Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27511g62361332460.0
Kwal_23.576962760320050.0
ADL082C56955719250.0
CAGL0L00781g67366219180.0
YIL046W (MET30)64058218900.0
Scas_704.4060863118520.0
YCR072C5153333106e-30
Scas_720.955153842947e-28
Sklu_2173.25153332851e-26
Kwal_23.63245143382851e-26
AER263C5133592823e-26
KLLA0C08547g5153152761e-25
CAGL0J03476g5173592734e-25
KLLA0F11231g4342832591e-23
CAGL0H03729g3033062522e-23
Sklu_2420.24412832554e-23
AEL246C8152892586e-23
AFR199C3341912487e-23
Kwal_26.87764333122502e-22
YDL145C (COP1)12012742552e-22
KLLA0E23529g8262842523e-22
ACR137W4252622447e-22
Kwal_23.50357445442498e-22
Scas_721.115*3181892399e-22
ADR077C12042742491e-21
Scas_721.328223062481e-21
Scas_592.4*3181892372e-21
Scas_695.153273162372e-21
Kwal_56.2452612102742472e-21
Sklu_2431.127492612453e-21
KLLA0F04884g12122742463e-21
KLLA0D04840g3033022334e-21
YPL151C (PRP46)4513132386e-21
CAGL0M05335g8063032418e-21
CAGL0I03718g12012752401e-20
YJL112W (MDV1)7143122372e-20
YNL006W (LST8)3033012282e-20
KLLA0D07546g6475032363e-20
YBR198C (TAF5)7982862363e-20
Kwal_27.120537553152363e-20
Sklu_2442.23033022263e-20
YMR116C (ASC1)3191832274e-20
Scas_707.227305642345e-20
Kwal_0.2123033072247e-20
Scas_624.1112052752321e-19
KLLA0E12287g3261982231e-19
Kwal_26.75702181682171e-19
AAL009C3033022212e-19
YFL009W (CDC4)7793822283e-19
CAGL0L02629g7955692264e-19
CAGL0M02277g4272782208e-19
CAGL0G04345g7112662175e-18
AEL314W7152612151e-17
Scas_711.116952952122e-17
AGL024W7563422122e-17
Scas_630.66212592104e-17
AGL234W6292652078e-17
KLLA0F21406g7052532032e-16
Kwal_27.126677212752032e-16
CAGL0C02937g4672912004e-16
Scas_603.55892591997e-16
Kwal_27.115858233331999e-16
CAGL0L03201g5792721971e-15
AEL269C4551661952e-15
AFL118W8322021962e-15
CAGL0C03608g6433381943e-15
CAGL0D02090g2771791864e-15
YLR222C (UTP13)8173021901e-14
CAGL0C00737g8162811901e-14
YGL137W (SEC27)8892771872e-14
Scas_679.288152741846e-14
KLLA0F10263g6821991837e-14
AER448W7141761829e-14
Kwal_23.62409133001839e-14
Scas_629.126712081811e-13
CAGL0H08932g9022741811e-13
Scas_558.37251651802e-13
KLLA0B01958g8901801802e-13
YCR084C (TUP1)7132691792e-13
CAGL0L10890g4573681772e-13
YCR057C (PWP2)9231611783e-13
AGR180W8062841783e-13
KLLA0F13244g8143001774e-13
AAR057W9221601774e-13
CAGL0E00561g8363311765e-13
YKL213C (DOA1)7151811765e-13
CAGL0K09284g9112721741e-12
Kwal_23.64297503311731e-12
YOR269W (PAC1)4942821711e-12
AGL196C9352801731e-12
Kwal_23.53514742761702e-12
Scas_720.83d9151601722e-12
CAGL0M04279g9401821712e-12
KLLA0C08976g9113131712e-12
Kwal_55.220674511671692e-12
Sklu_2160.37601691703e-12
KLLA0C07425g4443571673e-12
YKR036C (CAF4)6591211675e-12
Sklu_1880.34711801666e-12
CAGL0K00275g7151541659e-12
Kwal_26.89534583521631e-11
KLLA0D16390g9361531632e-11
CAGL0M04081g4551661612e-11
Kwal_33.155917141591622e-11
YLR129W (DIP2)9432801604e-11
Scas_713.509831821605e-11
CAGL0G09845g5002761585e-11
KLLA0E07073g4521641568e-11
Sklu_2318.17111711571e-10
CAGL0A02772g4411781551e-10
Scas_692.254882381541e-10
Scas_658.14423111532e-10
ADL184W4491641532e-10
ADR176W4612771532e-10
KLLA0E24508g3271631502e-10
Kwal_56.239209372791542e-10
Sklu_2172.62631161483e-10
YBR175W (SWD3)3151281493e-10
KLLA0E21263g4291901513e-10
AER337W4453591505e-10
YDR364C (CDC40)4551801495e-10
Scas_631.174742801496e-10
Scas_585.84601731497e-10
YOR272W (YTM1)4603581488e-10
YNL317W (PFS2)4651631471e-09
AER255C4673061471e-09
Scas_700.27*4332051461e-09
Kwal_26.89754453641452e-09
KLLA0B14410g7062461462e-09
YKL021C (MAK11)4681561425e-09
Sklu_2416.54591741416e-09
CAGL0L02761g4192571398e-09
Kwal_34.158183492511389e-09
Scas_721.73251421389e-09
CAGL0M06193g3162271361e-08
AGR207C3201631362e-08
Scas_692.294563391372e-08
KLLA0E07942g3901311372e-08
Kwal_55.214505031921372e-08
YPR178W (PRP4)4652441362e-08
Kwal_56.241637291161363e-08
YMR146C (TIF34)347731325e-08
Kwal_27.122393161231316e-08
Sklu_1963.23141641316e-08
AER114W6331841337e-08
CAGL0L06952g347661317e-08
CAGL0M08646g3371581309e-08
YLR429W (CRN1)6511821321e-07
CAGL0F06853g3881301291e-07
YGL004C (RPN14)4171951282e-07
Scas_685.113841321272e-07
AGR168W8251281283e-07
Scas_717.68908831283e-07
Scas_720.457551081274e-07
Scas_719.526282191264e-07
ADL322C5011871255e-07
KLLA0F16038g8621121265e-07
YLR409C (UTP21)9391471266e-07
Scas_660.7*6031261256e-07
Kwal_33.151364733191246e-07
Kwal_14.8843951561238e-07
ACR091W3281911219e-07
Kwal_55.215593511741211e-06
KLLA0E21879g3331581201e-06
YOR212W (STE4)4232531202e-06
KLLA0E18986g990801212e-06
KLLA0E04741g4591701202e-06
YDR267C3301961192e-06
KLLA0D02530g7071431212e-06
Scas_605.184242521192e-06
Kwal_26.86284222521193e-06
Kwal_26.76557431061193e-06
KLLA0C07513g4392051183e-06
AER081C10231471194e-06
CAGL0J04818g6542121185e-06
YER066W1851421125e-06
Kwal_23.41189391591176e-06
Scas_571.46011721167e-06
Scas_397.24101201157e-06
CAGL0M09845g9361551177e-06
Scas_719.309401531177e-06
YMR102C8342141168e-06
Sklu_2423.19441591151e-05
CAGL0J06512g545801141e-05
KLLA0A08866g423801131e-05
AFL056C9761431151e-05
CAGL0K03377g978781141e-05
Sklu_2430.9966761141e-05
KLLA0A04928g8611411132e-05
ABL024W734811132e-05
CAGL0J10340g3381581112e-05
Scas_615.113491691112e-05
KLLA0F15598g4783161122e-05
Kwal_27.125865091181122e-05
Kwal_14.12356072271122e-05
Scas_721.1288512291122e-05
ACR166W3881561103e-05
Kwal_27.11126996961113e-05
Scas_680.11347651103e-05
AAR102C5912891095e-05
CAGL0A00561g4121181076e-05
Sklu_675.13082501066e-05
ACR017W4231801077e-05
Sklu_2291.4997581079e-05
CAGL0K12188g535761061e-04
YGL003C (CDH1)5661981061e-04
YMR092C (AIP1)6151311061e-04
ACR097W467691051e-04
YBR103W (SIF2)5352351051e-04
KLLA0B02827g9421561052e-04
Kwal_55.211445703131042e-04
Kwal_56.243993692081032e-04
KLLA0B12804g852761042e-04
Kwal_47.174658001281042e-04
Kwal_47.175554171391023e-04
Sklu_1926.55092901023e-04
KLLA0D06787g4362671023e-04
Scas_659.94753151023e-04
Kwal_27.103855361241014e-04
KLLA0F22000g7931351006e-04
YLL011W (SOF1)489323996e-04
Sklu_2406.11426258996e-04
CAGL0J01287g610123997e-04
YGR200C (ELP2)788931007e-04
Scas_465.41002581007e-04
AFL009C41383987e-04
KLLA0E19613g572263998e-04
Scas_702.16816249990.001
AAL157C479126980.001
KLLA0B11077g567166980.001
Sklu_1870.2569225980.001
KLLA0E11297g51278970.001
CAGL0K00957g793140980.001
CAGL0D05588g477320970.001
CAGL0D04884g563131970.001
CAGL0G03399g369133960.001
Scas_718.6*54699970.001
Sklu_2435.13575129960.002
Kwal_56.24661561258960.002
CAGL0F07337g621162960.002
AFL014C557174960.002
Scas_652.1634584950.002
KLLA0F10791g545177950.002
Scas_705.2571129940.003
CAGL0B03575g419266940.003
YGL116W (CDC20)610169940.003
Kwal_26.7738611150940.003
CAGL0A00605g640125930.004
Sklu_1645.2587163930.004
Sklu_2332.7367114920.004
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27511g
         (613 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...  1254   0.0  
Kwal_23.5769                                                          776   0.0  
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...   746   0.0  
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...   743   0.0  
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...   732   0.0  
Scas_704.40                                                           717   0.0  
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...   124   6e-30
Scas_720.95                                                           117   7e-28
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                           114   1e-26
Kwal_23.6324                                                          114   1e-26
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...   113   3e-26
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...   110   1e-25
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...   109   4e-25
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...   104   1e-23
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...   101   2e-23
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                           102   4e-23
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...   103   6e-23
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...   100   7e-23
Kwal_26.8776                                                          100   2e-22
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...   102   2e-22
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...   101   3e-22
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    99   7e-22
Kwal_23.5035                                                          100   8e-22
Scas_721.115*                                                          97   9e-22
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...   100   1e-21
Scas_721.32                                                           100   1e-21
Scas_592.4*                                                            96   2e-21
Scas_695.15                                                            96   2e-21
Kwal_56.24526                                                         100   2e-21
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      99   3e-21
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    99   3e-21
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    94   4e-21
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    96   6e-21
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    97   8e-21
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    97   1e-20
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    96   2e-20
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    92   2e-20
KLLA0D07546g complement(647984..649927) some similarities with s...    96   3e-20
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    96   3e-20
Kwal_27.12053                                                          96   3e-20
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            92   3e-20
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    92   4e-20
Scas_707.22                                                            95   5e-20
Kwal_0.212                                                             91   7e-20
Scas_624.11                                                            94   1e-19
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    91   1e-19
Kwal_26.7570                                                           88   1e-19
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    90   2e-19
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    92   3e-19
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    92   4e-19
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    89   8e-19
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    88   5e-18
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    87   1e-17
Scas_711.11                                                            86   2e-17
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    86   2e-17
Scas_630.6                                                             86   4e-17
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    84   8e-17
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    83   2e-16
Kwal_27.12667                                                          83   2e-16
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    82   4e-16
Scas_603.5                                                             81   7e-16
Kwal_27.11585                                                          81   9e-16
CAGL0L03201g complement(366795..368534) some similarities with s...    80   1e-15
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    80   2e-15
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    80   2e-15
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    79   3e-15
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    76   4e-15
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    78   1e-14
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    78   1e-14
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    77   2e-14
Scas_679.28                                                            75   6e-14
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    75   7e-14
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    75   9e-14
Kwal_23.6240                                                           75   9e-14
Scas_629.12                                                            74   1e-13
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    74   1e-13
Scas_558.3                                                             74   2e-13
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    74   2e-13
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    74   2e-13
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    73   2e-13
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    73   3e-13
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    73   3e-13
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    73   4e-13
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    73   4e-13
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    72   5e-13
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    72   5e-13
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    72   1e-12
Kwal_23.6429                                                           71   1e-12
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    70   1e-12
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    71   1e-12
Kwal_23.5351                                                           70   2e-12
Scas_720.83d                                                           71   2e-12
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    70   2e-12
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    70   2e-12
Kwal_55.22067                                                          70   2e-12
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         70   3e-12
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    69   3e-12
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    69   5e-12
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            69   6e-12
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    68   9e-12
Kwal_26.8953                                                           67   1e-11
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    67   2e-11
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    67   2e-11
Kwal_33.15591                                                          67   2e-11
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    66   4e-11
Scas_713.50                                                            66   5e-11
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    65   5e-11
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    65   8e-11
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          65   1e-10
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    64   1e-10
Scas_692.25                                                            64   1e-10
Scas_658.1                                                             64   2e-10
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    64   2e-10
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    64   2e-10
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    62   2e-10
Kwal_56.23920                                                          64   2e-10
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       62   3e-10
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    62   3e-10
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    63   3e-10
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    62   5e-10
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    62   5e-10
Scas_631.17                                                            62   6e-10
Scas_585.8                                                             62   7e-10
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    62   8e-10
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    61   1e-09
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    61   1e-09
Scas_700.27*                                                           61   1e-09
Kwal_26.8975                                                           60   2e-09
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    61   2e-09
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    59   5e-09
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           59   6e-09
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    58   8e-09
Kwal_34.15818                                                          58   9e-09
Scas_721.7                                                             58   9e-09
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    57   1e-08
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    57   2e-08
Scas_692.29                                                            57   2e-08
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    57   2e-08
Kwal_55.21450                                                          57   2e-08
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    57   2e-08
Kwal_56.24163                                                          57   3e-08
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    55   5e-08
Kwal_27.12239                                                          55   6e-08
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         55   6e-08
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    56   7e-08
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    55   7e-08
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    55   9e-08
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    55   1e-07
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    54   1e-07
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    54   2e-07
Scas_685.11                                                            54   2e-07
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    54   3e-07
Scas_717.68                                                            54   3e-07
Scas_720.45                                                            54   4e-07
Scas_719.52                                                            53   4e-07
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    53   5e-07
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    53   5e-07
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    53   6e-07
Scas_660.7*                                                            53   6e-07
Kwal_33.15136                                                          52   6e-07
Kwal_14.884                                                            52   8e-07
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    51   9e-07
Kwal_55.21559                                                          51   1e-06
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    51   1e-06
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    51   2e-06
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    51   2e-06
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    51   2e-06
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    50   2e-06
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    51   2e-06
Scas_605.18                                                            50   2e-06
Kwal_26.8628                                                           50   3e-06
Kwal_26.7655                                                           50   3e-06
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    50   3e-06
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    50   4e-06
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    50   5e-06
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    48   5e-06
Kwal_23.4118                                                           50   6e-06
Scas_571.4                                                             49   7e-06
Scas_397.2                                                             49   7e-06
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    50   7e-06
Scas_719.30                                                            50   7e-06
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    49   8e-06
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             49   1e-05
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    49   1e-05
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    48   1e-05
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    49   1e-05
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    49   1e-05
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          49   1e-05
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    48   2e-05
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    48   2e-05
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    47   2e-05
Scas_615.11                                                            47   2e-05
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    48   2e-05
Kwal_27.12586                                                          48   2e-05
Kwal_14.1235                                                           48   2e-05
Scas_721.128                                                           48   2e-05
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    47   3e-05
Kwal_27.11126                                                          47   3e-05
Scas_680.11                                                            47   3e-05
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    47   5e-05
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    46   6e-05
Sklu_675.1 YMR146C, Contig c675 761-1687                               45   6e-05
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    46   7e-05
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         46   9e-05
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    45   1e-04
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    45   1e-04
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    45   1e-04
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    45   1e-04
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    45   1e-04
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    45   2e-04
Kwal_55.21144                                                          45   2e-04
Kwal_56.24399                                                          44   2e-04
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    45   2e-04
Kwal_47.17465                                                          45   2e-04
Kwal_47.17555                                                          44   3e-04
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         44   3e-04
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    44   3e-04
Scas_659.9                                                             44   3e-04
Kwal_27.10385                                                          44   4e-04
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    43   6e-04
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    43   6e-04
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      43   6e-04
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    43   7e-04
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    43   7e-04
Scas_465.4                                                             43   7e-04
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    42   7e-04
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    43   8e-04
Scas_702.16                                                            43   0.001
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    42   0.001
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    42   0.001
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         42   0.001
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    42   0.001
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    42   0.001
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    42   0.001
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    42   0.001
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    42   0.001
Scas_718.6*                                                            42   0.001
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         42   0.002
Kwal_56.24661                                                          42   0.002
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    42   0.002
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    42   0.002
Scas_652.16                                                            41   0.002
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    41   0.002
Scas_705.2                                                             41   0.003
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    41   0.003
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    41   0.003
Kwal_26.7738                                                           41   0.003
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    40   0.004
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          40   0.004
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       40   0.004
Scas_512.3                                                             40   0.004
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    40   0.005
YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component ...    40   0.005
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         40   0.005
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    40   0.005
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             40   0.005
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    40   0.005
Kwal_27.10785                                                          40   0.005
Scas_646.14                                                            40   0.006
Kwal_33.15475                                                          40   0.006
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    39   0.006
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    39   0.009
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    39   0.009
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    39   0.010
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    39   0.010
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    39   0.011
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    39   0.013
Scas_721.29                                                            39   0.013
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    39   0.014
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    39   0.014
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    39   0.014
YLR196W (PWP1) [3599] chr12 (543970..545700) Protein containing ...    39   0.016
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         39   0.016
Kwal_56.24596                                                          38   0.019
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            38   0.023
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    38   0.024
Scas_510.5                                                             38   0.025
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    37   0.026
Scas_542.5                                                             37   0.027
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    37   0.028
Scas_715.22                                                            38   0.030
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    37   0.030
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    37   0.031
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    38   0.032
Scas_642.1                                                             38   0.032
Kwal_33.13515                                                          37   0.033
Scas_660.8                                                             37   0.033
Kwal_47.17567                                                          37   0.034
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    37   0.038
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    37   0.038
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    37   0.050
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    37   0.051
YPL126W (NAN1) [5319] chr16 (310209..312899) Nucleolar protein a...    37   0.058
KLLA0F21076g 1966373..1969036 highly similar to sp|Q9P4C0 Kluyve...    37   0.059
Scas_670.21                                                            37   0.066
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    36   0.068
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    37   0.073
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    36   0.077
KLLA0C09262g 805512..807188 similar to sp|P40055 Saccharomyces c...    36   0.081
Kwal_56.23685                                                          36   0.081
Scas_693.22                                                            36   0.084
Kwal_14.906                                                            36   0.086
Scas_699.5                                                             36   0.089
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    36   0.090
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    36   0.092
AFR153W [3345] [Homologous to ScYLR055C (SPT8) - SH] complement(...    36   0.098
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    35   0.10 
KLLA0E18964g complement(1676876..1680310) similar to sp|P53010 S...    36   0.11 
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    35   0.12 
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    35   0.12 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    35   0.13 
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    35   0.13 
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    35   0.14 
KLLA0D13222g complement(1132067..1134277) similar to sgd|S000273...    35   0.15 
Scas_701.22                                                            35   0.18 
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         35   0.21 
KLLA0F08811g complement(819834..821744) some similarities with s...    35   0.22 
AGR367C [4678] [Homologous to ScYDR324C - SH] (1408366..1410681)...    35   0.23 
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            35   0.25 
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    35   0.27 
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    34   0.28 
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    34   0.28 
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    34   0.29 
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    35   0.29 
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    34   0.32 
ADR230W [1971] [Homologous to ScYOR080W (DIA2) - SH] complement(...    34   0.32 
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    34   0.33 
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          34   0.36 
CAGL0J03344g complement(322226..323857) highly similar to sp|P40...    34   0.37 
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    33   0.38 
Scas_469.3                                                             34   0.40 
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    34   0.41 
Scas_714.34                                                            34   0.45 
Scas_674.20                                                            33   0.46 
YER082C (UTP7) [1514] chr5 complement(324268..325932) Component ...    33   0.48 
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    33   0.50 
Kwal_26.7736                                                           33   0.50 
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    34   0.50 
Scas_656.15                                                            33   0.53 
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    33   0.53 
Kwal_33.14971                                                          33   0.55 
YDR324C (UTP4) [1154] chr4 complement(1114426..1116756) Protein ...    33   0.57 
Kwal_33.14248                                                          33   0.61 
Kwal_14.1710                                                           33   0.62 
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    33   0.64 
Kwal_55.20233                                                          33   0.65 
KLLA0E15950g complement(1417190..1418956) some similarities with...    33   0.71 
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    33   0.71 
Scas_595.3*                                                            33   0.74 
Kwal_56.24332                                                          33   0.75 
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    33   0.75 
Kwal_33.13148                                                          33   0.81 
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    33   0.81 
Scas_684.14                                                            33   0.92 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    33   0.98 
Sklu_2291.5 YGL094C, Contig c2291 9283-12280                           33   1.0  
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...    32   1.1  
ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...    32   1.2  
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            32   1.3  
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    32   1.3  
Kwal_47.17310                                                          32   1.4  
ADR331C [2072] [Homologous to ScYHR186C - SH] (1285564..1290252)...    32   1.4  
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    32   1.7  
YLR055C (SPT8) [3472] chr12 complement(251273..253081) Component...    32   1.8  
Kwal_56.22345                                                          32   1.8  
Scas_675.18                                                            32   1.8  
Scas_442.2*                                                            32   1.9  
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    32   2.3  
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    32   2.4  
Sklu_2359.2 YER124C, Contig c2359 3062-4807                            31   2.6  
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    32   2.6  
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         31   2.8  
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    31   2.8  
AFL055W [3138] [Homologous to ScYGL094C (PAN2) - SH] complement(...    31   2.8  
Scas_712.34                                                            31   2.9  
KLLA0B00165g <6735..7049                                               29   3.2  
Sklu_1661.2 YLL011W, Contig c1661 1311-1683                            30   3.2  
Scas_657.13                                                            31   3.6  
YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member o...    31   3.6  
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    31   3.7  
YGL213C (SKI8) [1783] chr7 complement(90057..91250) Protein invo...    31   3.7  
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    31   3.9  
Sklu_1710.1 YDR267C, Contig c1710 17-739                               30   4.2  
Scas_649.10                                                            31   4.3  
Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement         30   4.7  
YBL037W (APL3) [157] chr2 (147174..150251) Alpha-adaptin, large ...    30   5.1  
Sklu_1985.3 YLR196W, Contig c1985 4838-6544 reverse complement         30   5.5  
AEL154C [2352] [Homologous to ScYBR281C - SH] (339962..342628) [...    30   5.6  
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    30   5.6  
CAGL0A04037g complement(399371..401122) highly similar to sp|P21...    30   5.6  
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    30   5.9  
KLLA0C17820g 1586564..1588510 similar to sp|P32641 Saccharomyces...    30   6.2  
YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...    30   7.1  
Scas_700.47                                                            30   7.2  
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    30   7.9  
YDR488C (PAC11) [1304] chr4 complement(1429176..1430777) Dynein ...    30   8.7  
Kwal_14.1597                                                           29   9.9  

