRYT D+W    D  SVWI++   +  G   
Sbjct: 246 LQDLSLDSM-LVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGK-- 302

Query: 445 IDIDVFQFAIDL-GKINTIEHIEMCILYQTREGSSWIDHWDNNSGQN 490
            D+D+F+FAID+   ++    +E CI YQ R+ S +  HWDNN G N
Sbjct: 303 -DMDLFEFAIDVPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNN 348

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (67%)

Query: 11 QSGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSK 50
          Q GK+SSL  LRKPQRIS + E     + LKRNTD N+ +
Sbjct: 20 QEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYNRKR 59

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 170 RSKSLPTSPLEGRVSQEQRPPVFKRSKSVHFAQSEKFEVKYFREDESPLFL 220
           RS SLP +P     S  +RP   +RSKSVHF   +   VKYF  DES L +
Sbjct: 106 RSNSLPGTP----TSALKRPGGVRRSKSVHFDNRDVVSVKYFNSDESTLLV 152

>Kwal_23.5764
          Length = 462

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 75/129 (58%), Gaps = 24/129 (18%)

Query: 383 CHLQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGT 442
           C LQ+L L    H L+G+V+V+N+ YEK V+VRYT DSW++ +D+E VW ++  ++  G 
Sbjct: 315 CFLQELSLIGDQHYLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPG- 373

Query: 443 GAIDIDVFQFAIDLGKI--------NTIEH-------------IEMCILYQTREGSSWID 481
             + +D F+  IDL  +        +T  H             ++ CI Y +R+ +S ++
Sbjct: 374 --MHMDRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVE 431

Query: 482 HWDNNSGQN 490
           +WDNN+G+N
Sbjct: 432 YWDNNAGRN 440

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 98/229 (42%), Gaps = 46/229 (20%)

Query: 1   MYQRDAVQNLQ----SGKFS--SLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVD 54
           MY R    +L+    +G F+  SL FL KPQR++ Q      ++ L+RNTD+N+  + V+
Sbjct: 1   MYIRRPPSDLRREGSNGAFTDRSLAFLHKPQRVT-QPRALYADEWLRRNTDMNRGNVKVE 59

Query: 55  KSLQD--SQHDEHDPVGNELAGRLNEKLNFNKDADPSKKEDWDVETDPLKKEAWESETDP 112
              +D  SQ+ + D    + A   +E   F                DP    A   +T  
Sbjct: 60  NCPEDYFSQNFKGDGPTKQTAA--SEANGF----------------DPSASNASAGDTAS 101

Query: 113 SLSMQDYFPVSKPDVPEVEIXXXXXXXXXXXXXEPEDRYLDSRKLSAIFNPPSILLTRSK 172
            L +  YFP  +  V                   P    L  +K   +  P   +  RS+
Sbjct: 102 PLRVNPYFPAEEDSV------------VADAAAPP----LVRKKSGEVVRPSLKMAQRSR 145

Query: 173 SLPTSPLEGRVSQE-QRPPVF--KRSKSVHFAQSEKFEVKYFREDESPL 218
           SLP +P +    +    PP    KRSKSVHF Q +  + KYF +++SPL
Sbjct: 146 SLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQEDSPL 194

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 73/120 (60%), Gaps = 18/120 (15%)

Query: 385 LQDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGA 444
           LQDL L   G+ ++G V+V+NI Y+K+VIVRYT D W +  DV+ VW ++   +  G   
Sbjct: 263 LQDLSLLGDGNYVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPG--- 319

Query: 445 IDIDVFQFAIDLGKINTIE--------------HIEMCILYQTREGSSWIDHWDNNSGQN 490
           +++D+F+F +D+  +++ E               ++ CI Y TR+G+   +HWDNN+G+N
Sbjct: 320 MNMDMFKFVVDV-PVDSAEATLATTDPDKEGGREVQFCIRYTTRDGNYREEHWDNNNGKN 378

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 7/53 (13%)