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 1254 bits (3246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/613 (100%), Positives = 613/613 (100%)

Query: 1   MEFNLQQTCRPDLKRKFEDVDSNGVSDQRQDTDGKGEILRNKASKVNQNNEEIQLPSEMP 60
           MEFNLQQTCRPDLKRKFEDVDSNGVSDQRQDTDGKGEILRNKASKVNQNNEEIQLPSEMP
Sbjct: 1   MEFNLQQTCRPDLKRKFEDVDSNGVSDQRQDTDGKGEILRNKASKVNQNNEEIQLPSEMP 60

Query: 61  QFNFFKFCYRHNPDIQHTCKDSMVFQDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQHS 120
           QFNFFKFCYRHNPDIQHTCKDSMVFQDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQHS
Sbjct: 61  QFNFFKFCYRHNPDIQHTCKDSMVFQDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQHS 120

Query: 121 NDKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIA 180
           NDKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIA
Sbjct: 121 NDKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIA 180

Query: 181 SLTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGN 240
           SLTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGN
Sbjct: 181 SLTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGN 240

Query: 241 QFQNVANGNGNEIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRN 300
           QFQNVANGNGNEIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRN
Sbjct: 241 QFQNVANGNGNEIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRN 300

Query: 301 GRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360
           GRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF
Sbjct: 301 GRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE
Sbjct: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480
           SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI
Sbjct: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480

Query: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV 540
           PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV
Sbjct: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV 540

Query: 541 SSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG 600
           SSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG
Sbjct: 541 SSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG 600

Query: 601 IGDSSFVSGDELG 613
           IGDSSFVSGDELG
Sbjct: 601 IGDSSFVSGDELG 613

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 54/96 (56%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L + S D+T+ +W+  SG  IR   GH +GV  I  D+ ++++ S DK+I+VW+   G C
Sbjct: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKC 585

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           I T+ GH+  ++ V       VS      VK+WH +
Sbjct: 586 IQTFTGHKAPIVCVGIGDSSFVSGDELGEVKMWHFD 621

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           +GRC I+   GH++GV  +  ++  + +GS+D ++ +WD ++G  I+  TGH   +  + 
Sbjct: 542 SGRC-IRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG 600

Query: 360 FDDQKMITASLDKTIRVWNY 379
             D   ++      +++W++
Sbjct: 601 IGDSSFVSGDELGEVKMWHF 620

>Kwal_23.5769
          Length = 627

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/603 (62%), Positives = 453/603 (75%), Gaps = 34/603 (5%)

Query: 14  KRKFEDVDSNGVSDQRQDTD-GKGEILRNKASKVNQNNEEIQLPSEMPQFNFFKFCYRHN 72
           KRK  + +   + + + D+   +GE+  + AS  ++ N+ ++    +PQ+NF +FCYRHN
Sbjct: 48  KRKAAEYEDGQLQEAQVDSVVPRGEVTESAASANSRTNKRVR---GLPQYNFLRFCYRHN 104

Query: 73  PDIQHTCKDSMVF-QDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQHSNDKIRRLMLEG 131
           PD QH+   +  + QDQ R +K  +K++ L+ E  R + +  L  F   ND+IR+L+LEG
Sbjct: 105 PDFQHSQTHTACYMQDQQRHQKLNKKIEQLEPEEQRQV-QNVLTTFAGCNDRIRKLLLEG 163

Query: 132 ILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKRWKTLA 191
           +L  CCFPQLS++A EV+++IKIDFISTLPEE++LKILGYLDC+SLC A+  C+RW+ +A
Sbjct: 164 LLANCCFPQLSFVASEVQKMIKIDFISTLPEEVALKILGYLDCESLCNAARVCRRWQQMA 223

Query: 192 DDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGN 251
           DDD+VWYHMC+QHIDRKCPNCGWGLPLLHMKRAR++         Q G            
Sbjct: 224 DDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKRARFIEPPAESKPGQKG------------ 271

Query: 252 EIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGH 311
                      GN P   VA+     +  TRPWKVIYRERF+VESNWR G   IQ FKGH
Sbjct: 272 ----------AGNPP---VASETTTRK--TRPWKVIYRERFKVESNWRKGTAHIQEFKGH 316

Query: 312 MDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLD 371
           MDGVLSL+FN+RLLFTGSYDSTVAIWD  +G L+RRLTGH DGVK IYFD QK+IT SLD
Sbjct: 317 MDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSLD 376

Query: 372 KTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHT 431
           + IRVWNY+TG+C++ Y GH DSVLSVDSYKKIIVS SADKTVKVWHVESRTCYTLRGHT
Sbjct: 377 RMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGHT 436

Query: 432 EWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLV 491
           EWV  VKLHPKSFTC+S SDD T+RMWDIR+N+C+KVFRGHVGQVQKV+PLTI DTENLV
Sbjct: 437 EWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENLV 496

Query: 492 VDEKIEKVPN-PELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF 550
            D   +   N     +D  D      D +L YP+HLLSCSLDNTIKLWEV +G+C+RT F
Sbjct: 497 TDRTSDPPRNEATTAQDPPDGQLSALDDSLPYPSHLLSCSLDNTIKLWEVRTGKCVRTHF 556

Query: 551 GHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGD 610
           GHVEG+WDIAADNFRIVSG+HDK++KVWDLQ+GKCI TF  H+API CVGIGDS FVSGD
Sbjct: 557 GHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGD 616

Query: 611 ELG 613
           ELG
Sbjct: 617 ELG 619

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 51/92 (55%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L + S D+T+ +W+ ++G  +R   GH +G+  I  D+ ++++ + DKT++VW+  +G C
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKC 591

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKV 416
           I T+  HQ  +  V       VS      VKV
Sbjct: 592 IHTFDSHQAPITCVGIGDSEFVSGDELGCVKV 623

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/557 (64%), Positives = 425/557 (76%), Gaps = 40/557 (7%)

Query: 60  PQFNFFKFCYRHNPDIQHT-CKDSMVFQDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQ 118
           PQ+NF ++CYRHNPDIQ    +   V Q+Q R E+W  ++  L  E +R ++++ +  F 
Sbjct: 40  PQYNFVRYCYRHNPDIQAAPTQVRCVRQEQQRREEWQARVGELSSEGERQVVQEAVRLFD 99

Query: 119 HSNDKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLC 178
            SNDK+R+LMLEG+L   CFPQLS+I+ ++++LIKIDFIS LPEE++LKILGYLDCQSLC
Sbjct: 100 SSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLC 159

Query: 179 IASLTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQN 238
            A+  C+RW+ LADDD VWYHMCEQHIDRKCP CGWGLPLLHMKRARY+  ++A      
Sbjct: 160 SAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKA------ 213

Query: 239 GNQFQNVANGNGNEIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNW 298
                + + G G +                     A  SR   RPWKV+YRERF+VESNW
Sbjct: 214 -----SASKGEGED---------------------APQSR--MRPWKVVYRERFKVESNW 245

Query: 299 RNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358
           R G  RIQ FKGHMDGVLSL+  ++LL TGSYDSTVAIWD  +G LIRRL+GHTDGVK +
Sbjct: 246 RKGIYRIQEFKGHMDGVLSLQLTNKLLLTGSYDSTVAIWDLATGKLIRRLSGHTDGVKAL 305

Query: 359 YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWH 418
            FDDQK+IT SLDKTIRVWNY+TG+C+STYRGHQDSVLSVDS++K+IVS SADKTVKVWH
Sbjct: 306 RFDDQKLITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWH 365

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
           VESRTCYTLRGHT WVNCVKLHPKSFTC+S SDD T+RMWDIRTN+C++VF GHVGQVQK
Sbjct: 366 VESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQK 425

Query: 479 VIPLTIKDTENLVVDEKIEKVPNPELEEDFADDC--TGIFDPNLKYPTHLLSCSLDNTIK 536
           VIPLT+    +L+ D K   VP P+      D       FD +L YPTHLLSCSLDNTIK
Sbjct: 426 VIPLTLG--SDLIEDPKDAVVP-PDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIK 482

Query: 537 LWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
           LW V +G CIRTQFGHVEGVWDIAADNFRIVSGSHD+S KVWDLQ GKC+ TF G  AP+
Sbjct: 483 LWNVKTGACIRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPV 542

Query: 597 VCVGIGDSSFVSGDELG 613
            CVGIGDS FVSGDELG
Sbjct: 543 ACVGIGDSEFVSGDELG 559

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 310 GHMDGVLSLKFNHRL-----LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK 364
            H   V +  F+H L     L + S D+T+ +W+ K+G  IR   GH +GV  I  D+ +
Sbjct: 452 AHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIAADNFR 511

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVES 421
           +++ S D++ +VW+  TG C+ T+ G    V  V       VS      VK+++ ++
Sbjct: 512 IVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFVSGDELGCVKLYNFDT 568

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           N + G C I+   GH++GV  +  ++  + +GS+D +  +WD ++G  +    G    V 
Sbjct: 485 NVKTGAC-IRTQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVA 543

Query: 357 GIYFDDQKMITASLDKTIRVWNYIT 381
            +   D + ++      ++++N+ T
Sbjct: 544 CVGIGDSEFVSGDELGCVKLYNFDT 568

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/662 (57%), Positives = 455/662 (68%), Gaps = 66/662 (9%)

Query: 13  LKRKFEDVDSNGVSDQRQDTDGKGEIL----------RNKASKVNQNNEEIQLPSEMPQF 62
           +K   +D ++ G   ++   D + ++L          R+    +  + E     S +P+ 
Sbjct: 6   VKHSRDDTEAEGAKRRKMPYDEQIQMLAEEEEEDTMKRDMGDALATSTESQSGVSVLPRD 65

Query: 63  NFFKFCYRHNPDIQHTCKDSMVF-QDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQHSN 121
           NF ++CYRHNP+IQ +    + + QD  R +    K+  L    ++A I   +  + +SN
Sbjct: 66  NFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIISKYTNSN 125

Query: 122 DKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIAS 181
           DK+R+L+L+GIL   CFPQLSYIA  +  +IKIDFIS LP+ELSLKILGYLDCQSLC AS
Sbjct: 126 DKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQSLCNAS 185

Query: 182 LTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARY---------LPVNEA 232
           + CK W  LADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR            VN+ 
Sbjct: 186 MVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPNTTVNDR 245

Query: 233 HVHNQNGNQFQNVAN-GNGNEIGGGKSLINP-GNSPNQTVAA-------RARNSRYYTRP 283
            +   N N+   + +   GNE  G     N    + N TV+        +  N R   + 
Sbjct: 246 KMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVSGSKSSGQGQQENGRCRQKS 305

Query: 284 WKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGN 343
           WK++YRERF+VESNWR G C IQ FKGHMDGVL+L+FN+RLLFTGSYD+TVAIWD  +G 
Sbjct: 306 WKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIWDLFTGK 365

Query: 344 LIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK 403
           LIRRLTGH+DGVK +YFDDQK+IT SLDKTIRVWNYITG CISTYRGH DSV+SVDS+KK
Sbjct: 366 LIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVDSHKK 425

Query: 404 IIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463
           IIVS SADKTVKVWHVESRTCYTL+GHTEWVNCVKLHPKSF+CYS SDD T+RMWDIRTN
Sbjct: 426 IIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTN 485

Query: 464 SCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN---- 519
           +C++VFRGHVGQVQKVIPLTI D +NLV  E+      P  E+D A + TG  DP     
Sbjct: 486 TCLRVFRGHVGQVQKVIPLTIIDAQNLVTHER-----KPGEEDDIASNGTGEDDPENGVN 540

Query: 520 --------LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSH 571
                   + YPTHLLSC+LDNTIKLWEV SGRCIRTQFGHVEGVWDIAADNFRI+SGSH
Sbjct: 541 GQRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSH 600

Query: 572 DKSIKVWDLQNGKCIQTFTGHK--------------------APIVCVGIGDSSFVSGDE 611
           D SIK+WDLQ+GKC+ TF G K                    AP+ CV IGDS   SGDE
Sbjct: 601 DGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDE 660

Query: 612 LG 613
            G
Sbjct: 661 FG 662

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/582 (61%), Positives = 420/582 (72%), Gaps = 65/582 (11%)

Query: 59  MPQFNFFKFCYRHNPDIQHTCKDSMVFQDQVRSEKWMEKMKALDKESDRAIIKQTLDNFQ 118
           +P++NF KFCYRHNPDIQ +   +  ++  ++  + +    A     +++ I   +  + 
Sbjct: 86  LPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIAKLPLQEQSDIHHIISKYS 145

Query: 119 HSNDKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLC 178
           +SNDKIR+L+L+GIL   CFPQLSYI+  V  +IKIDFIS LP+ELSLKIL YLDCQSLC
Sbjct: 146 NSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISILPQELSLKILSYLDCQSLC 205

Query: 179 IASLTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQN 238
            A+  C++W+ LADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR           QN
Sbjct: 206 NATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARI---------QQN 256

Query: 239 GNQFQNVANGNGNEIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNW 298
                                   G+S N  +  +       TRPWKVIYRERF+VESNW
Sbjct: 257 ST----------------------GSSSNADIQTQT------TRPWKVIYRERFKVESNW 288

Query: 299 RNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358
           R G CRIQ FKGHMDGVL+L+FN+RLLFTGSYDST+ IWD  +G LIRRL+GH+DGVK +
Sbjct: 289 RKGHCRIQEFKGHMDGVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTL 348

Query: 359 YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWH 418
           YFDD+K+IT SLDKTIRVWNYITG CISTYRGH DSVLSVDSY+K+IVS SADKTVKVWH
Sbjct: 349 YFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWH 408

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
           VESRTCYTLRGHTEWVNCVKLHPKSF+C+S SDD T+RMWDIRTNSC+KVFRGHVGQVQK
Sbjct: 409 VESRTCYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 468

Query: 479 VIPLTIKDTENLVVDEKIEKVPNPELEEDFADDC----------TGIFDPNLKYPTHLLS 528
           +IPLTIKD ENL  D   +   +P+ +    D              + D N+ YPTHLLS
Sbjct: 469 IIPLTIKDVENLATDNTSDG-SSPQDDPTMTDGADESDTPSNEQETVLDENIPYPTHLLS 527

Query: 529 CSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQT 588
           C LDNTIKLW+V +G+CIRTQFGHVEGVWDIAADNFRI+SGSHD SIKVWDLQ+GKC+ T
Sbjct: 528 CGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHT 587

Query: 589 FTGHK-----------------APIVCVGIGDSSFVSGDELG 613
           F G +                 API CV IGDS   SGDE G
Sbjct: 588 FNGRRLQRETQHTQTQSLGDKVAPIACVCIGDSECFSGDEFG 629

>Scas_704.40
          Length = 608

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/631 (58%), Positives = 430/631 (68%), Gaps = 96/631 (15%)

Query: 45  KVNQNNEEIQ---------------LPSEMPQFNFFKFCYRHNPDIQHTCKDSMVF-QDQ 88
           K+N N+ EI+                 S +PQFNF KFCYRHNP+I  +   +  + QD 
Sbjct: 4   KINSNDNEIERELIRSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYNQDL 63

Query: 89  VRSEKWMEKMKALDKESDRAIIKQTLDNFQHSNDKIRRLMLEGILQLCCFPQLSYIADEV 148
            R +   + +  L  + ++A I   +  F  SNDK+R+L+L+GIL   CFPQLSYI+ +V
Sbjct: 64  KRFKDLNDNITKLPAQ-EQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISSQV 122

Query: 149 KQLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKRWKTLADDDRVWYHMCEQHIDRK 208
             +I+IDFIS LP+ELSLKIL YLDCQSLC A+  C++W+ LADDDRVWYHMCEQHIDRK
Sbjct: 123 SNMIRIDFISILPQELSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHIDRK 182

Query: 209 CPNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGNEIGGGKSLINPGNSPNQ 268
           CPNCGWGLPLLHMKRAR+       V N +     N    + N    GK +         
Sbjct: 183 CPNCGWGLPLLHMKRARF-------VKNASICATNNTCTKDSN----GKLM--------- 222

Query: 269 TVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTG 328
                        RPWKVIYRERF+VESNWR G C++Q FKGHMDGVL+L+FN+RLLFTG
Sbjct: 223 -------------RPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTG 269

Query: 329 SYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTY 388
           SYDSTVAIWD  S  LIRRL+GHTDGVK +YFD+ K++T SLDKTIRVWNY TG CISTY
Sbjct: 270 SYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTY 329

Query: 389 RGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYS 448
           RGH DSV+SVD++KKIIVS SADKTVK+WHVESRTCYTLRGHTEWVNCVKLHPKSFTC+S
Sbjct: 330 RGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFS 389

Query: 449 SSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDE---KIEKVPNPELE 505
            SDD T+RMWDIRTNSC+KVFRGHVGQVQKVIPLTI D ENLVVD      E    P   
Sbjct: 390 GSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPAST 449

Query: 506 EDFA----------DDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEG 555
                         D+     D ++ YPTHLLSCSLDNTIKLW+V +G+CIRTQFGHVEG
Sbjct: 450 TTPTAAIAAEAATNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEG 509

Query: 556 VWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHK---------------------- 593
           VWDIAADNFRI+SGSHD SIK+WDLQ+GKC+ TF G +                      
Sbjct: 510 VWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTHLASTSNATGTS 569

Query: 594 -----------APIVCVGIGDSSFVSGDELG 613
                      +PI CV IGDS F SGDELG
Sbjct: 570 TSTANPVQNKVSPIACVSIGDSEFFSGDELG 600

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score =  124 bits (310), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 104/333 (31%), Positives = 155/333 (46%), Gaps = 26/333 (7%)

Query: 289 RERFQVESNWRNGRCRIQLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKSGNLI 345
           R  F+V+   R+         GH   +L   F       + TG+ D+T  IWD  +   +
Sbjct: 124 RAVFKVKPVTRSSSA----IAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPM 179

Query: 346 RRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCIS-TYRGHQDSVLSVD--- 399
             L GH + V  + +  D + + T S+D TIR+W+  +G C+    RGH   + S+    
Sbjct: 180 HTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEP 239

Query: 400 ------SYKKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDD 452
                   K  + S+S D T+K+W   SR C YT+ GHT  V+CVK   +    YS S D
Sbjct: 240 IHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL-LYSGSHD 298

Query: 453 KTLRMWDIRTNS-CIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFA-D 510
           +T+R+WDI +   CI + + H   V  +   T         D   +K   PE  +  A +
Sbjct: 299 RTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALE 358

Query: 511 DCTGIFDPNLKYPTHLLSCSLDNTIKLW-EVSSGRCIRTQFGHVEGVWDIA--ADNFRIV 567
           +   I   N      +++ S D T+ LW  + S + I    GH + V  +A   D   IV
Sbjct: 359 NYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIV 418

Query: 568 SGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG 600
           S S D SIK+WD ++GK I TF GH A +  V 
Sbjct: 419 SASFDNSIKLWDGRDGKFISTFRGHVASVYQVA 451

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 90/219 (41%), Gaps = 47/219 (21%)

Query: 308 FKGHMDGVLSLKFNHR-LLFTGSYDSTVAIWDTKS-GNLIRRLTGHTDGVKGI------- 358
             GH + V  +K+  + LL++GS+D TV +WD  S G  I  L  H   V  +       
Sbjct: 274 MSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYA 333

Query: 359 ----YFD------------------------------DQKMITASLDKTIRVWNYITGS- 383
                FD                              ++ M+TAS D T+ +WN +  + 
Sbjct: 334 LRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTK 393

Query: 384 CISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWH-VESRTCYTLRGHTEWVNCVKLH 440
            I+   GHQ  V  ++     + IVSAS D ++K+W   + +   T RGH   V  V   
Sbjct: 394 PIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWS 453

Query: 441 PKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
                  S S D TL++WD+RT        GH  +V  V
Sbjct: 454 SDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTV 492

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 76/198 (38%), Gaps = 49/198 (24%)

Query: 421 SRTCYTLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           +R+   + GH   + C    P  S    + + D T R+WD  T + +   +GH   V  V
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCV 192

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                               P+ E+                     + + S+DNTI+LW+
Sbjct: 193 -----------------SWSPDGEV---------------------IATGSMDNTIRLWD 214

Query: 540 VSSGRCIRTQF-GHVEGVWDIAADNF---------RIVSGSHDKSIKVWDLQNGKCIQTF 589
             SG+C+     GH + +  ++ +           R+ S S D +IK+WD  +  C  T 
Sbjct: 215 PKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTM 274

Query: 590 TGHKAPIVCVGIGDSSFV 607
           +GH   + CV  G    +
Sbjct: 275 SGHTNSVSCVKWGGQGLL 292

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           I    GH   V  + F  + R + + S+D+++ +WD + G  I    GH   V  + +  
Sbjct: 395 IARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSS 454

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVW 417
           D + +++ S D T++VW+  T        GH+D V +VD     K + S   DK V++W
Sbjct: 455 DCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

>Scas_720.95
          Length = 515

 Score =  117 bits (294), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 112/384 (29%), Positives = 172/384 (44%), Gaps = 80/384 (20%)

Query: 286 VIYRER--FQVESNWRNGRCRIQLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTK 340
           +IY  R  F+V+   R+         GH   +L   F       + TG+ D+T  IWD  
Sbjct: 119 LIYTPRAVFKVKPVTRSSSA----IAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCD 174

Query: 341 SGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCIS-TYRGHQDSVLS 397
           +      LTGH + V  + +  + + + T S+D TIR+W+   G  +    RGH   + S
Sbjct: 175 TQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITS 234

Query: 398 VDSYKKI----------IVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTC 446
           + +++ I          + SAS D T+++W +  R C YT+ GHT  V+C+K   +    
Sbjct: 235 L-AWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGI-I 292

Query: 447 YSSSDDKTLRMWDIRTNS-CIKVFRGHVGQVQKVI------------------PLTIKDT 487
           YS S DKT+R+WD+  +  CI + + H   V  +                   P + KD 
Sbjct: 293 YSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDA 352

Query: 488 EN--LVVDEKIEKVPNPELEE---DFADDCTGI-------------------------FD 517
            +  L   EK+ K  N +LEE     +DD T                           F 
Sbjct: 353 RDKALANYEKVVK-KNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFS 411

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSI 575
           P+ +Y   ++S S DN+IKLW+   G+ I T  GHV  V+ +A  AD   +VS S D ++
Sbjct: 412 PDGRY---IVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTL 468

Query: 576 KVWDLQNGKCIQTFTGHKAPIVCV 599
           KVWD++  K      GHK  +  V
Sbjct: 469 KVWDVRTRKLSVDLPGHKDEVYTV 492

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 139/336 (41%), Gaps = 94/336 (27%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKFN--HRL-------LFTGSYDSTVAIWDTKSGNLIRRLT 349
           ++G+      +GH+  + SL +   H +       L + S D T+ IWD      +  ++
Sbjct: 216 KDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMS 275

Query: 350 GHTDGVKGIYFDDQKMI-TASLDKTIRVWNY-ITGSCISTYRGHQDSV----LSVD---- 399
           GHT+ V  I +  Q +I + S DKT+RVW+    G CI+  + H   V    LS D    
Sbjct: 276 GHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALR 335

Query: 400 -----------------------SYKKII----------VSASADKTVKVWHV--ESRTC 424
                                  +Y+K++          V+AS D T+ +W+    ++  
Sbjct: 336 VGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPI 395

Query: 425 YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTI 484
             + GH + VN V   P      S+S D ++++WD R    I  FRGHV  V +V     
Sbjct: 396 ARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVA---- 451

Query: 485 KDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR 544
                                  ++ DC             L+SCS D T+K+W+V + +
Sbjct: 452 -----------------------WSADC-----------RLLVSCSKDTTLKVWDVRTRK 477

Query: 545 CIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVW 578
                 GH + V+  D + D  R+ SG  DK +++W
Sbjct: 478 LSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 5/85 (5%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           R+G+  I  F+GH+  V  + ++   RLL + S D+T+ +WD ++  L   L GH D V 
Sbjct: 432 RDGKF-ISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVY 490

Query: 357 GI--YFDDQKMITASLDKTIRVWNY 379
            +    D +++ +   DK +R+W +
Sbjct: 491 TVDWSVDGKRVCSGGKDKMVRIWTH 515

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score =  114 bits (285), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 102/333 (30%), Positives = 148/333 (44%), Gaps = 26/333 (7%)

Query: 289 RERFQVESNWRNGRCRIQLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKSGNLI 345
           R  F+V+   R+         GH   +L   F       + TG+ D+T  IWD  +   +
Sbjct: 124 RAVFKVKPVTRSSSA----IAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPM 179

Query: 346 RRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCIS-TYRGHQDSVLSVD--- 399
             L GH + V  + +  D + + T S+D TIR+W    G  +    RGH   + S+    
Sbjct: 180 STLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEP 239

Query: 400 ------SYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDD 452
                   K  + SAS D T+K+W    R C  TL GHT  V+C+K   +    YS S D
Sbjct: 240 IHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGV-LYSGSHD 298

Query: 453 KTLRMWDIRTNS-CIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFA-D 510
           KT+R WD+     CI + + H   V  +   T         D   EK   PE  +  A  
Sbjct: 299 KTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALK 358

Query: 511 DCTGIFDPNLKYPTHLLSCSLDNTIKLW-EVSSGRCIRTQFGHVEGVWDIA--ADNFRIV 567
           +   I   N +    +++ S D T+ LW  + S + I    GH + V  +A   D   IV
Sbjct: 359 NYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIV 418

Query: 568 SGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG 600
           S S D SIK+W+ ++GK I TF GH A +  V 
Sbjct: 419 SASFDNSIKLWNGRDGKFISTFRGHVASVYQVA 451

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/301 (26%), Positives = 125/301 (41%), Gaps = 85/301 (28%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMI-TASLDKTIRVWNY-ITG 382
           L + S D T+ IWDT     +  L+GHT  V  I +  Q ++ + S DKTIR W+  + G
Sbjct: 251 LASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGG 310

Query: 383 SCISTYRGHQDSV----LSVD---------------------------SYKKI------- 404
            CI+  + H   V    LS D                           +Y+KI       
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEV 370

Query: 405 ---IVSASADKTVKVWHV--ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
              +V+AS D T+ +W+    ++    + GH + VN V   P      S+S D ++++W+
Sbjct: 371 EELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWN 430

Query: 460 IRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN 519
            R    I  FRGHV  V +V                            ++ DC       
Sbjct: 431 GRDGKFISTFRGHVASVYQVA---------------------------WSSDC------- 456

Query: 520 LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKV 577
                 L+SCS D T+K+W+V + +      GH + V+  D + D  R+ SG  DK +++
Sbjct: 457 ----RLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRL 512

Query: 578 W 578
           W
Sbjct: 513 W 513

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 85/186 (45%), Gaps = 8/186 (4%)

Query: 300 NGRCRIQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG 357
            G+C I + K H   V  LSL  ++ L   G++D T     T      R L  +    K 
Sbjct: 309 GGKC-INILKSHAHWVNHLSLSTDYALRI-GAFDHTSEKPSTPEEAQKRALKNYEKIAKR 366

Query: 358 IYFDDQKMITASLDKTIRVWNYITGS-CISTYRGHQDSV--LSVDSYKKIIVSASADKTV 414
               ++ M+TAS D T+ +WN +  +  I+   GHQ  V  ++     + IVSAS D ++
Sbjct: 367 NGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSI 426

Query: 415 KVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHV 473
           K+W+  + +   T RGH   V  V          S S D TL++WD++T        GH 
Sbjct: 427 KLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHK 486

Query: 474 GQVQKV 479
            +V  V
Sbjct: 487 DEVYTV 492

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 75/193 (38%), Gaps = 49/193 (25%)

Query: 421 SRTCYTLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           +R+   + GH   + C    P  S    + + D T R+WD  T + +   +GH   V  V
Sbjct: 133 TRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCV 192

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                               P+ EL                     + + S+DNTI+LWE
Sbjct: 193 -----------------SWSPDGEL---------------------IATGSMDNTIRLWE 214

Query: 540 VSSGRCIRTQF-GHVEGVWDIAADNF---------RIVSGSHDKSIKVWDLQNGKCIQTF 589
            + G+ +     GH + +  ++ +           R+ S S D +IK+WD     C+ T 
Sbjct: 215 GNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITL 274

Query: 590 TGHKAPIVCVGIG 602
           +GH + + C+  G
Sbjct: 275 SGHTSSVSCIKWG 287

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           I    GH   V  + F  + R + + S+D+++ +W+ + G  I    GH   V  + +  
Sbjct: 395 ITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSS 454

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVW 417
           D + +++ S D T++VW+  T        GH+D V +VD     K + S   DK V++W
Sbjct: 455 DCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

>Kwal_23.6324
          Length = 514

 Score =  114 bits (285), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 104/338 (30%), Positives = 151/338 (44%), Gaps = 28/338 (8%)

Query: 286 VIYRER--FQVESNWRNGRCRIQLFKGHMDGVLSLKFNHRL---LFTGSYDSTVAIWDTK 340
           ++Y  R  F+V    R+         GH   +L   F       + TGS D+T  IWD  
Sbjct: 118 IVYTPRAVFKVRPVTRSSSA----IAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCN 173

Query: 341 SGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITG-SCISTYRGHQDSVLS 397
           +   +  L GH + V  + +  D + + T S+D TIR+W+   G S     RGH   + S
Sbjct: 174 TNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITS 233

Query: 398 VD---------SYKKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCY 447
           +            +  + SAS D T+K+W    R C  TL GHT  V+CVK   +    Y
Sbjct: 234 LTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGI-LY 292

Query: 448 SSSDDKTLRMWDIRTNS-CIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEE 506
           S S DKT+R WD+     CI + + H   +  +   T         D   EK  +PE   
Sbjct: 293 SGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEAR 352

Query: 507 DFA-DDCTGIFDPNLKYPTHLLSCSLDNTIKLWE-VSSGRCIRTQFGHVEGVWDIA--AD 562
             A  +   I   N +    +++ S D T+ LW+ + + + I    GH + V  +A   D
Sbjct: 353 AKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSPD 412

Query: 563 NFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG 600
              IVS S D SIK+WD +NG  I TF GH A +  V 
Sbjct: 413 GRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVA 450

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 95/225 (42%), Gaps = 47/225 (20%)

Query: 302 RCRIQLFKGHMDGVLSLKFNHR-LLFTGSYDSTVAIWDTKSG-----------NLIRRLT 349
           R  +    GH + V  +K+  R +L++GS+D T+  WD  +G           + I  L+
Sbjct: 267 RVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLS 326

Query: 350 GHTD-GVKGIYFD------------------------------DQKMITASLDKTIRVWN 378
            +TD  ++   FD                              ++ M+TAS D T+ +W+
Sbjct: 327 LNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWD 386

Query: 379 YITGS-CISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWV 434
            +  S  I+   GHQ  V  ++     + IVSAS D ++K+W   + T   T RGH   V
Sbjct: 387 PLKASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASV 446

Query: 435 NCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
             V          S S D TL++WD+RT        GH  +V  V
Sbjct: 447 YQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTV 491

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 74/193 (38%), Gaps = 49/193 (25%)

Query: 421 SRTCYTLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           +R+   + GH   + C    P  S    + S D T R+WD  TN+ +   +GH   V  V
Sbjct: 132 TRSSSAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCV 191

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                               P+ EL                     + + S+DNTI+LW+
Sbjct: 192 -----------------AWCPDGEL---------------------IATGSMDNTIRLWD 213

Query: 540 VSSGRCIRTQF-GHVEGV----WDI-----AADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589
            + G        GH + +    W+      A D  R+ S S D +IK+WD     C+ T 
Sbjct: 214 SNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTL 273

Query: 590 TGHKAPIVCVGIG 602
           +GH   + CV  G
Sbjct: 274 SGHTNSVSCVKWG 286

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           I    GH   V  + F  + R + + S+D+++ +WD ++G  I    GH   V  + +  
Sbjct: 394 ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSS 453

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVW 417
           D + +++ S D T++VW+  T        GH D V +VD     K + SA  DK V++W
Sbjct: 454 DCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKMVRIW 512

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 5/85 (5%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           RNG   I  F+GH+  V  + ++   RLL + S D+T+ +WD ++  L   L GH D V 
Sbjct: 431 RNGTF-IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVY 489

Query: 357 GI--YFDDQKMITASLDKTIRVWNY 379
            +    D +++ +A  DK +R+W +
Sbjct: 490 TVDWSVDGKRVCSAGKDKMVRIWTH 514

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score =  113 bits (282), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 157/359 (43%), Gaps = 72/359 (20%)

Query: 308 FKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DD 362
             GH   +L   F       + TG+ D+T  IWD  +   +  L GH++ V  + +  D 
Sbjct: 137 IAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADG 196

Query: 363 QKMITASLDKTIRVWNYITGSCIS-TYRGHQDSVLSVD---------SYKKIIVSASADK 412
           + + T S+D TIR+W+   G  +    RGH   + S+            K  + SAS D 
Sbjct: 197 EVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDG 256

Query: 413 TVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS-CIKVFR 470
           T+K+W    R C YTL GHT  V+C+K   ++   YS+S D+T+R WD+     CI + +
Sbjct: 257 TIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNV-LYSASHDRTVRCWDMAAGGKCINILK 315

Query: 471 GHVGQVQKVI------------------PLTIKDTENLVVD--EKIEKVPNPELEEDF-- 508
            H   V  +                   P + +D +   +   EK+ K  N  +EE    
Sbjct: 316 SHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAK-KNGTMEELMVT 374

Query: 509 -ADDCTG-------------------------IFDPNLKYPTHLLSCSLDNTIKLWEVSS 542
            +DD T                           F P+ +Y   ++S S DN+IKLW+   
Sbjct: 375 GSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRY---IVSASFDNSIKLWDGRD 431

Query: 543 GRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           G+ I T  GHV  V+ +A  +D   +VS S D ++KVWD++  K      GH   +  V
Sbjct: 432 GKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTV 490

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 124/301 (41%), Gaps = 85/301 (28%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMI-TASLDKTIRVWNYITGS 383
           L + S D T+ IWDT     I  L+GHT  V  I +  + ++ +AS D+T+R W+   G 
Sbjct: 249 LASASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGG 308

Query: 384 -CISTYRGHQDSV----LSVD---------------------------SYKKI------- 404
            CI+  + H   V    LS D                           +Y+K+       
Sbjct: 309 KCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTM 368

Query: 405 ---IVSASADKTVKVWHV--ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
              +V+ S D T+ +W+    S+    + GH + VN V   P      S+S D ++++WD
Sbjct: 369 EELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 428

Query: 460 IRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN 519
            R    I  FRGHV  V +V                            ++ DC       
Sbjct: 429 GRDGKFIATFRGHVASVYQVA---------------------------WSSDC------- 454

Query: 520 LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKV 577
                 L+SCS D T+K+W+V + +      GH + V+  D + D  R+ SG  DK +++
Sbjct: 455 ----RLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRL 510

Query: 578 W 578
           W
Sbjct: 511 W 511

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 90/225 (40%), Gaps = 47/225 (20%)

Query: 302 RCRIQLFKGHMDGVLSLKFNHR-LLFTGSYDSTVAIWDTKSG-----------NLIRRLT 349
           R  I    GH   V  +K+  R +L++ S+D TV  WD  +G           + +  L+
Sbjct: 266 RVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLS 325

Query: 350 GHTD-----------GVKGIYFDDQK--------------------MITASLDKTIRVWN 378
             TD           G K    +D +                    M+T S D T+ +WN
Sbjct: 326 LSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWN 385

Query: 379 YITGS-CISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHV-ESRTCYTLRGHTEWV 434
            + GS  I    GHQ  V  ++     + IVSAS D ++K+W   + +   T RGH   V
Sbjct: 386 PLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASV 445

Query: 435 NCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
             V          S S D TL++WD++T        GH  +V  V
Sbjct: 446 YQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTV 490

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 58/123 (47%), Gaps = 6/123 (4%)

Query: 301 GRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358
           G   I    GH   V  + F  + R + + S+D+++ +WD + G  I    GH   V  +
Sbjct: 389 GSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQV 448

Query: 359 YF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTV 414
            +  D + +++ S D T++VW+  T        GH D V +VD     K + S   DK V
Sbjct: 449 AWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMV 508

Query: 415 KVW 417
           ++W
Sbjct: 509 RLW 511

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 70/193 (36%), Gaps = 49/193 (25%)

Query: 421 SRTCYTLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           +R+   + GH   + C    P  S    + + D T R+WD  T + +   +GH   V  V
Sbjct: 131 TRSSSAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCV 190

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                                      D     TG               S+D TI+LW+
Sbjct: 191 -----------------------AWSADGEVIATG---------------SMDATIRLWD 212

Query: 540 VSSGRCIRTQF-GHVEGVWDIA---------ADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589
              G+ +     GH + +  ++          +  R+ S S D +IK+WD     CI T 
Sbjct: 213 SEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTL 272

Query: 590 TGHKAPIVCVGIG 602
           +GH + + C+  G
Sbjct: 273 SGHTSSVSCIKWG 285

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 47/85 (55%), Gaps = 5/85 (5%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           R+G+  I  F+GH+  V  + ++   RLL + S D+T+ +WD K+  L   L GH D V 
Sbjct: 430 RDGKF-IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVY 488

Query: 357 GI--YFDDQKMITASLDKTIRVWNY 379
            +    D +++ +   DK +R+W +
Sbjct: 489 TVDWSVDGKRVCSGGKDKMVRLWTH 513

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score =  110 bits (276), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 144/315 (45%), Gaps = 24/315 (7%)

Query: 308 FKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DD 362
             GH   +L   F       + TG+ D+T  IWD  +   +  L GH + V    +  D 
Sbjct: 139 IAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSPDG 198

Query: 363 QKMITASLDKTIRVWNYITGSCIS-TYRGHQDSVLSVDSYKKI----------IVSASAD 411
           + + T S+D TIR+W    G       RGH   + S+ S++ I          + +AS D
Sbjct: 199 ELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSL-SWEPIHLVKPGDKPRLATASKD 257

Query: 412 KTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS-CIKVF 469
            T+K+W    R C  TL GHT  V+CVK   K+   YS S DKT+R WD+  N  CI + 
Sbjct: 258 GTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNV-LYSGSHDKTIRCWDMNLNGKCINIL 316

Query: 470 RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFA-DDCTGIFDPNLKYPTHLLS 528
           + H   V  +   T         D K E   +PE  +  A  +   +      +   +++
Sbjct: 317 KSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVT 376

Query: 529 CSLDNTIKLW-EVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKC 585
            S D T+ LW  + S + I    GH + V  +A   D   IVS S D SIK+WD ++GK 
Sbjct: 377 ASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKF 436

Query: 586 IQTFTGHKAPIVCVG 600
           + TF GH A +  V 
Sbjct: 437 LSTFRGHVASVYQVA 451

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 90/330 (27%), Positives = 149/330 (45%), Gaps = 45/330 (13%)

Query: 302 RCRIQLFKGHMDGVL--SLKFNHRLLFTGSYDSTVAIWDTKSGNLI-RRLTGHTDGVKGI 358
           + R+   +GH + VL  S   +  L+ TGS D+T+ +W++  G      L GH+  +  +
Sbjct: 176 QTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSL 235

Query: 359 YF---------DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-SYKKIIVSA 408
            +         D  ++ TAS D TI++W+     C+ T  GH  SV  V    K ++ S 
Sbjct: 236 SWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVLYSG 295

Query: 409 SADKTVKVW--HVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM--WDIRTNS 464
           S DKT++ W  ++  +    L+ H  WVN + L          S D  LR+  +D +  +
Sbjct: 296 SHDKTIRCWDMNLNGKCINILKSHAHWVNHLSL----------STDYALRLGAFDHKGET 345