Query: 170 RSKSLPTSPLEGRVSQEQ----RPPVFKRSKSVHFAQSEKFEVKYFREDESPL 218
           RSKSLP +P  GR  + +     PP  KRSKSVHF Q +   VKYF++DE P+
Sbjct: 112 RSKSLPATPT-GREPRTEIIIMEPP--KRSKSVHFDQRDVVSVKYFQKDERPV 161

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 2/49 (4%)

Query: 1  MYQRDAVQNLQS-GKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNK 48
          MY +    N     K  SL+FL KPQR++ Q++T    D+L+RNT+LN+
Sbjct: 1  MYIKKLTNNYSGENKPRSLDFLHKPQRVT-QLKTLYAEDSLQRNTNLNR 48

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 61/96 (63%), Gaps = 3/96 (3%)

Query: 396 MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAI- 454
           +L G V+V+NI ++KRV++RYT D W++ QDVE VW+++   L  G  A  +DVF F I 
Sbjct: 431 LLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAA--MDVFHFVID 488

Query: 455 DLGKINTIEHIEMCILYQTREGSSWIDHWDNNSGQN 490
           D  K      +E CI Y TR+ +  ++ WDNN G+N
Sbjct: 489 DATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKN 524

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 91/226 (40%), Gaps = 70/226 (30%)

Query: 12  SGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDSQHDEHDPVGNE 71
           SGK +SL FL KPQR+S   +     + L RNT LNK+   VD + ++      D   +E
Sbjct: 37  SGKLTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASE 96

Query: 72  LAGRLNEKLNFNKDADPSKKEDWDVETDPLKKEAWESETDPSLSMQDYFPVS-KPDVPEV 130
                                         +++A +          D  P+S K  +PE+
Sbjct: 97  ------------------------------RQQARD----------DLIPLSPKSTLPEL 116

Query: 131 EIXXXXXXXXXXXXXEPEDRYLDSRKLS---AIFNPP----------SILLTRSKSLPTS 177
           +                 D  LDS   S   A F+PP          S+L  RSKSLP +
Sbjct: 117 DTNML-------------DNTLDSDNSSNDLAPFSPPVYKKSGEPVKSVLKRRSKSLPGT 163

Query: 178 P-LEGRVSQEQRPPVFKRSKSVHFAQSEKFEVKYFREDESPLFLRN 222
           P L   +     P    RSKSVHF Q+    V+YF E+E P+ + N
Sbjct: 164 PGLNTSMHGASPPNKLMRSKSVHFDQTA--PVRYFNENERPIDVSN 207

>Scas_715.46
          Length = 570

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 62/96 (64%), Gaps = 4/96 (4%)

Query: 396 MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAI- 454
           ++ G ++V+NI Y+KRVIVRYT + W++  DVE +W+++   +  GT   ++DVF+F I 
Sbjct: 461 LITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGT---NMDVFRFLID 517

Query: 455 DLGKINTIEHIEMCILYQTREGSSWIDHWDNNSGQN 490
           D  K+     +E CI Y  R  +  +++WDNN G+N
Sbjct: 518 DANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKN 553

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 78/211 (36%), Gaps = 59/211 (27%)

Query: 15  FSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDSQHDEHDPVGNELAG 74
            +S++FL KPQR++         + +KRNTDLNK+  +V      S   + +  G E   
Sbjct: 87  LNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTSG---SVAKDEEETGREYMS 143

Query: 75  RLNEKLNFNKDADPSKKEDWDVETDPLKKEAWESETDPSLSMQDYFPVSKPDV-PEVEIX 133
                                                         P+  P++ P   I 
Sbjct: 144 ----------------------------------------------PIDLPEISPRSTIQ 157

Query: 134 XXXXXXXXXXXXEPEDRYLDSRKLSAIFNPPSILLT-----RSKSLPTSP--LEGRVSQE 186
                         ++RY     LS I+     LL      RSKSLP++   L+  +  E
Sbjct: 158 SSEFIQNNKTQEGVDERYDGITPLSPIYKKSGELLKSSLKRRSKSLPSTSEILQKSLRFE 217