Query: 465 CIKVFRGHVGQVQKVIPLTIK--DTENLVV---DEKIEKVPNPELEEDFADDCTG----- 514
                      ++    +  +  D E L+V   D+    + NP          TG     
Sbjct: 346 PASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLV 405

Query: 515 ---IFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSG 569
               F P+ +Y   ++S S DN+IKLW+   G+ + T  GHV  V+ +A  +D   +VS 
Sbjct: 406 NHVAFSPDGRY---IVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSC 462

Query: 570 SHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           S D ++KVWD++  K      GH+  +  V
Sbjct: 463 SKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 492

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 123/301 (40%), Gaps = 85/301 (28%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMI-TASLDKTIRVWNY-ITG 382
           L T S D T+ IWDT     +  L GHT  V  + +  + ++ + S DKTIR W+  + G
Sbjct: 251 LATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNG 310

Query: 383 SCISTYRGHQDSV----LSVD-------------------------------------SY 401
            CI+  + H   V    LS D                                      +
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDF 370

Query: 402 KKIIVSASADKTVKVWHV--ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
           ++++V+AS D T+ +W+    ++    + GH + VN V   P      S+S D ++++WD
Sbjct: 371 EELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

Query: 460 IRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN 519
            R    +  FRGHV  V +V                            ++ DC       
Sbjct: 431 GRDGKFLSTFRGHVASVYQVA---------------------------WSSDC------- 456

Query: 520 LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKV 577
                 L+SCS D T+K+W+V + +      GH + V+  D + D  R+ SG  DK +++
Sbjct: 457 ----RLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRI 512

Query: 578 W 578
           W
Sbjct: 513 W 513

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           I    GH   V  + F  + R + + S+D+++ +WD + G  +    GH   V  + +  
Sbjct: 395 ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSS 454

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVW 417
           D + +++ S D T++VW+  T        GHQD V +VD     K + S   DK V++W
Sbjct: 455 DCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 104/268 (38%), Gaps = 64/268 (23%)

Query: 259 LINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSL 318
           L+ PG+ P    A++    + +    +V                C + L  GH   V  +
Sbjct: 242 LVKPGDKPRLATASKDGTIKIWDTTRRV----------------CLLTLC-GHTSSVSCV 284

Query: 319 KFNHR-LLFTGSYDSTVAIWDTK-SGNLIRRLTGHTDGVKGI-----------YFD---- 361
           K+  + +L++GS+D T+  WD   +G  I  L  H   V  +            FD    
Sbjct: 285 KWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGE 344

Query: 362 --------------------------DQKMITASLDKTIRVWNYITGS-CISTYRGHQDS 394
                                     ++ M+TAS D T+ +WN +  +  I+   GHQ  
Sbjct: 345 TPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKL 404

Query: 395 V--LSVDSYKKIIVSASADKTVKVWH-VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSD 451
           V  ++     + IVSAS D ++K+W   + +   T RGH   V  V          S S 
Sbjct: 405 VNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSK 464

Query: 452 DKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           D TL++WD++T        GH  +V  V
Sbjct: 465 DTTLKVWDVKTRKLSVDLPGHQDEVYTV 492

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 10/83 (12%)

Query: 530 SLDNTIKLWEVSSGRCIRTQF-GHVEGVWDIA---------ADNFRIVSGSHDKSIKVWD 579
           S+DNTI+LWE S G+       GH + +  ++          D  R+ + S D +IK+WD
Sbjct: 205 SMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWD 264

Query: 580 LQNGKCIQTFTGHKAPIVCVGIG 602
                C+ T  GH + + CV  G
Sbjct: 265 TTRRVCLLTLCGHTSSVSCVKWG 287

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 5/85 (5%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           R+G+  +  F+GH+  V  + ++   RLL + S D+T+ +WD K+  L   L GH D V 
Sbjct: 432 RDGKF-LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVY 490

Query: 357 GI--YFDDQKMITASLDKTIRVWNY 379
            +    D +++ +   DK +R+W +
Sbjct: 491 TVDWSVDGKRVCSGGKDKMVRIWTH 515

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score =  109 bits (273), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 103/359 (28%), Positives = 152/359 (42%), Gaps = 72/359 (20%)

Query: 308 FKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DD 362
             GH   +L   F       + TG  D+T  IWD  +      L GH + V  + +  D 
Sbjct: 141 IAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADG 200

Query: 363 QKMITASLDKTIRVWNYITGSCIS-TYRGHQDSVLSV---------DSYKKIIVSASADK 412
           + + T S+D TIR+W+  +G  +    RGH   + S+            K  + SAS D 
Sbjct: 201 EVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDG 260

Query: 413 TVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS-CIKVFR 470
           T+++W    R C  TL GHT  V+CVK   +    YS S DKT+R WD++ N  CI + +
Sbjct: 261 TIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGI-LYSGSHDKTVRAWDMKQNGKCINILK 319

Query: 471 GHVGQVQK------------------VIPLTIKDTENLVVDEKIEKVP-----NPELEED 507
            H   V                    V P   K+  +  + +  EKV      + EL   
Sbjct: 320 SHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKAL-QNYEKVARKNGKHEELMVT 378

Query: 508 FADDCTGI-------------------------FDPNLKYPTHLLSCSLDNTIKLWEVSS 542
            +DD T                           F P+ KY   ++S S DN+IKLW+   
Sbjct: 379 ASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKY---IVSASFDNSIKLWDGKE 435

Query: 543 GRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           G  + T  GHV  V+ +A  +D   +VS S D ++KVWD++  K      GH+  +  V
Sbjct: 436 GTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 494

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 124/301 (41%), Gaps = 85/301 (28%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMI-TASLDKTIRVWNYI-TG 382
           L + S D T+ IWD+     +  L GHT+ V  + +  + ++ + S DKT+R W+    G
Sbjct: 253 LASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNG 312

Query: 383 SCISTYRGHQ----------DSVLSVDSY------------------------------- 401
            CI+  + H           D  L V ++                               
Sbjct: 313 KCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKH 372

Query: 402 KKIIVSASADKTVKVWHV--ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
           ++++V+AS D T+ +W+    ++    + GH + VN V   P      S+S D ++++WD
Sbjct: 373 EELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWD 432

Query: 460 IRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN 519
            +  + +  FRGHV  V +V                            ++ DC       
Sbjct: 433 GKEGTFLSTFRGHVASVYQVA---------------------------WSSDC------- 458

Query: 520 LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKV 577
                 L+SCS D T+K+W+V + +      GH + V+  D + D  R+ SG  DK +++
Sbjct: 459 ----RLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRL 514

Query: 578 W 578
           W
Sbjct: 515 W 515

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 106/268 (39%), Gaps = 64/268 (23%)

Query: 259 LINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSL 318
           L+ PG+ P    A++    R +    +V                C + L  GH + V  +
Sbjct: 244 LVEPGSKPRLASASKDGTIRIWDSSRRV----------------CLMTL-GGHTNSVSCV 286

Query: 319 KFNHR-LLFTGSYDSTVAIWDTK-SGNLIRRLTGHTDGVKGI-----------YFD---- 361
           K+    +L++GS+D TV  WD K +G  I  L  H   V  +            FD    
Sbjct: 287 KWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGV 346

Query: 362 --------------------------DQKMITASLDKTIRVWNYITGS-CISTYRGHQDS 394
                                     ++ M+TAS D T+ +WN + G+  IS   GHQ  
Sbjct: 347 KPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKL 406

Query: 395 V--LSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCYSSSD 451
           V  ++     K IVSAS D ++K+W  +  T   T RGH   V  V          S S 
Sbjct: 407 VNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWSSDCRLLVSCSK 466

Query: 452 DKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           D TL++WD++T        GH  +V  V
Sbjct: 467 DTTLKVWDVKTRKLSVDLPGHQDEVYTV 494

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 301 GRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358
           G   I    GH   V  + F  + + + + S+D+++ +WD K G  +    GH   V  +
Sbjct: 393 GTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQV 452

Query: 359 YF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTV 414
            +  D + +++ S D T++VW+  T        GHQD V +VD     K + S   DK +
Sbjct: 453 AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMM 512

Query: 415 KVW 417
           ++W
Sbjct: 513 RLW 515

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQF-GHVEGVWDIAADNF---------RIVSGSHDKSI 575
           + + S+DNTI+LW+  SG+ +     GH + +  +  +           R+ S S D +I
Sbjct: 203 IATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTI 262

Query: 576 KVWDLQNGKCIQTFTGHKAPIVCVGIG 602
           ++WD     C+ T  GH   + CV  G
Sbjct: 263 RIWDSSRRVCLMTLGGHTNSVSCVKWG 289

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score =  104 bits (259), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/283 (28%), Positives = 126/283 (44%), Gaps = 18/283 (6%)

Query: 327 TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSC 384
           TGS D+T+ IWD  +G L   L GH   V+ I    +   M +AS DK ++ W+    + 
Sbjct: 140 TGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTA 199

Query: 385 ISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHP 441
           I  + GH   V +VD +    II +A  D  V++W + SR+    L GH   +N VK  P
Sbjct: 200 IRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLP 259

Query: 442 KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI--PLTIKDTENLVVDEKIEKV 499
                 S S D T+R+WDI      KV   H   ++ +   P           D +  K+
Sbjct: 260 VDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHPAEFSFASVSTNDVRSWKL 319

Query: 500 PNPELEEDFADDCTGIFDP-NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF-----GHV 553
           P  +L  +F    TGI +  ++ +   LL+   D T+  ++  +G   ++       G +
Sbjct: 320 PEGQLLTNFQSQNTGILNTVSINHDNVLLAGGDDGTLCFYDYKTGHKYQSMMTTEVAGSL 379

Query: 554 EGVWDIAADNF-----RIVSGSHDKSIKVWDLQNGKCIQTFTG 591
           E    I    F     R+++G  DKSIK+W         TF G
Sbjct: 380 ESERSILCSTFDVTGTRLITGEGDKSIKIWKQVPDATEDTFPG 422

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 117/280 (41%), Gaps = 49/280 (17%)

Query: 344 LIRRLTGHTDGVKGI---YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSV 398
           L + + GHT  V+ +     D++   T S D TI++W+   G    T  GH  SV  +++
Sbjct: 114 LSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAI 173

Query: 399 DSYKKIIVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
                 + SAS DK VK W +E  T      GH   V+ V +HP      ++  D  +R+
Sbjct: 174 SKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRL 233

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           WDIR+ S I V  GH   + KV  L +                                D
Sbjct: 234 WDIRSRSEIMVLPGHKSPINKVKCLPV--------------------------------D 261

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSI 575
           P       ++SCS D T++LW++ +G+  +    H   + D+      F   S S +  +
Sbjct: 262 P------QIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHPAEFSFASVSTN-DV 314

Query: 576 KVWDLQNGKCIQTFTGHKAPIV-CVGIG-DSSFVSGDELG 613
           + W L  G+ +  F      I+  V I  D+  ++G + G
Sbjct: 315 RSWKLPEGQLLTNFQSQNTGILNTVSINHDNVLLAGGDDG 354

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 74/183 (40%), Gaps = 41/183 (22%)

Query: 417 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVFRGHVGQ 475
           WH   +    + GHT WV CV + P     +++ S+D T+++WD+          GHV  
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMS 167

Query: 476 VQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTI 535
           V+               D  I K                      ++P ++ S S D  +
Sbjct: 168 VR---------------DIAISK----------------------RHP-YMFSASEDKLV 189

Query: 536 KLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHK 593
           K W++     IR   GH+ GV   D+      I +   D  +++WD+++   I    GHK
Sbjct: 190 KCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHK 249

Query: 594 API 596
           +PI
Sbjct: 250 SPI 252

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 138/306 (45%), Gaps = 33/306 (10%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITG 382
           LL +  YD T+  W+  +G  +R +      V  +   +D+K++ A+  + IR+++  T 
Sbjct: 4   LLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTS 63

Query: 383 SC--ISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438
           +   ++++ GH+ +V SV   +  K +V++S D T+KVW + S +      H   VN V 
Sbjct: 64  NSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVV 123

Query: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL----TIKDTENLVVDE 494
           +HP      S   D  +R+WD+  N C      H    +  +PL       D   LV   
Sbjct: 124 IHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDDVPLQSLSVASDGSMLVAAN 178

Query: 495 K-----IEKVPNPELEEDFADDCTGIFDPNLKYPT---------HLLSCSLDNTIKLWEV 540
                 + ++PN     +        F  +  Y T         H+ +CS D+T ++W V
Sbjct: 179 NKGNCYVWEMPNHTDASNLKPATK--FKAHPSYITRVLLSSDVKHMATCSADHTARIWSV 236

Query: 541 SSGRCIRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIV 597
                + +   GH   VWD A  AD+  +V+ S D  +++WDL     I+ + GH    V
Sbjct: 237 EDNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAV 296

Query: 598 CVGIGD 603
           CV + D
Sbjct: 297 CVALND 302

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 84/224 (37%), Gaps = 56/224 (25%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           +  F+GH   V S+ F  +++ + T S D T+ +WD +S ++ R    +    + +   +
Sbjct: 68  VASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHPN 127

Query: 363 Q-KMITASLDKTIRVWNYITGSCISTYRGHQD---SVLSVDSYKKIIVSA---------- 408
           Q ++I+   D  IR+W+     C        D     LSV S   ++V+A          
Sbjct: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVWE 187

Query: 409 --------------------------------------SADKTVKVWHVESRTCY--TLR 428
                                                 SAD T ++W VE       TL 
Sbjct: 188 MPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLESTLD 247

Query: 429 GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
           GH  WV        S    ++S D  +R+WD+ T   I+ + GH
Sbjct: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGH 291

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 42/96 (43%), Gaps = 5/96 (5%)

Query: 308 FKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSG-NLIRRLTGHTDGVKGIYF--DD 362
           FK H   +  + L  + + + T S D T  IW  +   NL   L GH   V    F  D 
Sbjct: 203 FKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLESTLDGHQRWVWDCAFSADS 262

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV 398
             ++TAS D  +R+W+  T   I  Y GH    + V
Sbjct: 263 AYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGAVCV 298

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score =  102 bits (255), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 130/283 (45%), Gaps = 18/283 (6%)

Query: 327 TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSC 384
           TGS D+T+ IWD  +G L   L+GH   VK I    +   M +AS DK ++ W+      
Sbjct: 147 TGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKCWDLEKNRV 206

Query: 385 ISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHP 441
           I  Y GH   V +VD +    +I +A  D  V++W + ++    T+ GH   +N VK  P
Sbjct: 207 IRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLP 266

Query: 442 KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK--VIPLTIKDTENLVVDEKIEKV 499
                 S S D T+R+WDI     +KV   H   V+   + P     +     D +  K+
Sbjct: 267 VDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGEFSISSACTDDIRSWKL 326

Query: 500 PNPELEEDFADDCTGIFDP-NLKYPTHLLSCSLDNTIKLWEVSSGRCIR----TQF-GHV 553
           P  +L  +F  + TGI +  ++     L + S +  +  ++  +G   +    T+  G +
Sbjct: 327 PEGQLLTNFQSEKTGIINTLSINQDDVLFAGSDNGVLSFYDYKTGHKYQQLDTTEIPGSL 386

Query: 554 EGVWDIAADNF-----RIVSGSHDKSIKVWDLQNGKCIQTFTG 591
           E    I    F     R+++G  DKSIK+W        +T+TG
Sbjct: 387 ESERGILTSTFDQTGLRLITGESDKSIKIWKQDQDATPETYTG 429

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 110/262 (41%), Gaps = 47/262 (17%)

Query: 344 LIRRLTGHTDGVKGIY---FDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSV 398
           L+R + GH   V+ +     D++   T S D TI++W+  TG    T  GH  +V  + +
Sbjct: 121 LMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICI 180

Query: 399 DSYKKIIVSASADKTVKVWHVE-SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
                 + SAS DK VK W +E +R      GH   V+ V +HP      ++  D  +R+
Sbjct: 181 SKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRL 240

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           WDIRT   +    GH   + +V  L +                                D
Sbjct: 241 WDIRTKLPVMTMAGHKSPINRVKCLPV--------------------------------D 268

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSI 575
           P       ++SCS D T++LW++++G+ ++    H   V DI      F I S   D  I
Sbjct: 269 P------QVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGEFSISSACTD-DI 321

Query: 576 KVWDLQNGKCIQTFTGHKAPIV 597
           + W L  G+ +  F   K  I+
Sbjct: 322 RSWKLPEGQLLTNFQSEKTGII 343

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 93/199 (46%), Gaps = 11/199 (5%)

Query: 417 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVFRGHVGQ 475
           WH   +    + GH  WV  V + P     +++ S+D T+++WD+ T        GH+  
Sbjct: 115 WHAPWKLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMT 174

Query: 476 VQKVI-----PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCS 530
           V+ +      P     +E+ +V  K   +    +  D+    +G+   ++    +L++ +
Sbjct: 175 VKDICISKRHPYMFSASEDKLV--KCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATA 232

Query: 531 -LDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQ 587
             D+ ++LW++ +   + T  GH   +  +     + ++VS S D ++++WD+  GK ++
Sbjct: 233 GRDSVVRLWDIRTKLPVMTMAGHKSPINRVKCLPVDPQVVSCSADATVRLWDITAGKTLK 292

Query: 588 TFTGHKAPIVCVGIGDSSF 606
             T HK  +  +GI    F
Sbjct: 293 VLTHHKRSVRDIGIHPGEF 311

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score =  103 bits (258), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 129/289 (44%), Gaps = 65/289 (22%)

Query: 318 LKF--NHRLLFTGSYDSTVAIWD-------------TKSGNLIRRLTGHTDGVKGIYF-- 360
           L+F  + RL+  G  DS + +W               K  +    L GH+  V  + F  
Sbjct: 493 LRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSP 552

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWH 418
           D++ +++AS DKT+R+W+  T +C+ +Y+GH   V  V          + S D+T ++W 
Sbjct: 553 DNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWS 612

Query: 419 VESRTCYTLR---GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQ 475
            +    Y LR   GH   V+CV  HP      + S DKT RMWDI+T   +++F GH   
Sbjct: 613 CDH--IYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTAS 670

Query: 476 VQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTI 535
           V  V                                      P+ ++   L + S D  I
Sbjct: 671 VVSV-----------------------------------AVSPDGRW---LTTGSEDGVI 692

Query: 536 KLWEVSSGRCIRTQFGHVE-GVWDIA--ADNFRIVSGSHDKSIKVWDLQ 581
            +W++ +G+ I+   GH +  V+ ++   +   +VSG  D+S++VWDL+
Sbjct: 693 IVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 109/254 (42%), Gaps = 59/254 (23%)

Query: 359 YFDDQKMITASL-DKTIRVWNYITGSCIS--------------TYRGHQDSVLSVD--SY 401
           + DD +++ A   D  I++W+ + G+ +               T  GH   V SV     
Sbjct: 495 FSDDSRLVAAGFQDSYIKLWS-LDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPD 553

Query: 402 KKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
            + +VSAS DKTV++W +++ TC  + +GH   V  VK  P      + S D+T R+W  
Sbjct: 554 NRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSC 613

Query: 461 RTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL 520
                +++F GH+  V                                  DC   F PN 
Sbjct: 614 DHIYPLRIFAGHLNDV----------------------------------DCV-TFHPN- 637

Query: 521 KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVW 578
              T++L+ S D T ++W++ +G  +R   GH   V  +A   D   + +GS D  I VW
Sbjct: 638 --GTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVW 695

Query: 579 DLQNGKCIQTFTGH 592
           D+  GK I+   GH
Sbjct: 696 DIGTGKRIKQMRGH 709

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           +++F GH++ V  + F  N   + TGS D T  +WD ++G+ +R   GHT  V  +    
Sbjct: 619 LRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSP 678

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVW 417
           D + + T S D  I VW+  TG  I   RGH  S +   S+ K   I+VS  AD++V+VW
Sbjct: 679 DGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVW 738

Query: 418 HVESRT 423
            ++  T
Sbjct: 739 DLKKFT 744

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 85/215 (39%), Gaps = 54/215 (25%)

Query: 403 KIIVSASADKTVKVWHVE--------------SRTCYTLRGHTEWVNCVKLHPKSFTCYS 448
           +++ +   D  +K+W ++              +    TL GH+  V  V   P +    S
Sbjct: 500 RLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVS 559

Query: 449 SSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDF 508
           +S+DKT+R+W + T +C+  ++GH   V  V                             
Sbjct: 560 ASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVK---------------------------- 591

Query: 509 ADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRI 566
                  F P   Y     + S D T +LW       +R   GH+  V       +   +
Sbjct: 592 -------FSPLGHY---FATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYV 641

Query: 567 VSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           ++GS DK+ ++WD+Q G  ++ F GH A +V V +
Sbjct: 642 LTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAV 676

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 85/187 (45%), Gaps = 8/187 (4%)

Query: 293 QVESNWRNGRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTG 350
           Q+ S  ++    + L  GH   V S+ F  ++R L + S D TV +W   +   +    G
Sbjct: 524 QLPSKAKDASNTVTLI-GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKG 582

Query: 351 HTDGVKGIYFDD--QKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIV 406
           H   V  + F        T S D+T R+W+      +  + GH + V  ++       ++
Sbjct: 583 HNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVL 642

Query: 407 SASADKTVKVWHVESRTCYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC 465
           + S+DKT ++W +++     L  GHT  V  V + P      + S+D  + +WDI T   
Sbjct: 643 TGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKR 702

Query: 466 IKVFRGH 472
           IK  RGH
Sbjct: 703 IKQMRGH 709

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 69/160 (43%), Gaps = 17/160 (10%)

Query: 442 KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPN 501
           +  TC   SDD  L     + +S IK++      ++  +P   KD  N V          
Sbjct: 488 REMTCLRFSDDSRLVAAGFQ-DSYIKLWSLDGTPLESQLPSKAKDASNTVT--------- 537

Query: 502 PELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA 561
             L        +  F P+ +Y   L+S S D T++LW + +  C+ +  GH   VWD+  
Sbjct: 538 --LIGHSGPVYSVSFSPDNRY---LVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKF 592

Query: 562 DNF--RIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
                   +GSHD++ ++W   +   ++ F GH   + CV
Sbjct: 593 SPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCV 632

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score =  100 bits (248), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 100/191 (52%), Gaps = 17/191 (8%)

Query: 308 FKGHMDGVLSLKFNH---RLLFTGSYDSTVAIW-----DTKSGNLIRRLTGHTDGVK--G 357
            +GH   V SL  +     +L +GS D T+  W     D + G  +R   GH+  V+   
Sbjct: 29  LEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCT 88

Query: 358 IYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVK 415
           +  D +  ++AS DKT+R+W+  +G CI  + GH+  V+SV  D     IVSAS DKTVK
Sbjct: 89  VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVK 148

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPK-----SFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
           VW+       TL GH +WV+ V++ P      + T  S+  DK +++WD+++ +    F 
Sbjct: 149 VWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFI 208

Query: 471 GHVGQVQKVIP 481
           GH   V  V P
Sbjct: 209 GHNNYVTTVTP 219

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 87/174 (50%), Gaps = 13/174 (7%)

Query: 305 IQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           ++ FKGH   V      H  +   + S+D T+ +WD +SG  I+R  GH   V  +  D 
Sbjct: 74  VRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDP 133

Query: 363 Q--KMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV---DSYKK----IIVSASADKT 413
           +  ++++AS DKT++VWN + G C+ T  GH D V +V    S K      ++SA  DK 
Sbjct: 134 RATQIVSASRDKTVKVWNTV-GDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKV 192

Query: 414 VKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCI 466
           VKVW ++S T      GH  +V  V   P      S+  D  + +W++   + +
Sbjct: 193 VKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTAL 246

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 94/230 (40%), Gaps = 57/230 (24%)

Query: 387 TYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHVESR------TCYTLRGHTEWV-NC 436
           T  GH   V S+ +      +++S S DKT+  W +            + +GH+  V +C
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKI 496
              H   +   S+S DKTLR+WD+++  CIK F GH   V  V                 
Sbjct: 88  TVTHDGKY-ALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVS---------------- 130

Query: 497 EKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV 556
                               DP     T ++S S D T+K+W  + G C+ T  GH + V
Sbjct: 131 -------------------IDPR---ATQIVSASRDKTVKVWN-TVGDCVVTLLGHNDWV 167

Query: 557 WDI-------AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            ++       + D   ++S   DK +KVWDLQ+      F GH   +  V
Sbjct: 168 SNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTV 217

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 78/187 (41%), Gaps = 47/187 (25%)

Query: 426 TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMW-----DIRTNSCIKVFRGHVGQVQKV 479
           TL GH  WV  +   P +     S S DKTL  W     D +    ++ F+GH   VQ  
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQ-- 85

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                                          DCT   D   KY    LS S D T++LW+
Sbjct: 86  -------------------------------DCTVTHDG--KYA---LSASWDKTLRLWD 109

Query: 540 VSSGRCIRTQFGHVEGVWDIAAD--NFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIV 597
           + SG+CI+   GH   V  ++ D    +IVS S DK++KVW+   G C+ T  GH   + 
Sbjct: 110 LQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTV-GDCVVTLLGHNDWVS 168

Query: 598 CVGIGDS 604
            V I  S
Sbjct: 169 NVRIAPS 175

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 77/158 (48%), Gaps = 15/158 (9%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKFNHRL--LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           ++G+C I+ F GH   V+S+  + R   + + S D TV +W+T  G+ +  L GH D V 
Sbjct: 111 QSGKC-IKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNT-VGDCVVTLLGHNDWVS 168

Query: 357 GIYF-------DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK--KIIVS 407
            +         D   +I+A +DK ++VW+  + +  + + GH + V +V       I  S
Sbjct: 169 NVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFAS 228

Query: 408 ASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSF 444
           A  D  + +W++  +T  YTL    E V  V   P  +
Sbjct: 229 AGKDGQIILWNLNEKTALYTLDAKDE-VFAVAFSPNRY 265

>Kwal_26.8776
          Length = 433

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 135/312 (43%), Gaps = 21/312 (6%)

Query: 288 YRERFQVESNWRNGRCRIQLFKGHMDGVLSL---KFNHRLLFTGSYDSTVAIWDTKSGNL 344
           ++++ +++  W      +++  GH   V  +     ++    TGS D+T+ +WD  SG L
Sbjct: 97  HKQQLELQPEWHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKL 156

Query: 345 IRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK 402
              LTGH   V+ +    +   M +AS DK ++ W+    + I  Y GH   V +VD + 
Sbjct: 157 KLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHP 216

Query: 403 KI--IVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
            +  I SA  D  V++W + +R    TL GH   +N VK  P      S S D T+R+WD
Sbjct: 217 TLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSSDATVRLWD 276

Query: 460 IRTNSCIKVFRGHVGQVQKVI--PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           IR     K+   H   V+ +   P           D +  +  + +L  ++  +  GI +
Sbjct: 277 IRAGKATKILTHHSKSVRAIAAHPAESSVATASTSDVRSWRHSDGQLLTNYHSEGIGIIN 336

Query: 518 P-NLKYPTHLLSCSLDNTIKLWEVSSGR--------CIRTQFGHVEGVWDIAAD--NFRI 566
             ++     L     D  +  ++  SG          I        G+   + D    R+
Sbjct: 337 SLSVNADGVLFGGGDDGNLSFFDYKSGHKYQELPTTKIPGSLDSERGILSASFDQTGLRL 396

Query: 567 VSGSHDKSIKVW 578
           ++G  DKSIK+W
Sbjct: 397 ITGESDKSIKMW 408

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 105/253 (41%), Gaps = 45/253 (17%)

Query: 344 LIRRLTGHTDGVKGI---YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDS 400
           L+R + GH   V+ +     D+    T S D TI+VW+  +G    T  GH  +V SV  
Sbjct: 113 LMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAV 172

Query: 401 YKK--IIVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
            ++  ++ SAS DK VK W +E         GH   VN V +HP      S+  D  +R+
Sbjct: 173 SQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRL 232

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           WDIRT   +    GH   + +V    +                                D
Sbjct: 233 WDIRTRLPVMTLAGHKSPINQVKCFPV--------------------------------D 260

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-IVSGSHDKSIK 576
           P +      +SCS D T++LW++ +G+  +    H + V  IAA      V+ +    ++
Sbjct: 261 PQI------MSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAESSVATASTSDVR 314

Query: 577 VWDLQNGKCIQTF 589
            W   +G+ +  +
Sbjct: 315 SWRHSDGQLLTNY 327

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 88/194 (45%), Gaps = 13/194 (6%)

Query: 417 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVFRGHVGQ 475
           WH   +    + GH  WV CV   P     +++ S+D T+++WD+ +        GHV  
Sbjct: 107 WHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMT 166

Query: 476 VQKVI-----PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH--LLS 528
           V+ V      PL    +E+ +V  K   +       D+    +G+   ++ +PT   + S
Sbjct: 167 VRSVAVSQRHPLMFSASEDKMV--KCWDLERNAAIRDYHGHFSGVNTVDV-HPTLDLIAS 223

Query: 529 CSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCI 586
              D  ++LW++ +   + T  GH   +  +     + +I+S S D ++++WD++ GK  
Sbjct: 224 AGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFPVDPQIMSCSSDATVRLWDIRAGKAT 283

Query: 587 QTFTGHKAPIVCVG 600
           +  T H   +  + 
Sbjct: 284 KILTHHSKSVRAIA 297

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQNGKCIQ 587
           S D TIK+W+++SG+   T  GHV  V  +A       + S S DK +K WDL+    I+
Sbjct: 141 SNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIR 200

Query: 588 TFTGHKAPIVCVGI 601
            + GH + +  V +
Sbjct: 201 DYHGHFSGVNTVDV 214

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%)

Query: 544 RCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           R I    G V  V     DN    +GS+D +IKVWD+ +GK   T TGH   +  V +
Sbjct: 115 RVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAV 172

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 10/75 (13%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLT-----GHTDGVKGIY---FDDQ--KMITASLDKT 373
           +LF G  D  ++ +D KSG+  + L      G  D  +GI    FD    ++IT   DK+
Sbjct: 345 VLFGGGDDGNLSFFDYKSGHKYQELPTTKIPGSLDSERGILSASFDQTGLRLITGESDKS 404

Query: 374 IRVWNYITGSCISTY 388
           I++W  I  +   T+
Sbjct: 405 IKMWKQIPEATPETH 419

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 131/274 (47%), Gaps = 17/274 (6%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           +    + ST+ +WD + G L+ R   H   V+G+ F   +   ++A  D TI+VW+  T 
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTN 85

Query: 383 SCISTYRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKL 439
            C+ T  GH D V +V  ++++  I+SAS D+T+++W+ ++R     L GH  +V C + 
Sbjct: 86  KCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQF 145

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKV 499
           HP      S+S D+T+R+WDI       + + H           +   +NL+     + V
Sbjct: 146 HPTDDLIVSASLDETIRIWDIS-----GLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCV 200

Query: 500 PNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC--IRTQFGHVEGVW 557
               LE          F P L     ++S S D  +KLW +S+ +   + T  GH   V 
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPL---IVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVD 257

Query: 558 DIAADNFR--IVSGSHDKSIKVWDLQNGKCIQTF 589
            +     +  I+S   DK+++VWDL     ++ F
Sbjct: 258 SVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQF 291

 Score = 85.1 bits (209), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 121/265 (45%), Gaps = 31/265 (11%)

Query: 344 LIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY 401
           ++ +    +   KGI F   +  ++ A    TI++W+Y  G+ +  +  H+  V  +D +
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFH 62

Query: 402 --KKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
             + I VSA  D T+KVW +++  C YTL GH ++V  V  H +     S+SDD+T+R+W
Sbjct: 63  PTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIW 122

Query: 459 DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV----DEKIEKVPNPELEEDFADDCTG 514
           + +    I    GH      V+      T++L+V    DE I       L +  +   T 
Sbjct: 123 NWQNRKEIACLTGH---NHFVMCAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTS 179

Query: 515 IFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF---GHVEGV-WDIAADNFR-IVSG 569
            F+  +    +LL  SL           G C+  +F   GH  GV W         IVSG
Sbjct: 180 SFEEQMSAQQNLLDGSL-----------GDCV-VKFILEGHTRGVNWASFHPTLPLIVSG 227

Query: 570 SHDKSIKVWDLQNGKC--IQTFTGH 592
           S D+ +K+W +   K   + T  GH
Sbjct: 228 SDDRQVKLWRMSATKAWEVDTCRGH 252

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 93/200 (46%), Gaps = 39/200 (19%)

Query: 310 GHMDGVLSLKFNHRL--LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKM 365
           GH+D V ++ F+  L  + + S D T+ IW+ ++   I  LTGH   V    F   D  +
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLI 152

Query: 366 ITASLDKTIRVW-------------------------NYITGS---CISTY--RGHQDSV 395
           ++ASLD+TIR+W                         N + GS   C+  +   GH   V
Sbjct: 153 VSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGV 212

Query: 396 --LSVDSYKKIIVSASADKTVKVWHVESRTCY---TLRGHTEWVNCVKLHPKSFTCYSSS 450
              S      +IVS S D+ VK+W + +   +   T RGHT  V+ V  HP      S  
Sbjct: 213 NWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG 272

Query: 451 DDKTLRMWDIRTNSCIKVFR 470
           +DKTLR+WD+   + +K F+
Sbjct: 273 EDKTLRVWDLDKRTPVKQFK 292

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 66/167 (39%), Gaps = 44/167 (26%)

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKI 496
           +  HP       +    T+++WD R  + +  F  H G V+ +                 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL----------------- 59

Query: 497 EKVPNPELEEDFADDCTGIFDPNLKYPTH--LLSCSLDNTIKLWEVSSGRCIRTQFGHVE 554
                     DF             +PT    +S   D TIK+W + + +C+ T  GH++
Sbjct: 60  ----------DF-------------HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLD 96

Query: 555 GVWDIAADNFR--IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            V  +        I+S S D++I++W+ QN K I   TGH   ++C 
Sbjct: 97  YVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCA 143

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 71/159 (44%), Gaps = 12/159 (7%)

Query: 278 RYYTRPWKVIYRERFQVESNWRNGR---CRIQ-LFKGHMDGV--LSLKFNHRLLFTGSYD 331
           + ++ P    + E+   + N  +G    C ++ + +GH  GV   S      L+ +GS D
Sbjct: 171 KRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDD 230

Query: 332 STVAIWDTKSGNL--IRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCIST 387
             V +W   +     +    GHT+ V  + F   +  +I+   DKT+RVW+    + +  
Sbjct: 231 RQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQ 290

Query: 388 YRGHQDSVLSVDSYKKI-IVSASADKTVKVWHVE-SRTC 424
           ++   D    + ++  I +  A+ D  + V+ ++  R C
Sbjct: 291 FKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPC 329

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score =  101 bits (252), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 126/284 (44%), Gaps = 67/284 (23%)

Query: 323 RLLFTGSYDSTVAIW-------------DTKSGNLIRRLTGHTDGVKGIYF--DDQKMIT 367
           RL   G  DST+ +W               K  +    L GH+  V  + F  D++ +++
Sbjct: 511 RLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLS 570

Query: 368 ASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY 425
           AS DKT+R+W+  T +C+  Y+GH   V  +         ++AS D+T ++W  +    Y
Sbjct: 571 ASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDH--IY 628

Query: 426 TLR---GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL 482
            LR   GH   V+C   HP     ++ S DKT RMWDI+T   +++F GH   V      
Sbjct: 629 PLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTA---- 684

Query: 483 TIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSS 542
                                LE            P+ ++   L + S D TI +W++ +
Sbjct: 685 ---------------------LE----------VSPDGRW---LTTGSEDGTIIVWDIGT 710

Query: 543 GRCIRTQFGHVEGVWDIAADNFR-----IVSGSHDKSIKVWDLQ 581
           G+ I+   GH  G   I +  F      +V+G  D+S++VWD++
Sbjct: 711 GKRIKQMKGH--GKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 115/262 (43%), Gaps = 60/262 (22%)

Query: 359 YFDDQKMITASL-DKTIRVWNYITGSCI--------------STYRGHQDSVLSV--DSY 401
           + DD ++  A   D TI+VW Y+ GS +              +T  GH   V SV     
Sbjct: 506 FSDDARLTAAGFQDSTIKVW-YLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPD 564

Query: 402 KKIIVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
            + ++SAS DKTV++W +++ TC    +GH   V  VK  P      ++S D+T R+W  
Sbjct: 565 NRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSC 624

Query: 461 RTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL 520
                +++F GH+  V                                  DC+  F PN 
Sbjct: 625 DHIYPLRIFSGHLNDV----------------------------------DCS-TFHPNG 649

Query: 521 KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVW 578
            Y   + + S D T ++W++ +G  +R   GH   V   +++ D   + +GS D +I VW
Sbjct: 650 CY---VFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVW 706

Query: 579 DLQNGKCIQTFTGH-KAPIVCV 599
           D+  GK I+   GH K PI  +
Sbjct: 707 DIGTGKRIKQMKGHGKNPIYSI 728

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           +++F GH++ V    F  N   +FTGS D T  +WD ++G+ +R   GHT  V  +    
Sbjct: 630 LRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSP 689

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVW 417
           D + + T S D TI VW+  TG  I   +GH  + +   ++ K    +V+  AD++V+VW
Sbjct: 690 DGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVW 749

Query: 418 HVESRT 423
            ++  T
Sbjct: 750 DIKRFT 755

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 80/170 (47%), Gaps = 7/170 (4%)

Query: 310 GHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QKM 365
           GH   V S+ F  ++R L + S D TV +W   +   +    GH   V  + F       
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 366 ITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVESRT 423
           ITAS D+T R+W+      +  + GH + V     +     + + S+DKT ++W +++  
Sbjct: 611 ITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGD 670

Query: 424 CYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
              L  GHT  V  +++ P      + S+D T+ +WDI T   IK  +GH
Sbjct: 671 SVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGH 720

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 73/202 (36%), Gaps = 59/202 (29%)

Query: 444 FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPE 503
            TC   SDD  L     + +S IKV+      +Q ++P   KD  N              
Sbjct: 501 MTCVEFSDDARLTAAGFQ-DSTIKVWYLDGSPLQSILPSKAKDQSNSAT----------- 548

Query: 504 LEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW------ 557
           L        +  F P+ +Y   LLS S D T++LW + +  C+    GH   VW      
Sbjct: 549 LVGHSGPVYSVAFSPDNRY---LLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSP 605

Query: 558 ---------------------------------DIAADNFR-----IVSGSHDKSIKVWD 579
                                            D+    F      + +GS DK+ ++WD
Sbjct: 606 LGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWD 665

Query: 580 LQNGKCIQTFTGHKAPIVCVGI 601
           +Q G  ++ F GH +P+  + +
Sbjct: 666 IQTGDSVRLFLGHTSPVTALEV 687

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 98.6 bits (244), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 113/262 (43%), Gaps = 47/262 (17%)

Query: 344 LIRRLTGHTDGVKGI---YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSV 398
           L R + GHT  V+ +     D+    T S D TIRVW+  TG    T +GH  +V  + +
Sbjct: 105 LTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICI 164

Query: 399 DSYKKIIVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
            +    + SAS DK VK W +E  T      G    V+ V LHP      S+  D  +R+
Sbjct: 165 SARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRV 224

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           WDIR+ SC+    GH G + KV  L +                                D
Sbjct: 225 WDIRSRSCVLTLAGHRGPINKVRCLPV--------------------------------D 252

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD--NFRIVSGSHDKSI 575
           P       ++SCS D T+KLW++ +G+ ++T   H   V D+A +   F   S   D  I
Sbjct: 253 P------QIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTD-DI 305

Query: 576 KVWDLQNGKCIQTFTGHKAPIV 597
           + W L +G+ +  F      IV
Sbjct: 306 RSWKLVDGQLLTNFNSEALGIV 327

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 137/333 (41%), Gaps = 37/333 (11%)

Query: 288 YRERFQVESNWRNGRCRIQLFKGHMDGVLSL---KFNHRLLFTGSYDSTVAIWDTKSGNL 344
           Y E    +  W       ++  GH   V  +     ++    TGS DST+ +WD  +G L
Sbjct: 89  YEEVVSQKPQWHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKL 148

Query: 345 IRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK 402
              L GH   V+ I    +   M +AS DK ++ W+    + +  + G    V SVD + 
Sbjct: 149 KVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHP 208

Query: 403 K--IIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
              +IVSA  D  V+VW + SR+C  TL GH   +N V+  P      S S D T+++WD
Sbjct: 209 SLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCSTDATVKLWD 268

Query: 460 IRTNSCIKVFRGHVGQVQKVI--PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           +     +K    H   V+ +   P           D +  K+ + +L  +F  +  GI +
Sbjct: 269 LVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTDDIRSWKLVDGQLLTNFNSEALGIVN 328

Query: 518 PNLKYPTHLLSCSLDNT---------IKLWEVSSGRCIR-----TQFGHVEGVWDIAADN 563
                    L+C+ D           +  ++  +G   +        G +E    + A  
Sbjct: 329 --------TLACNQDGVLFAGGDTGELSFFDYKTGHKFQKLETTAMPGSLESEKGVLAST 380

Query: 564 F-----RIVSGSHDKSIKVWDLQNGKCIQTFTG 591
           F     R+++   DKSIK+W   +G    +  G
Sbjct: 381 FDRTGLRLLTCERDKSIKIWKHIDGATQDSHPG 413

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 96/200 (48%), Gaps = 13/200 (6%)

Query: 417 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVFRGHVGQ 475
           WH   +    + GHT WV CV + P     +++ S+D T+R+WD+ T       +GH+  
Sbjct: 99  WHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMT 158

Query: 476 VQKVI-----PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLL-SC 529
           V+ +      P     +++ +V  K   +    +  DF    +G+   +L     L+ S 
Sbjct: 159 VRDICISARHPYMFSASQDKLV--KCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSA 216