Query: 187 QRPPVFKRSKSVHFAQSEKFEVKYFREDESP 217
                  RSKSVHF Q  K  VKYFREDESP
Sbjct: 218 NDAMEMVRSKSVHFDQ--KAPVKYFREDESP 246

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 63/96 (65%), Gaps = 4/96 (4%)

Query: 396 MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAI- 454
           ++ G ++V+NI Y+KRV+VRYT DSW++  +VE V+I++   +  GT   ++D+F F I 
Sbjct: 438 LIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISDGDGILPGT---NMDIFHFIID 494

Query: 455 DLGKINTIEHIEMCILYQTREGSSWIDHWDNNSGQN 490
           D+ K++    +E CI Y TR      ++WDNN+G N
Sbjct: 495 DVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNN 530

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 94/211 (44%), Gaps = 33/211 (15%)

Query: 15  FSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDSQHDEHDPVGNELAG 74
            +SL FL KPQR++         + ++RNTDLNK       S  + ++ +++   +++A 
Sbjct: 56  LNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIF----SAGNDENVDNESGWSKIAA 111

Query: 75  RLN----EKLNFNKDADPSKKEDWDVETDPLKKEAWESETDPSLSMQDYFPVSKPDVPEV 130
             N    E LN       S +  + +E  PL  ++    T P  S Q  +P +K   P  
Sbjct: 112 AKNHTSVESLN------GSTRPPFKIELPPLSPKS----TVPK-SFQAEYPEAK--SPGN 158

Query: 131 EIXXXXXXXXXXXXXEPEDRYLDSRKLSAIFNPPSILLTRSKSLPTSP---LEGRVSQEQ 187
           ++              P   Y  S +L       S L  RSKSLPT+P       V    
Sbjct: 159 DMNFEYDEEILIPFAPP--VYKKSGELLK-----SSLKRRSKSLPTTPGIRSGNGVQARD 211

Query: 188 RPPVFKRSKSVHFAQSEKFEVKYFREDESPL 218
             P+  RSKSVHF Q+    VKYF EDESP+
Sbjct: 212 GSPMLIRSKSVHFDQAA--PVKYFAEDESPI 240

>Scas_704.41
          Length = 582

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 64/99 (64%), Gaps = 4/99 (4%)

Query: 393 QGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQF 452
           Q   +IG  +V NI ++K+V+++YT D+W+S +D+E++++++   +  G+   ++DVF+F
Sbjct: 468 QNKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGS---NMDVFKF 524

Query: 453 AI-DLGKINTIEHIEMCILYQTREGSSWIDHWDNNSGQN 490
            I D+ K  +  H+E CI YQTR      + WDNN  +N
Sbjct: 525 LIDDVNKSVSKCHLEFCIQYQTRNEKERKEFWDNNDDKN 563

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 98/221 (44%), Gaps = 62/221 (28%)

Query: 15  FSSLNFLRKPQRISCQVETTAM-NDALKRNTDLNKSKIIVDKSLQDSQHDEHDPVGNELA 73
           FSSLNFL++P+++  Q++  A+  + L+RNT+LNK+   +   ++        P   + +
Sbjct: 97  FSSLNFLQEPRKLD-QLKLNALPQEELRRNTNLNKNINPIPTPIK--------PTIYKNS 147

Query: 74  GRLNEKLNFNKDADPSKKEDWDVETDPLKKEAWESETDPSLSMQDYFPVSKPDVPEVEIX 133
             LN+    + DA   ++E+ D E  P+ +    ++          FPV           
Sbjct: 148 YYLNDN---DTDAFKEEQENED-EISPITQVPANAKIP--------FPV----------- 184

Query: 134 XXXXXXXXXXXXEPEDRYLDSRKLSAIFNPPSILLT-----RSKSLPTSP---------L 179
                        P + Y++  ++  ++     LL      RS+SLP +P         +
Sbjct: 185 -------------PNNAYMEVNRIKPVYKKSGELLKPSLKRRSQSLPVTPNISNLNLRRI 231