Query: 530 SLDNTIKLWEVSSGRCIRTQFGH---VEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCI 586
             D+ +++W++ S  C+ T  GH   +  V  +  D  +IVS S D ++K+WDL  GK +
Sbjct: 217 GRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDP-QIVSCSTDATVKLWDLVAGKPM 275

Query: 587 QTFTGHKAPIVCVGIGDSSF 606
           +T T HK  +  +    + F
Sbjct: 276 KTLTHHKRNVRDLAFNPTEF 295

>Kwal_23.5035
          Length = 744

 Score =  100 bits (249), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 124/544 (22%), Positives = 202/544 (37%), Gaps = 146/544 (26%)

Query: 120 SNDKIRRLMLEGILQLCCFPQLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCI 179
           S+   R L+ + I +L    +LS +   VK  +K DFI++LP E+S+ IL  L  + +  
Sbjct: 227 SDSAYRNLVFQLISKLS-RSELSDLGTLVKDNLKRDFITSLPLEVSMNILTNLGFEDISR 285

Query: 180 ASLTCKRWKTLA-DDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQN 238
                K W +L  D   +W  +                    +    ++ V E H ++Q 
Sbjct: 286 CLSVSKAWNSLIRDTSYLWRTL--------------------LVTENFITVEEYHKYSQG 325

Query: 239 GNQFQNVANGNGNEIGGGKSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNW 298
             Q                  +N G+            +R Y + W   Y  +F+     
Sbjct: 326 PQQ------------------LNSGHLHEDFFRLHFMENRAYLKNW---YDSKFKPHRT- 363

Query: 299 RNGRCRIQLFKGH-MDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG 357
                     +GH M  V  L+F    + TG+ D  + ++D K+   I +L+GH  GV  
Sbjct: 364 --------TLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWA 415

Query: 358 I-YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD----SYKKIIVSASADK 412
           + Y  D  +++ S D+++RVWN  +G C   ++GH  +V  +D    + KK IV+ S D 
Sbjct: 416 LKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDH 475

Query: 413 TVKVWHVES--------RTCY-------------TLRGHTEWVNCVKLHPKSFTCYSSSD 451
           T+ VW + +          C               LRGH   V  V  H       S S 
Sbjct: 476 TLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVSGHGN--IVVSGSY 533

Query: 452 DKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADD 511
           D  L +WDI    C+ V  GH  ++      TI D +                       
Sbjct: 534 DFNLMVWDIAQMKCLYVLTGHTDRIYS----TIYDYQR---------------------- 567

Query: 512 CTGIFDPNLKYPTHLLSCSLDNTIKLWEVS---------------------SGRCIRTQF 550
                          +S  +D+T+K+W+++                     +G  I  Q 
Sbjct: 568 ------------NRCISAGMDSTVKVWDLADVSKNGPCTTITSSNNPCTKVTGSSITLQ- 614

Query: 551 GHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHK---APIVCVGIGDSSFV 607
           GH   V  +   +  +VS   D  ++ WD +N    + F  H    + I    + D+  V
Sbjct: 615 GHTALVGLLGLSDKFLVSAGADGILRGWDSEN--YTRQFAYHHKDLSAITTFYVNDNILV 672

Query: 608 SGDE 611
           SG E
Sbjct: 673 SGSE 676

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 134/341 (39%), Gaps = 54/341 (15%)

Query: 305 IQLFKGHMDGVLSLKFNHR-LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQ 363
           I    GH  GV +LK+ H  +L +GS D +V +W+ KSG       GHT  V+ +   + 
Sbjct: 403 ITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEH 462

Query: 364 K----MITASLDKTIRVW--------NYITGSC------------ISTYRGHQDSVLSVD 399
                ++T S D T+ VW        +Y    C            +   RGH  +V +V 
Sbjct: 463 NGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVS 522

Query: 400 SYKKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
            +  I+VS S D  + VW +    C Y L GHT+ +       +   C S+  D T+++W
Sbjct: 523 GHGNIVVSGSYDFNLMVWDIAQMKCLYVLTGHTDRIYSTIYDYQRNRCISAGMDSTVKVW 582

Query: 459 DI--------------RTNSCIKV------FRGHVGQVQKVIPLTIKDTENLVVDEKIEK 498
           D+                N C KV       +GH   V  ++ L+ K   +   D  +  
Sbjct: 583 DLADVSKNGPCTTITSSNNPCTKVTGSSITLQGHTALV-GLLGLSDKFLVSAGADGILRG 641

Query: 499 VPNPELEEDFA---DDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQ-FGHVE 554
             +      FA    D + I         ++L    +    ++ + SG+ I +      +
Sbjct: 642 WDSENYTRQFAYHHKDLSAI--TTFYVNDNILVSGSEGNFNIYNLRSGKLIHSYILSDAD 699

Query: 555 GVWDIAADNFRIVSG-SHDKSIKVWDLQNGKCIQTFTGHKA 594
            +W +  +N R+V+    D    V  L  GK  Q   G  A
Sbjct: 700 QIWSVKFNNRRLVAAVERDGHSYVEFLDFGKSEQVLEGESA 740

>Scas_721.115*
          Length = 318

 Score = 96.7 bits (239), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 95/189 (50%), Gaps = 17/189 (8%)

Query: 308 FKGHMDGVLSLKFNH---RLLFTGSYDSTVAIW-----DTKSGNLIRRLTGHTDGVKGIY 359
            +GH   V SL  +     LL +GS D T+  W     D K G  +R   GH+  V+   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 360 F--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVK 415
              D    ++AS DKT+R+W+  TG     + GH+  V+SV  D    +I+S S DKT+K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPK-----SFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
           VW ++ +   TL GH +WV+ V++ P      S T  S+ +DK ++ W++        F 
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 471 GHVGQVQKV 479
           GH G V  V
Sbjct: 193 GHNGNVNTV 201

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 79/168 (47%), Gaps = 13/168 (7%)

Query: 305 IQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           ++ FKGH   V   +L  +     + S+D T+ +WD  +G   +R  GH   V  +  D 
Sbjct: 58  VRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDR 117

Query: 363 QK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSV-------DSYKKIIVSASADKT 413
           +   +I+ S DKTI+VW  I G C++T  GH D V  V       +     ++SA  DK 
Sbjct: 118 KASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKM 176

Query: 414 VKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           VK W++ + +      GH   VN V   P      S+  D  + +W++
Sbjct: 177 VKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNL 224

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 72/175 (41%), Gaps = 47/175 (26%)

Query: 426 TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMW-----DIRTNSCIKVFRGHVGQVQKV 479
           TL GH  WV  +     +     S S DKTL  W     D +    ++ F+GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ-- 69

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                                          DCT   D       + LS S D T++LW+
Sbjct: 70  -------------------------------DCTLTQDG-----AYALSASWDKTLRLWD 93

Query: 540 VSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           V++G   +   GH   V  +A D     I+SGS DK+IKVW ++ G+C+ T  GH
Sbjct: 94  VATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 88/229 (38%), Gaps = 55/229 (24%)

Query: 387 TYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESR------TCYTLRGHTEWVNCV 437
           T  GH   V S+ +      +++S S DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE 497
            L        S+S DKTLR+WD+ T    + F GH   V  V            +D K  
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV-----------AIDRK-- 118

Query: 498 KVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW 557
                                     + ++S S D TIK+W +  G+C+ T  GH + V 
Sbjct: 119 -------------------------ASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVS 152

Query: 558 DIAA-------DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            +         D+  ++S  +DK +K W+L   +    F GH   +  V
Sbjct: 153 QVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTV 201

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 77/176 (43%), Gaps = 26/176 (14%)

Query: 306 QLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--- 360
           Q F GH   V+S+  + +  ++ +GS D T+ +W  K G  +  L GH D V  +     
Sbjct: 101 QRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPT 159

Query: 361 ----DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK--KIIVSASADKTV 414
               D   +I+A  DK ++ WN       + + GH  +V +V +     +I SA  D  +
Sbjct: 160 DQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEI 219

Query: 415 KVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF 469
            +W++ E +  YTL    E V  +   P  +   ++            T S IK+F
Sbjct: 220 MLWNLAEKKAMYTLSAQDE-VFALAFSPNRYWLAAA------------TASGIKIF 262

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 7/86 (8%)

Query: 523 PTHLLSCSLDNTIKLWEVSS-----GRCIRTQFGHVEGVWD--IAADNFRIVSGSHDKSI 575
           P  LLS S D T+  W+++      G  +R+  GH   V D  +  D    +S S DK++
Sbjct: 30  PNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTL 89

Query: 576 KVWDLQNGKCIQTFTGHKAPIVCVGI 601
           ++WD+  G+  Q F GHK+ ++ V I
Sbjct: 90  RLWDVATGETYQRFVGHKSDVMSVAI 115

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 132/274 (48%), Gaps = 17/274 (6%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           +    + ST+ +WD + G L+ R   H   V+G+ F   +   ++A  D +I+VW+  T 
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTH 85

Query: 383 SCISTYRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKL 439
            C+ T  GH D V +V  + ++  I+SAS D+T+++W+ ++ R    L GH  +V C + 
Sbjct: 86  KCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQF 145

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKV 499
           HP      S+S D+T+R+WDI   S ++  + H     +     +   +NL      + V
Sbjct: 146 HPTEDLVVSASLDETVRIWDI---SGLR--KRHSAPGSQSFEEQMITQQNLFDGGFGDCV 200

Query: 500 PNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC--IRTQFGHVEGVW 557
               LE          F P L     ++S S D  +KLW +SS +   + T  GH   V 
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPL---IVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVD 257

Query: 558 DIAADNFR--IVSGSHDKSIKVWDLQNGKCIQTF 589
            +    F+  I+S   D +I+VWDL     ++ F
Sbjct: 258 SVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQF 291

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/355 (21%), Positives = 140/355 (39%), Gaps = 81/355 (22%)

Query: 268 QTVAARARNSRYY-TRPWKVIYRERFQVES-NWRNGRCRIQLFKGHMDGVLSLKFN--HR 323
           ++ + RA+   ++ +RPW ++      ++  ++R G   +  F+ H   V  + F+    
Sbjct: 8   ESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMG-VLLHRFEEHEGPVRGVDFHPTQP 66

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYIT 381
           L  +   D ++ +W   +   +  L GH D V+ ++F  +   +I+AS D+TIR+WN+  
Sbjct: 67  LFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQN 126

Query: 382 GSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVWHVESR----------------- 422
              I+   GH   V+    +  + ++VSAS D+TV++W +                    
Sbjct: 127 RREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMI 186

Query: 423 --------------TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC--I 466
                           + L GHT  VN    HP      S SDD+ +++W + +     +
Sbjct: 187 TQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEV 246

Query: 467 KVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHL 526
              RGH   V  V                                   IF P   +   +
Sbjct: 247 DTCRGHTNNVDSV-----------------------------------IFHP---FQNLI 268

Query: 527 LSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-DNFRIVSGSHDKSIKVWDL 580
           +S   D+TI++W++     ++      +  W I A  N  +   +HD  I V+ L
Sbjct: 269 ISVGEDSTIRVWDLDKRTPVKQFKREQDRFWSIRAHPNVNLFGAAHDSGIMVFKL 323

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 65/176 (36%), Gaps = 60/176 (34%)

Query: 436 CVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK 495
            +  HP       +    T+++WD R    +  F  H G V+ V                
Sbjct: 16  AIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGV---------------- 59

Query: 496 IEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSL--DNTIKLWEVSSGRC-------- 545
                      DF             +PT  L  S   D +IK+W +S+ +C        
Sbjct: 60  -----------DF-------------HPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHL 95

Query: 546 --IRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
             +RT F H E  W        I+S S D++I++W+ QN + I   TGH   ++C 
Sbjct: 96  DYVRTVFFHTELPW--------IISASDDQTIRIWNWQNRREIACLTGHNHFVMCA 143

>Scas_721.32
          Length = 822

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 128/306 (41%), Gaps = 72/306 (23%)

Query: 308 FKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIR------------------- 346
           F     G+ SL+F+   RL+  G  DS + +W     +L +                   
Sbjct: 483 FHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTS 542

Query: 347 -RLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSY 401
             L GH+  V    F  D++ +++ S DKT+R+W+  T + + +Y+GH   V  V     
Sbjct: 543 TTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPL 602

Query: 402 KKIIVSASADKTVKVWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
                +AS D+T ++W  +    Y LR   GH   V+CV  HP     ++ S DKT RMW
Sbjct: 603 GHYFATASHDQTARLWSCDH--IYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW 660

Query: 459 DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDP 518
           DI T   +++F GH   V                                   CT +  P
Sbjct: 661 DISTGDSVRLFLGHTAPVL----------------------------------CTAV-SP 685

Query: 519 NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV---WDIAADNFRIVSGSHDKSI 575
           + ++   L + S D  I LW++ + + ++   GH +          +   +VSG  D S+
Sbjct: 686 DGRW---LATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSV 742

Query: 576 KVWDLQ 581
           +VWDL+
Sbjct: 743 RVWDLK 748

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 305 IQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV--KGIYF 360
           +++F GH+  V  +S   N   +FTGS D T  +WD  +G+ +R   GHT  V    +  
Sbjct: 626 LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSP 685

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVW 417
           D + + T S D  I +W+  T   +   RGH  + +   SY K   ++VS  AD +V+VW
Sbjct: 686 DGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVW 745

Query: 418 HVESRTC 424
            ++  T 
Sbjct: 746 DLKKSTA 752

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 86/218 (39%), Gaps = 45/218 (20%)

Query: 390 GHQDSVL---SVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFT 445
           G QDS +   S+D S  K I   SAD ++    +   T  TL GH+  V      P +  
Sbjct: 505 GFQDSYIKLWSLDGSSLKQIQEKSAD-SINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRY 563

Query: 446 CYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELE 505
             S S+DKT+R+W   T + +  ++GH   V  V                          
Sbjct: 564 LLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQ------------------------- 598

Query: 506 EDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADN 563
                     F P   Y     + S D T +LW       +R   GH+  V       + 
Sbjct: 599 ----------FSPLGHY---FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNG 645

Query: 564 FRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
             + +GS DK+ ++WD+  G  ++ F GH AP++C  +
Sbjct: 646 CYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAV 683

>Scas_592.4*
          Length = 318

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 95/189 (50%), Gaps = 17/189 (8%)

Query: 308 FKGHMDGVLSLKFNH---RLLFTGSYDSTVAIW-----DTKSGNLIRRLTGHTDGVKGIY 359
            +GH   V SL  +     LL +GS D T+  W     D K G  +R   GH+  V+   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 360 F--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVK 415
              D    ++AS DKT+R+W+  TG     + GH+  V+SV  D    +I+S S DKT+K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPK-----SFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
           VW ++ +   TL GH +WV+ V++ P      + T  S+ +DK ++ W++        F 
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 471 GHVGQVQKV 479
           GH G V  V
Sbjct: 193 GHNGNVNAV 201

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 79/168 (47%), Gaps = 13/168 (7%)

Query: 305 IQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           ++ FKGH   V   +L  +     + S+D T+ +WD  +G   +R  GH   V  +  D 
Sbjct: 58  VRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDR 117

Query: 363 QK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSV-------DSYKKIIVSASADKT 413
           +   +I+ S DKTI+VW  I G C++T  GH D V  V       +     ++SA  DK 
Sbjct: 118 KASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKM 176

Query: 414 VKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           VK W++ + +      GH   VN V   P      S+  D  + +W++
Sbjct: 177 VKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNL 224

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 72/175 (41%), Gaps = 47/175 (26%)

Query: 426 TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMW-----DIRTNSCIKVFRGHVGQVQKV 479
           TL GH  WV  +     +     S S DKTL  W     D +    ++ F+GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQ-- 69

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                                          DCT   D       + LS S D T++LW+
Sbjct: 70  -------------------------------DCTLTQDG-----AYALSASWDKTLRLWD 93

Query: 540 VSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           V++G   +   GH   V  +A D     I+SGS DK+IKVW ++ G+C+ T  GH
Sbjct: 94  VATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 87/229 (37%), Gaps = 55/229 (24%)

Query: 387 TYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESR------TCYTLRGHTEWVNCV 437
           T  GH   V S+ +      +++S S DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE 497
            L        S+S DKTLR+WD+ T    + F GH   V  V            +D K  
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV-----------AIDRK-- 118

Query: 498 KVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW 557
                                     + ++S S D TIK+W +  G+C+ T  GH + V 
Sbjct: 119 -------------------------ASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVS 152

Query: 558 DIAA-------DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            +         D   ++S  +DK +K W+L   +    F GH   +  V
Sbjct: 153 QVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAV 201

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 77/176 (43%), Gaps = 26/176 (14%)

Query: 306 QLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--- 360
           Q F GH   V+S+  + +  ++ +GS D T+ +W  K G  +  L GH D V  +     
Sbjct: 101 QRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPT 159

Query: 361 ----DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK--KIIVSASADKTV 414
               D   +I+A  DK ++ WN       + + GH  +V +V +     +I SA  D  +
Sbjct: 160 DQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEI 219

Query: 415 KVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF 469
            +W++ E +  YTL    E V  +   P  +   ++            T S IK+F
Sbjct: 220 MLWNLAEKKAMYTLSAQDE-VFSLAFSPNRYWLAAA------------TASGIKIF 262

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 7/86 (8%)

Query: 523 PTHLLSCSLDNTIKLWEVSS-----GRCIRTQFGHVEGVWD--IAADNFRIVSGSHDKSI 575
           P  LLS S D T+  W+++      G  +R+  GH   V D  +  D    +S S DK++
Sbjct: 30  PNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTL 89

Query: 576 KVWDLQNGKCIQTFTGHKAPIVCVGI 601
           ++WD+  G+  Q F GHK+ ++ V I
Sbjct: 90  RLWDVATGETYQRFVGHKSDVMSVAI 115

>Scas_695.15
          Length = 327

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 144/316 (45%), Gaps = 49/316 (15%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDG-VKGIYF-DDQKMITASLDKTIRVWNYIT 381
           +L +  YD T+  W+  +G +  R   H+D  V  +   +D+K++ A+  + +R+++  T
Sbjct: 24  ILVSAGYDHTIRFWEALTG-VCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDIRT 82

Query: 382 GS--CISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCV 437
            +   ++T+ GH+ +V SV   +  K +V++S D T+KVW V S +      H   VN V
Sbjct: 83  TNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 142

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP---------LTIKDTE 488
            +HP      S   D T+++WD+  N C            ++IP         L++    
Sbjct: 143 VIHPNQGELISCDRDGTIKIWDLGENQC----------THQLIPDDDNTSLQSLSVASDG 192

Query: 489 NLVV------DEKIEKVPNPELEEDFADDCTGIFDPNLKYPT---------HLLSCSLDN 533
           +++V      D  + ++PN     +        F  +  Y T         H+ +CS D 
Sbjct: 193 SMLVAANNKGDCYVWEMPNHTDASNLKP--INKFSAHKDYITRVVLSSDVKHMATCSADR 250

Query: 534 TIKLWEVSSGR----CIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQ 587
           T K+W V           T  GH   VWD A  AD+  +V+ S D  +++WDL   + ++
Sbjct: 251 TAKIWSVGETEDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVR 310

Query: 588 TFTGHKAPIVCVGIGD 603
            + GH    VCV + D
Sbjct: 311 QYGGHHKGAVCVALND 326

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 90/228 (39%), Gaps = 60/228 (26%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           +  F+GH   V S+ F  +++ + T S D T+ +WD +S ++ R    +    + +   +
Sbjct: 88  VATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEVVIHPN 147

Query: 363 Q-KMITASLDKTIRVWNYITGSC------------------------------------- 384
           Q ++I+   D TI++W+     C                                     
Sbjct: 148 QGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYVW 207

Query: 385 -------------ISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHV-ESRTCY--- 425
                        I+ +  H+D +  V   S  K + + SAD+T K+W V E+   +   
Sbjct: 208 EMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLE 267

Query: 426 -TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
            TL GH  WV        S    ++S D  +R+WD+ T   ++ + GH
Sbjct: 268 TTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 315

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 42/102 (41%), Gaps = 8/102 (7%)

Query: 305 IQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSG----NLIRRLTGHTDGVKGI 358
           I  F  H D +  + L  + + + T S D T  IW         NL   L GH   V   
Sbjct: 221 INKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNLETTLDGHQRWVWDC 280

Query: 359 YF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV 398
            F  D   ++TAS D  +R+W+  T   +  Y GH    + V
Sbjct: 281 AFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCV 322

>Kwal_56.24526
          Length = 1210

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 130/274 (47%), Gaps = 17/274 (6%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           +    + S++ +WD + G L+ +   H   V+GI F   +   ++A  D TI+VW+  T 
Sbjct: 26  VLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTK 85

Query: 383 SCISTYRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKL 439
            C+ T  GH D V +V  ++++  I+SAS D+T+++W+ ++R     L GH  +V C   
Sbjct: 86  KCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADF 145