Query: 180 EGRVSQEQRPPVFKRSKSVHFAQSEKFEVKYFREDESPLFL 220
            G  +   R     RSKSVHFA +    V++F +DESP+ +
Sbjct: 232 NGHANGNDRAHHLARSKSVHFANT--LPVRFFSKDESPIIV 270

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 64/102 (62%), Gaps = 10/102 (9%)

Query: 396 MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAID 455
           ++ G V+V+NI ++K+V +RYT D W+S  +VES+++ +  N   G+    +D+F+F ID
Sbjct: 723 IITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSGNNYLPGS---QMDIFRFMID 779

Query: 456 LGKINTIEHI-------EMCILYQTREGSSWIDHWDNNSGQN 490
              ++  +++       E CI Y TR  ++  ++WDNN+G+N
Sbjct: 780 NTVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWDNNNGKN 821

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 102/239 (42%), Gaps = 60/239 (25%)

Query: 13  GKFSSLNFLRKPQRIS-CQVETTAMNDALKRNTDLNK----SKIIVDKSLQDSQHDEHDP 67
           G+ +SL+FL KPQR++  + E     + LKRNTD+NK    +KI+ D  + D   D   P
Sbjct: 308 GRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDKIDDITTP 367

Query: 68  VGNELAGRLNE--KLNF-----NKDADPSKKEDWDVETD------------PLKKEAWES 108
              E+ G  +E  K++      N  A  S K +  +E              P+   A ++
Sbjct: 368 -EEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEHHYPILNRANQA 426

Query: 109 ETDPSLSMQDYF---PVSKPDVPEVEIXXXXXXXXXXXXXEPEDRYLDSRKLSAIFNPPS 165
           + D  L + D +   PV    +P   +                  Y  S +L       S
Sbjct: 427 QQDVCLPLHDSYDQSPVEDHMMPLPPV------------------YKKSGELVK-----S 463

Query: 166 ILLTRSKSLPTSPLEGRVSQEQRPPVFK-------RSKSVHFAQSEKFEVKYFREDESP 217
            L  RSKSLP +P   R +Q  R            RSKSVHF Q  +  VKYF ++ESP
Sbjct: 464 SLKRRSKSLPVTPNSNRRTQNSRGVRMNNPRDQLIRSKSVHFDQ--RLPVKYFFKEESP 520

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 67/114 (58%), Gaps = 11/114 (9%)

Query: 385 LQDLRLDTQGH--MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGT 442
           LQ++ L T  H  ++IG V V+NI ++K++IVRYT D+W++  + E V+ +N   +  G+
Sbjct: 394 LQEITLLTGFHNMVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGS 453

Query: 443 GAIDIDVFQFAID-----LGKINTIEHIEMCILYQT-REGSSWIDHWDNNSGQN 490
              ++D+F+F+ID       K + I  +E CI Y T     S  ++WDNN   N
Sbjct: 454 ---NMDIFKFSIDDIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSAN 504

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 82/213 (38%), Gaps = 46/213 (21%)

Query: 10  LQSGKFSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDSQHDEHDPVG 69
           +   + +SL FL KP+R+S         D L+RNTD+NK      K +       H P  
Sbjct: 45  MHPARLNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVH-----AHHPF- 98

Query: 70  NELAGRLNEKLNFNK-DADPSKKEDWDVETDPLKKEAWESETDPSLSMQDYFPVSKPDVP 128
                 +N   NFN    D SK  + + E  PL  + ++ E++ +           P  P
Sbjct: 99  ------INSGANFNAHHQDVSKLGEEEDEISPLSHDNFQYESEEN---------GNPSPP 143

Query: 129 EVEIXXXXXXXXXXXXXEPEDRYLDSRKLSAIFNPPSIL---LTRSKSLPTSPLEGRVSQ 185
                            E     L  R  S    P SI     ++SK +    ++ R+ Q
Sbjct: 144 -----------IYKKSGELVKSSLKRRSKSLPITPKSIFNKTGSKSKHVNLDHVDTRLLQ 192