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKV 499
           HP      S+S D+T+R+WDI       + + H       +   I   +NL+     + V
Sbjct: 146 HPTEDLVVSASLDETVRVWDIS-----GLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCV 200

Query: 500 PNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC--IRTQFGHVEGVW 557
               LE          F P L     ++S   D  +KLW +SS +   + T  GH   V 
Sbjct: 201 VKFILEGHSRGVNWASFHPTLPL---IVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVD 257

Query: 558 DIAADNFR--IVSGSHDKSIKVWDLQNGKCIQTF 589
            +     +  I+S   DK+++VWDL     ++ F
Sbjct: 258 SVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQF 291

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 113/254 (44%), Gaps = 42/254 (16%)

Query: 268 QTVAARARNSRYY-TRPWKVIYRERFQVES-NWRNGRCRIQLFKGHMDGVLSLKFN--HR 323
           ++ + RA+   ++ +RPW ++      ++  ++R G   +  F+ H   V  + F+    
Sbjct: 8   ESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGTL-LHKFEDHEGPVRGIDFHPTQP 66

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYIT 381
           L  +   D T+ +W   +   +  L GH D V+ ++F  +   +I+AS D+TIR+WN+  
Sbjct: 67  LFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQN 126

Query: 382 GSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVWHV-------ESRTCYT------ 426
              I+   GH   V+  D +  + ++VSAS D+TV+VW +        + + YT      
Sbjct: 127 RKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIA 186

Query: 427 ------------------LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC--I 466
                             L GH+  VN    HP      S  DD+ +++W + +     +
Sbjct: 187 AQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEV 246

Query: 467 KVFRGHVGQVQKVI 480
              RGH   V  VI
Sbjct: 247 DTCRGHTNNVDSVI 260

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 121/261 (46%), Gaps = 23/261 (8%)

Query: 344 LIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY 401
           ++ +    +   KG+ F   +  ++ A    +I++W+Y  G+ +  +  H+  V  +D +
Sbjct: 3   MLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGIDFH 62

Query: 402 --KKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
             + + VSA  D T+KVW ++++ C +TL GH ++V  V  H +     S+SDD+T+R+W
Sbjct: 63  PTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIW 122

Query: 459 DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDP 518
           + +    I    GH      V+      TE+LVV   +++            D +G+   
Sbjct: 123 NWQNRKEIACLTGH---NHFVMCADFHPTEDLVVSASLDETVR-------VWDISGLRKR 172

Query: 519 NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF---GHVEGV-WDIAADNFR-IVSGSHDK 573
           +    T+ L   +     L +   G C+  +F   GH  GV W         IVSG  D+
Sbjct: 173 HSAPSTYTLEDQIAAQQNLLDGGFGDCV-VKFILEGHSRGVNWASFHPTLPLIVSGGDDR 231

Query: 574 SIKVWDLQNGKC--IQTFTGH 592
            +K+W + + K   + T  GH
Sbjct: 232 QVKLWRMSSTKAWEVDTCRGH 252

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 96/209 (45%), Gaps = 42/209 (20%)

Query: 302 RCRIQLFKGHMDGVLSLKFNHRL--LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           +C   L  GH+D V ++ F+  L  + + S D T+ IW+ ++   I  LTGH   V    
Sbjct: 86  KCLFTL-NGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAD 144

Query: 360 F--DDQKMITASLDKTIRVWNYITG-----SCISTY------------------------ 388
           F   +  +++ASLD+T+RVW+ I+G     S  STY                        
Sbjct: 145 FHPTEDLVVSASLDETVRVWD-ISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKF 203

Query: 389 --RGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY---TLRGHTEWVNCVKLHP 441
              GH   V   S      +IVS   D+ VK+W + S   +   T RGHT  V+ V  HP
Sbjct: 204 ILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHP 263

Query: 442 KSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
                 S  +DKT+R+WD+   + +K F+
Sbjct: 264 HQNLIISVGEDKTVRVWDLDKRTPVKQFK 292

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 20/90 (22%)

Query: 522 YPTHLLSCSL--DNTIKLWEVSSGRC----------IRTQFGHVEGVWDIAADNFRIVSG 569
           +PT  L  S   D TIK+W + + +C          +RT F H E  W        I+S 
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPW--------IISA 113

Query: 570 SHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           S D++I++W+ QN K I   TGH   ++C 
Sbjct: 114 SDDQTIRIWNWQNRKEIACLTGHNHFVMCA 143

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 62/136 (45%), Gaps = 9/136 (6%)

Query: 301 GRCRIQ-LFKGHMDGVLSLKFNHRL--LFTGSYDSTVAIWDTKSGNL--IRRLTGHTDGV 355
           G C ++ + +GH  GV    F+  L  + +G  D  V +W   S     +    GHT+ V
Sbjct: 197 GDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNV 256

Query: 356 KGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI-IVSASADK 412
             + F   +  +I+   DKT+RVW+    + +  ++   D    V ++  I +  A+ D 
Sbjct: 257 DSVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDS 316

Query: 413 TVKVWHVE-SRTCYTL 427
            + V+ ++  R C  +
Sbjct: 317 GIMVFKLDRERPCSVI 332

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 99.0 bits (245), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 119/261 (45%), Gaps = 56/261 (21%)

Query: 348 LTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKK 403
           L GH+  V    F  D++ +++AS DKT+R+W+  T S + +Y+GH   V  +S      
Sbjct: 472 LIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGH 531

Query: 404 IIVSASADKTVKVWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
              +AS D+T ++W  +    Y LR   GH   V+CV  HP     ++ S DKT RMWDI
Sbjct: 532 YFATASHDQTARLWSCDH--IYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDI 589

Query: 461 RTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL 520
            T   +++F GH   V                                    +    P+ 
Sbjct: 590 GTGDSVRLFLGHTAPV-----------------------------------ISTAVSPDG 614

Query: 521 KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVE-GVWDI--AADNFRIVSGSHDKSIKV 577
           ++   L + S D  I +W++ +G+ ++   GH +  V+ +  + +   +VSG  D S++V
Sbjct: 615 RW---LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRV 671

Query: 578 WDLQ------NGKCIQTFTGH 592
           WDL+      N +  Q FT +
Sbjct: 672 WDLKRSTAEPNTEPEQPFTSY 692

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 106/254 (41%), Gaps = 59/254 (23%)

Query: 359 YFDDQKMITASL-DKTIRVWNYITGSCI--------------STYRGHQDSVLSVD--SY 401
           + DD  +  A   D  I++W+ + G+ +              +T  GH  +V S      
Sbjct: 429 FSDDATLAAAGFQDSYIKLWS-LDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPD 487

Query: 402 KKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
            K ++SAS DKTV++W +++  +  + +GH   V  V   P      ++S D+T R+W  
Sbjct: 488 NKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSC 547

Query: 461 RTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL 520
                +++F GH+  V                                  DC   F PN 
Sbjct: 548 DHIYPLRIFAGHLNDV----------------------------------DCVS-FHPN- 571

Query: 521 KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWD--IAADNFRIVSGSHDKSIKVW 578
              T++ + S D T ++W++ +G  +R   GH   V    ++ D   + +GS D  I VW
Sbjct: 572 --GTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVW 629

Query: 579 DLQNGKCIQTFTGH 592
           D+  GK ++   GH
Sbjct: 630 DIGTGKRLKQMRGH 643

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 67/127 (52%), Gaps = 7/127 (5%)

Query: 305 IQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV--KGIYF 360
           +++F GH++ V  +S   N   +FTGS D T  +WD  +G+ +R   GHT  V    +  
Sbjct: 553 LRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSP 612

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVW 417
           D + + T S D  I VW+  TG  +   RGH  + +   SY K   ++VS  AD +V+VW
Sbjct: 613 DGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVW 672

Query: 418 HVESRTC 424
            ++  T 
Sbjct: 673 DLKRSTA 679

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 69/178 (38%), Gaps = 40/178 (22%)

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIK 485
           TL GH+  V      P +    S+S+DKT+R+W + T S +  ++GH   V  V      
Sbjct: 471 TLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVS----- 525

Query: 486 DTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC 545
                                         F P   Y     + S D T +LW       
Sbjct: 526 ------------------------------FSPLGHY---FATASHDQTARLWSCDHIYP 552

Query: 546 IRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           +R   GH+  V       +   + +GS DK+ ++WD+  G  ++ F GH AP++   +
Sbjct: 553 LRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAV 610

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 70/162 (43%), Gaps = 17/162 (10%)

Query: 442 KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPN 501
           +  TC   SDD TL     + +S IK++      +   +P            ++ EK+ N
Sbjct: 422 RDMTCLEFSDDATLAAAGFQ-DSYIKLWSLDGTPLDSKLP-----------SKQREKINN 469

Query: 502 PELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA 561
             L        +  F P+ KY   LLS S D T++LW + +   + +  GH   VWD++ 
Sbjct: 470 TTLIGHSGTVYSTSFSPDNKY---LLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSF 526

Query: 562 DNF--RIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
                   + SHD++ ++W   +   ++ F GH   + CV  
Sbjct: 527 SPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSF 568

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 133/274 (48%), Gaps = 17/274 (6%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           +    + ST+ +WD + G L+ R   H   V+GI F   +   ++A  D TI+VW+  + 
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESN 85

Query: 383 SCISTYRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKL 439
            C+ T  GH D V +V  + ++  I+S+S D+T+++W+ ++R     L GH  +V C + 
Sbjct: 86  KCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQF 145

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKV 499
           HP      S+S D+T+R+WDI   S ++  + H     +     ++  +NL+     + V
Sbjct: 146 HPVEDLVVSASLDETVRVWDI---SGLR--KRHSAPGTQSFEEQMRQQQNLLDGGFGDCV 200

Query: 500 PNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC--IRTQFGHVEGVW 557
               LE          F P L     ++S S D  +KLW +S+ +   + T  GH   V 
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPL---IVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVD 257

Query: 558 DIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589
            +        I+S   DK+++VWDL     I+ F
Sbjct: 258 SVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQF 291

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 118/265 (44%), Gaps = 31/265 (11%)

Query: 344 LIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY 401
           ++ +    +   KGI F   +  ++ A    TI++W+Y  G  +  +  H+  V  +D +
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDFH 62

Query: 402 --KKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
             + + VSA  D T+KVW +ES  C +TL GH ++V  V  H +     SSSDD+T+R+W
Sbjct: 63  PTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIW 122

Query: 459 DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV----DEKIEKVPNPELEEDFADDCTG 514
           + +    I    GH      V+       E+LVV    DE +       L +  +   T 
Sbjct: 123 NWQNRKEIACLTGH---NHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQ 179

Query: 515 IFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF---GHVEGV-WDIAADNFR-IVSG 569
            F+  ++   +LL               G C+  +F   GH  GV W         IVSG
Sbjct: 180 SFEEQMRQQQNLLDGGF-----------GDCV-VKFILEGHTRGVNWASFHPTLPLIVSG 227

Query: 570 SHDKSIKVWDLQNGKC--IQTFTGH 592
           S D+ +K+W +   K   + T  GH
Sbjct: 228 SDDRQVKLWRMSATKAWEVDTCRGH 252

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/355 (21%), Positives = 139/355 (39%), Gaps = 81/355 (22%)

Query: 268 QTVAARARNSRYY-TRPWKVIYRERFQVES-NWRNGRCRIQLFKGHMDGVLSLKFN--HR 323
           ++ + RA+   ++ +RPW ++      ++  ++R G   +  F+ H   V  + F+    
Sbjct: 8   ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMG-VLLHRFEDHEGPVRGIDFHPTQP 66

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYIT 381
           L  +   D T+ +W  +S   +  L GH D V+ ++F  +   +I++S D+TIR+WN+  
Sbjct: 67  LFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQN 126

Query: 382 GSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVWHVESR----------------- 422
              I+   GH   V+    +  + ++VSAS D+TV+VW +                    
Sbjct: 127 RKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMR 186

Query: 423 --------------TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC--I 466
                           + L GHT  VN    HP      S SDD+ +++W +       +
Sbjct: 187 QQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEV 246

Query: 467 KVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHL 526
              RGH   V  VI       +NL++                                  
Sbjct: 247 DTCRGHTNNVDSVI---FHPQQNLII---------------------------------- 269

Query: 527 LSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-DNFRIVSGSHDKSIKVWDL 580
            S   D T+++W++     I+      +  W + A  N  +   +HD  I ++ L
Sbjct: 270 -SVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLFGAAHDSGIMIFKL 323

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 66/167 (39%), Gaps = 44/167 (26%)

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKI 496
           +  HP       +    T+++WD R    +  F  H G V+ +                 
Sbjct: 17  IAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGI----------------- 59

Query: 497 EKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSL--DNTIKLWEVSSGRCIRTQFGHVE 554
                     DF             +PT  L  S   D TIK+W + S +C+ T  GH++
Sbjct: 60  ----------DF-------------HPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLD 96

Query: 555 GVWDIAADNFR--IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            V  +   +    I+S S D++I++W+ QN K I   TGH   ++C 
Sbjct: 97  YVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCA 143

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 61/128 (47%), Gaps = 8/128 (6%)

Query: 301 GRCRIQ-LFKGHMDGVLSLKFNHRL--LFTGSYDSTVAIWDTKSGNL--IRRLTGHTDGV 355
           G C ++ + +GH  GV    F+  L  + +GS D  V +W   +     +    GHT+ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNV 256

Query: 356 KGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI-IVSASADK 412
             + F  Q+  +I+   DKT+RVW+    + I  ++   D    V ++  + +  A+ D 
Sbjct: 257 DSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLFGAAHDS 316

Query: 413 TVKVWHVE 420
            + ++ ++
Sbjct: 317 GIMIFKLD 324

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 94.4 bits (233), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 134/302 (44%), Gaps = 25/302 (8%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITG 382
           +L +  YD T+  W+  +G   R +      V  +    D+K + A+    +R+++  + 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDIRSN 63

Query: 383 SC--ISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438
           +   +S++ GH+ +V S+      + +VS+S D T+KVW V S +      H   VN V 
Sbjct: 64  NPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEVA 123

Query: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK--- 495
           +HP      S   D  +R+WD+  N C            + + +   D   LV       
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVA-SDGSMLVAGNNKGN 182

Query: 496 --IEKVPNPELEEDFADDCTGIFDPNLKYPT---------HLLSCSLDNTIKLWEVSSGR 544
             + K+P+   +    +  T  F  + KY T         HL +CS D+T ++W +    
Sbjct: 183 CYVWKMPH-HTDASTLEPVTK-FKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNF 240

Query: 545 CIRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
            + T   GH   VWD A  AD+  +V+   D  +++WDL   + ++ + GH    VCV +
Sbjct: 241 ELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCVAL 300

Query: 602 GD 603
            D
Sbjct: 301 ND 302

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 108/267 (40%), Gaps = 54/267 (20%)

Query: 305 IQLFKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK--GIYF 360
           +  F+GH   V S+ F   +R + + S D T+ +WD +S + ++R   H   V    I+ 
Sbjct: 68  VSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPS-VQRNYKHNAPVNEVAIHP 126

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDS---VLSVDSYKKIIVSASADKTVKVW 417
           +  ++I+   D  IR+W+     C +      ++    LSV S   ++V+ +      VW
Sbjct: 127 NQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 418 ----HVESRT---CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK-VF 469
               H ++ T       + HT+++  V L        + S D T R+W+I  N  ++   
Sbjct: 187 KMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTL 246

Query: 470 RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSC 529
            GH                                 + +  DC   F  +  Y   L++ 
Sbjct: 247 DGH---------------------------------QRWVWDCA--FSADSAY---LVTA 268

Query: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGV 556
             D+ ++LW++S+   +R   GH +G 
Sbjct: 269 CSDHYVRLWDLSTSEIVRQYGGHHKGA 295

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 41/96 (42%), Gaps = 5/96 (5%)

Query: 308 FKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSG-NLIRRLTGHTDGVKGIYF--DD 362
           FK H   +  + L  + + L T S D T  +W+ +    L   L GH   V    F  D 
Sbjct: 203 FKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDCAFSADS 262

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV 398
             ++TA  D  +R+W+  T   +  Y GH    + V
Sbjct: 263 AYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCV 298

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 96.3 bits (238), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 133/313 (42%), Gaps = 25/313 (7%)

Query: 287 IYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKFN---HRLLFTGSYDSTVAIWDTKSGN 343
           +  +R +  + W+  R    +  GH+  V  +  +   +    TGS D+T+ +WD  +G 
Sbjct: 118 LLSQRPEWHAPWKLSR----VINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGK 173

Query: 344 LIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVD 399
           L   L GH   V+ +   D+   + + S DKT++ W+      I  Y GH   V  +S+ 
Sbjct: 174 LKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIH 233

Query: 400 SYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
               +I +A  D  +K+W + +R    TL GH   +N V+  P      SSS D T+R+W
Sbjct: 234 PTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLW 293

Query: 459 DIRTNSCIKVFRGHVGQVQKVI--PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIF 516
           D+     +KV   H   V+     P           D +   +    L  +F  + TGI 
Sbjct: 294 DVVAGKTMKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGII 353

Query: 517 DPNLKYPTHLLSCSLDN-TIKLWEVSSGR-----CIRTQFGHVEGVWDIAADNF-----R 565
           +        +L    DN  +  ++  SG        R   G +EG   +    F     R
Sbjct: 354 NTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLR 413

Query: 566 IVSGSHDKSIKVW 578
           +++G  DKSIK+W
Sbjct: 414 LITGEADKSIKIW 426

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 90/199 (45%), Gaps = 11/199 (5%)

Query: 417 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCY-SSSDDKTLRMWDIRTNSCIKVFRGHVGQ 475
           WH   +    + GH  WV CV + P     + + S+D T+++WD+ T        GHV  
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMT 184

Query: 476 VQKVI-----PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCS 530
           V+ V      P     +E+  V  K   +   ++  D+    +G+   ++     L++ +
Sbjct: 185 VRDVAVSDRHPYLFSVSEDKTV--KCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATA 242

Query: 531 -LDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQ 587
             D+ IKLW++ +   + T  GH   +  +     + ++VS S D ++++WD+  GK ++
Sbjct: 243 GRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMK 302

Query: 588 TFTGHKAPIVCVGIGDSSF 606
             T HK  +    +    F
Sbjct: 303 VLTHHKRSVRATALHPKEF 321

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 97.4 bits (241), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 126/303 (41%), Gaps = 70/303 (23%)

Query: 315 VLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIR------------------RLTGHTDG 354
           + SL+F+   RL   G  DS + IW     +LI                    L GH+  
Sbjct: 476 MTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGT 535

Query: 355 VKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASA 410
           V    F  D+  +++ S DKT+++W+  T + +  Y+GH   V  V          SAS 
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASH 595

Query: 411 DKTVKVWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK 467
           D+T ++W  +    Y LR   GHT  V+ V  HP     ++ S DKT RMWD+ T   ++
Sbjct: 596 DQTARLWACDH--IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR 653

Query: 468 VFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLL 527
           +F GH   V                                    +    P+ ++   L 
Sbjct: 654 LFLGHTAPV-----------------------------------LSTQVSPDGRW---LA 675

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR---IVSGSHDKSIKVWDLQNGK 584
           + S D  I LW++ +G+ I+   GH +      + N     ++SG  D S++VWD+++G 
Sbjct: 676 TGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGT 735

Query: 585 CIQ 587
             Q
Sbjct: 736 TEQ 738

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 87/193 (45%), Gaps = 14/193 (7%)

Query: 308 FKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK- 364
           +KGH   V  +KF+       + S+D T  +W       +R   GHT+ V  + F     
Sbjct: 571 YKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGC 630

Query: 365 -MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSYKKIIVSASADKTVKVWHVES 421
            + T S DKT R+W+  TG  +  + GH   VLS  V    + + + S D  + +W + +
Sbjct: 631 YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGT 690

Query: 422 -RTCYTLRGHTE-WVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC------IKVFRGHV 473
            +    +RGH +  V+ +  + +     S   D ++R+WD++  +        + F  HV
Sbjct: 691 GKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHV 750

Query: 474 GQVQKVIPLTIKD 486
           G +   I   IKD
Sbjct: 751 GDITASINQDIKD 763

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 72/181 (39%), Gaps = 40/181 (22%)

Query: 423 TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL 482
           TC TL GH+  V      P +    S S+DKT+++W + T++ +  ++GH   V  V   
Sbjct: 525 TCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVK-- 582

Query: 483 TIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSS 542
                                            F P   Y     S S D T +LW    
Sbjct: 583 ---------------------------------FSPLGHY---FASASHDQTARLWACDH 606

Query: 543 GRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG 600
              +R   GH   V  ++   +   + +GS DK+ ++WD+  G  ++ F GH AP++   
Sbjct: 607 IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQ 666

Query: 601 I 601
           +
Sbjct: 667 V 667

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 44/111 (39%), Gaps = 33/111 (29%)

Query: 507 DFADDCTGIFDPNLKYPTHLLSCSL-DNTIKLWEVSSGRCIRTQF--------------- 550
           +F+DDC             L +    D+ IK+W +     I  ++               
Sbjct: 480 EFSDDC------------RLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCS 527