Query: 186 EQRPPVFKRSKSVHFAQSEKFEVKYFREDESPL 218
                   RSKSVHF +     +K F E+E P+
Sbjct: 193 --------RSKSVHFDRV--LPIKLFNENEKPI 215

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 56/103 (54%), Gaps = 13/103 (12%)

Query: 397 LIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVW-ITNHCNLKSGTGAIDIDVFQFAID 455
           + G V V+N+S+EK + +++T +SW+    V + +  T + N+      ID++  ++ + 
Sbjct: 258 ITGLVYVKNLSFEKYLEIKFTFNSWRDIHYVTANFNRTINSNVDEFKFTIDLNSLKYILL 317

Query: 456 LGKINTIE--------HIEMCILYQTREGSSWIDHWDNNSGQN 490
           + +I T+E        +IE+C  Y     +    ++DNN+G+N
Sbjct: 318 IKRIITMEKNTSSCPLNIELCCRYDVNNET----YYDNNNGKN 356

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 52/90 (57%), Gaps = 11/90 (12%)

Query: 386 QDLRLDTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAI 445
           QD  +D +   ++G ++V+N++YEK + V+YT ++W    D+   +IT +    + + + 
Sbjct: 290 QDSTIDDK---IVGKILVKNLNYEKFIEVKYTFNNW---NDIH--YITAYF---TKSISA 338

Query: 446 DIDVFQFAIDLGKINTIEHIEMCILYQTRE 475
           +ID F+F I+L  +  I   +  + +++ +
Sbjct: 339 EIDEFEFKINLSSLKYILQFKRILQFKSND 368

>Scas_659.21
          Length = 594

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 9/81 (11%)

Query: 391 DTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVF 450
           D Q   L+G ++V NI +EK + V++T ++W++    +  +     N+K        D F
Sbjct: 217 DGQAFKLVGLILVNNIQFEKNIEVKFTFNNWENIC-YQVAYFNRSLNVK-------FDEF 268

Query: 451 QFAIDLGKINTIEHIEMCILY 471
           +F IDL    ++  ++  ILY
Sbjct: 269 KFTIDLTSFKSLLKLQK-ILY 288

>Scas_521.1
          Length = 579

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 9/81 (11%)

Query: 391 DTQGHMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVF 450
           D Q   L+G ++V NI +EK + V++T ++W++    +  +     N K        D F
Sbjct: 199 DGQAFKLVGLILVNNIQFEKNIEVKFTFNNWENIC-YQVAYFNRSLNAK-------FDEF 250

Query: 451 QFAIDLGKINTIEHIEMCILY 471
           +F IDL    ++  ++  ILY
Sbjct: 251 KFTIDLTSFKSLLKLQK-ILY 270

>Kwal_56.23262
          Length = 429

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 8/64 (12%)

Query: 397 LIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAIDL 456
           L G + V N+++EK + +++T ++W+   DV  V   +H   +S T A  ID F+F IDL
Sbjct: 36  LQGLIYVANLNFEKSLEIKFTFNNWR---DVHYVAAHHH---RSITDA--IDEFKFTIDL 87

Query: 457 GKIN 460
             ++
Sbjct: 88  AGLS 91

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 8/62 (12%)

Query: 395 HMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAI 454
           H + G++ V N+ +EK + V+++ D WK+   V + +      LK+ T    +D FQF I
Sbjct: 284 HTIKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQY------LKTVTS--KVDEFQFII 335

Query: 455 DL 456
           DL
Sbjct: 336 DL 337

>Scas_526.4
          Length = 915

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 8/63 (12%)

Query: 397 LIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAIDL 456
           LIG + V N+++EK + ++++ + WK   D+   ++T   N KS T   +ID F+F IDL
Sbjct: 308 LIGLIYVNNLNFEKFIEIKFSFNHWK---DIH--YVTAFLN-KSVTS--NIDEFKFVIDL 359

Query: 457 GKI 459
             +
Sbjct: 360 NSL 362

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 35.8 bits (81), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 28/111 (25%)

Query: 399 GNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAIDLG- 457
           G + V N+++EK++ +++TL++W    D+   +I  H N KS T    +D F+F ID+  
Sbjct: 226 GLIFVNNLNFEKKIEIKFTLNNW---ADIH--YINAHYN-KSVTPH--VDEFKFIIDISA 277

Query: 458 -KINTIE-----------------HIEMCILYQTREGSSWIDHWDNNSGQN 490
            K+N I                  +++ C  Y    G  +   +DNN  +N
Sbjct: 278 LKLNLISKNLIYTNFFERKTTCLLNLQFCCRYDVN-GFEYRSFYDNNDYKN 327

>KLLA0D09240g complement(775848..778094) some similarities with
           sp|P28006 Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, regulatory chain,
           hypothetical start
          Length = 748

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 8/77 (10%)

Query: 397 LIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAIDL 456
           L G + V N+S+EK + ++++ + WK   D+  V      N K  T    +D FQF I+L
Sbjct: 472 LTGLIYVNNLSFEKFIEIKFSFNGWK---DIHYVT----ANFKR-TITDTVDEFQFLINL 523

Query: 457 GKINTIEHIEMCILYQT 473
                   ++  IL+ +
Sbjct: 524 SSFVYFLKVKNLILFNS 540

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 14/63 (22%)

Query: 397 LIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVW---ITNHCNLKSGTGAIDIDVFQFA 453
           L G + V N+++EK + V+++ ++WK      + +   IT+H           ID F+F 
Sbjct: 192 LKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITDH-----------IDEFRFT 240

Query: 454 IDL 456
           ID+
Sbjct: 241 IDV 243

>KLLA0D15125g 1275978..1276826 weakly similar to sgd|S0006320
           Saccharomyces cerevisiae YPR116w hypothetical protein,
           start by similarity
          Length = 282

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 9/93 (9%)

Query: 9   NLQSGKFSS-----LNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIVDKSLQDSQHD 63
           N++SGK SS     L   +  +    Q+  TA+ND+   N  L  S I++DKSL   +H 
Sbjct: 118 NMKSGKSSSYVANSLKIFKGKKPGLGQLVPTAVNDSGIANISL--SDIVLDKSLFTEKHQ 175

Query: 64  EHDPVGNELAGRLNEKLNFNKDADPSKKEDWDV 96
           E   +   +   + + ++  K + P   EDWDV
Sbjct: 176 EE--LLQCIENCMTQLVDRRKSSVPVVVEDWDV 206

>ADR012C [1753] [Homologous to ScYER008C (SEC3) - SH]
           (725113..729072) [3960 bp, 1319 aa]
          Length = 1319

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 2/60 (3%)

Query: 64  EHDPVGNELAGRLNEKLNFNKDADPSKKEDWDVETDPLKKEA--WESETDPSLSMQDYFP 121
           E+D    EL G L   L+ N+D  PS    +  E  P KKE    E+   P L     FP
Sbjct: 495 ENDRYMEELDGALRSSLDINRDHSPSNINTFSDEPSPYKKETNMQEAPAAPMLEAIRKFP 554

>KLLA0E19030g 1684751..1687216 weakly similar to sp|P53148
           Saccharomyces cerevisiae YGL093w SPC105 spindle pole
           body protein singleton, start by similarity
          Length = 821

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 445 IDIDVFQFAIDLGKINTIEHIEMCILYQ 472
           +D  + +F IDL   N IEH+   I+YQ
Sbjct: 379 VDTQINEFQIDLKSTNNIEHVPSNIIYQ 406

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,118,150
Number of extensions: 687792
Number of successful extensions: 1751
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1768
Number of HSP's successfully gapped: 52
Length of query: 490
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 384
Effective length of database: 12,926,601
Effective search space: 4963814784
Effective search space used: 4963814784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)