Query: 551 ---GHVEGVWD--IAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
              GH   V+    + DN  +VSGS DK++K+W +     +  + GH  P+
Sbjct: 528 TLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPV 578

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 129/275 (46%), Gaps = 29/275 (10%)

Query: 330 YDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCIST 387
           + ST+ +WD + G L+ R  GH   V+ + F   +   ++A  D +I+VW+  T  C+ T
Sbjct: 31  FSSTIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYT 90

Query: 388 YRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSF 444
             GH D V +V  + ++  ++SAS D+TV++W+ ++R     L GH  +V C + H    
Sbjct: 91  LTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTED 150

Query: 445 TCYSSSDDKTLRMWDI------RTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEK 498
              S+S D+T+R+WDI       +   +  +   +   Q ++     D +   + E   +
Sbjct: 151 LVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTR 210

Query: 499 VPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC--IRTQFGHVEGV 556
             N              F P L     +++   D  +KLW +SS +   + T  GH   V
Sbjct: 211 GVN-----------WASFHPTLPL---IVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNV 256

Query: 557 WDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589
             +    D   I+S + DK++++WDL     ++ F
Sbjct: 257 DCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQF 291

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 124/268 (46%), Gaps = 23/268 (8%)

Query: 344 LIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY 401
           L+ +    +   KGI F   +   + A    TI++W+Y  G+ +  + GH+  V +VD +
Sbjct: 3   LLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEGPVRAVDFH 62

Query: 402 --KKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
             + I VSA  D ++KVW +E+  C YTL GH ++V  V  H +     S+SDD+T+R+W
Sbjct: 63  PTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIW 122

Query: 459 DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDP 518
           + +    +    GH      V+      TE+LVV   +++            D +G+   
Sbjct: 123 NWQNRKELACLTGH---NHFVMCAQFHQTEDLVVSASLDETVR-------VWDISGLRKK 172

Query: 519 NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF---GHVEGV-WDIAADNFR-IVSGSHDK 573
           +          SL +   L + + G C + +F   GH  GV W         IV+G  D+
Sbjct: 173 HSAPGVTSYEDSLASQQNLLDGAFGDC-KVKFILEGHTRGVNWASFHPTLPLIVTGGDDR 231

Query: 574 SIKVWDLQNGKC--IQTFTGHKAPIVCV 599
            +K+W + + K   + T  GH   + CV
Sbjct: 232 QVKLWRMSSNKAWEVDTCRGHTNNVDCV 259

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 98/209 (46%), Gaps = 42/209 (20%)

Query: 302 RCRIQLFKGHMDGVLSLKFNHRL--LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           RC   L  GH+D V ++ F+  L  + + S D TV IW+ ++   +  LTGH   V    
Sbjct: 86  RCLYTL-TGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQ 144

Query: 360 FDDQK--MITASLDKTIRVWNYITG-------SCISTY---------------------- 388
           F   +  +++ASLD+T+RVW+ I+G         +++Y                      
Sbjct: 145 FHQTEDLVVSASLDETVRVWD-ISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKF 203

Query: 389 --RGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY---TLRGHTEWVNCVKLHP 441
              GH   V   S      +IV+   D+ VK+W + S   +   T RGHT  V+CV  HP
Sbjct: 204 ILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHP 263

Query: 442 KSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
                 S ++DKTLR+WD+   + +K F+
Sbjct: 264 DQNLILSVAEDKTLRIWDLDKRTPVKQFK 292

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 69/152 (45%), Gaps = 11/152 (7%)

Query: 280 YTRPWKVIYRERFQVESNWRNGR---CRIQ-LFKGHMDGVLSLKFNHRL--LFTGSYDST 333
           ++ P    Y +    + N  +G    C+++ + +GH  GV    F+  L  + TG  D  
Sbjct: 173 HSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQ 232

Query: 334 VAIWDTKSGNL--IRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYR 389
           V +W   S     +    GHT+ V  + F  D   +++ + DKT+R+W+    + +  ++
Sbjct: 233 VKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQFK 292

Query: 390 GHQDSVLSVDSYKKI-IVSASADKTVKVWHVE 420
              D    + S+  + +  A+ D  + ++ ++
Sbjct: 293 RENDRFWLIRSHPNMSLFGAAHDSGIMIFKLD 324

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 137/312 (43%), Gaps = 46/312 (14%)

Query: 307 LFKGHMDGVLSLKFNH---RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK--GIYFD 361
           +   H D +  L F+     L   G  D TV IWD    N I  L GH   +    I  D
Sbjct: 393 IMSTHDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRD 452

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVES 421
              ++T   D  +++WN                     +  + +   + + T    H++S
Sbjct: 453 YGTLVTGGRDAALKLWNL--------------------NLAQQLYQETQNLTSPTNHIDS 492

Query: 422 RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP 481
              +T   HT+ V  + L P SF   S S D+T+R WD+R+  C++        V     
Sbjct: 493 PCVHTFEAHTDEVTALSLDP-SF-LVSGSQDRTIRQWDLRSGKCLQTIDLSFANVL-TTS 549

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVS 541
             +  +++ ++ ++ E+     L+          FD  L   T       D  ++LW++ 
Sbjct: 550 TNVDLSKSTLLTQRNERPSIGALQS---------FDAALATGTK------DGVVRLWDLR 594

Query: 542 SGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           SG+ IRT  GH + +  +  D+  +V+GS+D+++++WDL+ G  +  F  + AP++ + +
Sbjct: 595 SGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-LLNKFHAYSAPVLSLDL 653

Query: 602 --GDSSFVSGDE 611
              +++ V  DE
Sbjct: 654 FQENAAVVVADE 665

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 59/97 (60%), Gaps = 2/97 (2%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L TG+ D  V +WD +SG +IR L GHTD +  + FD   ++T S D+T+R+W+  TG  
Sbjct: 579 LATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-L 637

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADK-TVKVWHVE 420
           ++ +  +   VLS+D +++      AD+ +V+++  E
Sbjct: 638 LNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSE 674

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 99/206 (48%), Gaps = 21/206 (10%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK 364
           +  F+ H D V +L  +   L +GS D T+  WD +SG  ++ +         + F +  
Sbjct: 495 VHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTI--------DLSFANVL 546

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVES-RT 423
             + ++D        ++ S + T R  + S+ ++ S+   + + + D  V++W + S + 
Sbjct: 547 TTSTNVD--------LSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKV 598

Query: 424 CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLT 483
             TL+GHT+ +  +K    S    + S D+T+R+WD+RT   +  F  +   V   + L 
Sbjct: 599 IRTLKGHTDAITSLKFD--SACLVTGSYDRTVRIWDLRT-GLLNKFHAYSAPVLS-LDLF 654

Query: 484 IKDTENLVVDEKIEKVPNPELEEDFA 509
            ++   +V DE   ++ + E +E ++
Sbjct: 655 QENAAVVVADEPSVQIYDSEKDESWS 680

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 110/257 (42%), Gaps = 54/257 (21%)

Query: 382 GSCISTYRGHQDSVLSVD---SYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCV 437
           GS +ST   H D +  +D    +  +  +   D TVK+W +  +     L GH   +NC+
Sbjct: 391 GSIMST---HDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCM 447

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE 497
           +++    T  +   D  L++W++  N   +++               ++T+NL       
Sbjct: 448 QINRDYGTLVTGGRDAALKLWNL--NLAQQLY---------------QETQNLTSPTNHI 490

Query: 498 KVPNPELEEDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT---QFGHV 553
             P     E   D+ T +  DP+      L+S S D TI+ W++ SG+C++T    F +V
Sbjct: 491 DSPCVHTFEAHTDEVTALSLDPSF-----LVSGSQDRTIRQWDLRSGKCLQTIDLSFANV 545

Query: 554 ---------------------EGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
                                  +  + + +  + +G+ D  +++WDL++GK I+T  GH
Sbjct: 546 LTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGH 605

Query: 593 KAPIVCVGIGDSSFVSG 609
              I  +    +  V+G
Sbjct: 606 TDAITSLKFDSACLVTG 622

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 68/127 (53%), Gaps = 8/127 (6%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           + R+G+  I+  KGH D + SLKF+   L TGSYD TV IWD ++G L+ +   ++  V 
Sbjct: 592 DLRSGKV-IRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-LLNKFHAYSAPVL 649

Query: 357 GI-YFDDQKMITASLDKTIRVWNYITG---SCISTYRGHQDSVLSVDSYKKIIVSASADK 412
            +  F +   +  + + ++++++       SC+   +G++ SV +V   +  +V    + 
Sbjct: 650 SLDLFQENAAVVVADEPSVQIYDSEKDESWSCVE--QGNETSVSTVKYKENYMVEGRENG 707

Query: 413 TVKVWHV 419
            V +W V
Sbjct: 708 DVNIWAV 714

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 92.4 bits (228), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 136/301 (45%), Gaps = 23/301 (7%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITG 382
           +L +  YD T+  W+  +G   R +      V  +   +D+K++  +  + +R+++  T 
Sbjct: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63

Query: 383 SC--ISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438
           +   ++++ GH+ +V SV   +  + +V++S D T+KVW V S +      H   VN V 
Sbjct: 64  NPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVV 123

Query: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK--- 495
           +HP      S   D  +R+WD+  N C            + + +    +     + K   
Sbjct: 124 IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNC 183

Query: 496 -IEKVPNPELEEDFADDCTGIFDPNLKYPT---------HLLSCSLDNTIKLWEVSSGRC 545
            + ++PN   +       T  F  +  Y T         HL +CS D+T ++W +     
Sbjct: 184 YVWEMPN-HTDASHLKPVTK-FRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFK 241

Query: 546 IRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIG 602
           + T   GH   VWD A  AD+  +V+ S D  +++WDL   + ++ + GH    VCV + 
Sbjct: 242 LETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

Query: 603 D 603
           D
Sbjct: 302 D 302

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 86/224 (38%), Gaps = 56/224 (25%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           +  F+GH   V S+ F  ++R + T S D T+ +WD +S ++ R    +    + +   +
Sbjct: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPN 127

Query: 363 Q-KMITASLDKTIRVWNYITGSC------------------------------------- 384
           Q ++I+   D  IR+W+     C                                     
Sbjct: 128 QGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWE 187

Query: 385 ------------ISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVES--RTCYTLR 428
                       ++ +R H   +  +   S  K + + SAD T +VW ++   +   TL 
Sbjct: 188 MPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLD 247

Query: 429 GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
           GH  WV        S    ++S D  +R+WD+ T   ++ + GH
Sbjct: 248 GHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 119/503 (23%), Positives = 203/503 (40%), Gaps = 104/503 (20%)

Query: 140 QLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKRWKTLADDDRVWYH 199
           QLS +   +   +K D   +LP E+++KIL  L  + +    L  + W  L ++  V + 
Sbjct: 135 QLSDLVSIITDNLKRDLFQSLPNEITVKILLNLSSEDIFACLLVNRNWNRLIEEAPVVW- 193

Query: 200 MCEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGNEIGGGKSL 259
                                    ++L +NE  V     +QF +  N   ++    K L
Sbjct: 194 -------------------------KWLMLNEGFV---TEDQFPSYCNSLPSKY---KHL 222

Query: 260 INPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLS-L 318
           INP    +         + +  + W          + N++ GR       GH   V++ L
Sbjct: 223 INP----DDRFRLDFLENNWCLQNW---------YDPNYKPGRT---CLDGHSTNVVTCL 266

Query: 319 KFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK-MITASLDKTIRVW 377
           +F +  + TG+ D  + ++D ++   +  L GH  GV  + F D K +++ S D+++R+W
Sbjct: 267 QFENNYIITGADDKKINVYDAENDLFLLELNGHEGGVWALKFVDGKILVSGSTDRSVRIW 326

Query: 378 NYITGSCISTYRGHQDSV--LSVDSY--KKIIVSASADKTVKVWHVES------------ 421
           N  TG C   ++GH  +V  L V  Y   K IV+ S D T+ VW +              
Sbjct: 327 NIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKELDKGSQEPI 386

Query: 422 --RT-------CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
             RT          LRGH   V  V  H +     S S D  L +WDI +   + +  GH
Sbjct: 387 FYRTPEENPYFVGVLRGHMSSVRTVSGHGR--IVISGSYDHNLMVWDIISMKLLYILTGH 444

Query: 473 VGQVQKVIPLTIKDTE-NLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSL 531
             +V      TI D + N  +   ++        E+  ++ T              + ++
Sbjct: 445 TDRVYS----TIYDYKRNRCISASMDTTVMIWDLENIENNGT--------------TTTI 486

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTG 591
           ++   +  V S +C+   +GH   V  +   N  +VS + D SI+ WD  +    + F+ 
Sbjct: 487 NDGASIKVVGSMKCL---YGHTALVGLLCLSNKFLVSAAADGSIRGWDPNDYS--RKFSF 541

Query: 592 HK---APIVCVGIGDSSFVSGDE 611
           H    A I    + D+  VSG E
Sbjct: 542 HHTNLAAITSFSMNDNILVSGSE 564

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 123/286 (43%), Gaps = 67/286 (23%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLI-----------------RRLTGHTDGVKGIYF--DDQ 363
           R+   G  DS + IW     +L                  + L GH+  V    F  D++
Sbjct: 479 RIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNK 538

Query: 364 KMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVES 421
            +++ S DKT+R+W+  T + + +Y+GH   V  +S         +AS D+T ++W  + 
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH 598

Query: 422 RTCYTLR---GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
              Y LR   GH   V+CV  HP     ++ S DKT RMWD+ T   +++F GH      
Sbjct: 599 --IYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA---P 653

Query: 479 VIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLW 538
           VI + +                           C     P+ ++   L + S D  I +W
Sbjct: 654 VISIAV---------------------------C-----PDGRW---LSTGSEDGIINVW 678

Query: 539 EVSSGRCIRTQFGHVEGV---WDIAADNFRIVSGSHDKSIKVWDLQ 581
           ++ +G+ ++   GH +        + +   ++SG  D +++VWDL+
Sbjct: 679 DIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 89/211 (42%), Gaps = 43/211 (20%)

Query: 387 TYRGHQDSVLSVD--SYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKS 443
           T  GH  +V S       K ++S S DKTV++W +++ T   + +GH   V  V   P  
Sbjct: 520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLG 579

Query: 444 FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPE 503
               ++S D+T R+W       +++F GH+  V                           
Sbjct: 580 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDV--------------------------- 612

Query: 504 LEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-- 561
                  DC   F PN  Y   + + S D T ++W+VS+G  +R   GH   V  IA   
Sbjct: 613 -------DCVS-FHPNGCY---VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCP 661

Query: 562 DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           D   + +GS D  I VWD+  GK ++   GH
Sbjct: 662 DGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 692

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 67/127 (52%), Gaps = 7/127 (5%)

Query: 305 IQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           +++F GH++ V  +S   N   +FTGS D T  +WD  +G+ +R   GHT  V  I    
Sbjct: 602 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCP 661

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVW 417
           D + + T S D  I VW+  TG  +   RGH  + +   SY K   +++S  AD TV+VW
Sbjct: 662 DGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVW 721

Query: 418 HVESRTC 424
            ++  T 
Sbjct: 722 DLKKATT 728

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 82/219 (37%), Gaps = 58/219 (26%)

Query: 403 KIIVSASADKTVKVWHV------------------ESRTCYTLRGHTEWVNCVKLHPKSF 444
           +I  +   D  +K+W +                  E  TC TL GH+  V      P + 
Sbjct: 479 RIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNK 538

Query: 445 TCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPEL 504
              S S+DKT+R+W + T++ +  ++GH   V  V                         
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVS------------------------ 574

Query: 505 EEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAAD 562
                      F P   Y     + S D T +LW       +R   GH+  V       +
Sbjct: 575 -----------FSPLGHY---FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPN 620

Query: 563 NFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
              + +GS DK+ ++WD+  G  ++ F GH AP++ + +
Sbjct: 621 GCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAV 659

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 77/170 (45%), Gaps = 7/170 (4%)

Query: 310 GHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QKM 365
           GH   V S  F  +++ L +GS D TV +W   +   +    GH   V  + F       
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYF 582

Query: 366 ITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVESRT 423
            TAS D+T R+W+      +  + GH + V  V  +     + + S+DKT ++W V +  
Sbjct: 583 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD 642

Query: 424 CYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
              L  GHT  V  + + P      + S+D  + +WDI T   +K  RGH
Sbjct: 643 SVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 692

>Kwal_27.12053
          Length = 755

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 133/315 (42%), Gaps = 71/315 (22%)

Query: 315 VLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRL-------------TGHTDGVKGIY 359
           + SL+F+   RL   G  DS + IW      L  +L              GH+  V    
Sbjct: 430 MTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTS 489

Query: 360 F--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVK 415
           F  D++ +++AS DKT+R+W+  T + +  Y+GH   +  ++         +AS D+T +
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTAR 549

Query: 416 VWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
           +W  +    Y LR   GH   V+ V  HP     ++ S DKT RMWDI +   +++F GH
Sbjct: 550 LWSCDH--IYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGH 607

Query: 473 VGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLD 532
              V                                    +    P+ ++   L + S D
Sbjct: 608 TAPV-----------------------------------TSTAVSPDGRW---LSTGSED 629

Query: 533 NTIKLWEVSSGRCIRTQFGHVE-GVWDI--AADNFRIVSGSHDKSIKVWDLQNGKC---- 585
             I +W++ +G+ ++   GH +  V+ +  + +   ++SG  D S++VWD++        
Sbjct: 630 GVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAEPGS 689

Query: 586 --IQTFTGHKAPIVC 598
              Q FTG+   +  
Sbjct: 690 EPEQPFTGYSGDVTS 704

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 68/127 (53%), Gaps = 7/127 (5%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK--GIYF 360
           +++F GH++ V ++ F  N   +FTGS D T  +WD  SG+ +R   GHT  V    +  
Sbjct: 559 LRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSP 618

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVW 417
           D + + T S D  I VW+  TG  +   RGH  + +   SY K   +++S  AD +V+VW
Sbjct: 619 DGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVW 678

Query: 418 HVESRTC 424
            V+  T 
Sbjct: 679 DVKKSTA 685

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 79/178 (44%), Gaps = 7/178 (3%)

Query: 302 RCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           R   +   GH   V S  F  ++R L + S D TV +W T +   +    GH   +  + 
Sbjct: 472 RTNNETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVA 531

Query: 360 FDD--QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVK 415
           F        TAS D+T R+W+      +  + GH + V +V  +     + + S+DKT +
Sbjct: 532 FSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCR 591

Query: 416 VWHVESRTCYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
           +W + S     L  GHT  V    + P      + S+D  + +WDI T   +K  RGH
Sbjct: 592 MWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGH 649

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/236 (20%), Positives = 90/236 (38%), Gaps = 56/236 (23%)

Query: 384 CISTYRGHQDSVLSVDSYKKIIVSASA--DKTVKVWHV--------------ESRTCYTL 427
           C+ T+      + S++    + ++A+   D  +K+W +              E     TL
Sbjct: 419 CMYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETL 478

Query: 428 RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDT 487
            GH+  V      P +    S+S+DKT+R+W   T + +  ++GH   +  V        
Sbjct: 479 VGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVA------- 531

Query: 488 ENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIR 547
                                       F P   Y     + S D T +LW       +R
Sbjct: 532 ----------------------------FSPLGHY---FATASHDQTARLWSCDHIYPLR 560

Query: 548 TQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
              GH+  V  ++   +   + +GS DK+ ++WD+ +G  ++ F GH AP+    +
Sbjct: 561 IFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAV 616

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 91.7 bits (226), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 133/302 (44%), Gaps = 25/302 (8%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITG 382
           +L +  YD T+  W+  +G   R +      V  +    D++ + A+    +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDIRTT 63

Query: 383 SC--ISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438
           +   ++++ GH+ +V S+   +  K +VS+S D T+KVW V + +      H   VN V 
Sbjct: 64  NPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVV 123

Query: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK--- 495
           +HP      S   D  +R+WD+  N C            + + +   D   LV       
Sbjct: 124 IHPNQGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIA-SDGSMLVAGNNKGN 182

Query: 496 --IEKVPNPELEEDFADDCTGIFDPNLKYPT---------HLLSCSLDNTIKLWEVSSGR 544
             + ++PN     +        F  + KY T         HL +CS D+T ++W +    
Sbjct: 183 CYVWQMPNHTDAANLKP--VTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNF 240

Query: 545 CIRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
            + T   GH   VWD A  AD+  +V+   D  +++WDL   + ++ + GH    VCV +
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 602 GD 603
            D
Sbjct: 301 ND 302

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 85/224 (37%), Gaps = 56/224 (25%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           +  F+GH   V S+ F  +++ + + S D T+ +WD ++ ++ R    H    + +   +
Sbjct: 68  VTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPN 127

Query: 363 Q-KMITASLDKTIRVWNYITGSC------------------------------------- 384
           Q ++I+   D  IR+W+     C                                     
Sbjct: 128 QGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQ 187

Query: 385 ------------ISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVES--RTCYTLR 428
                       ++ +R H   +  V   S  K + + SAD T +VW +E   +   TL 
Sbjct: 188 MPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLD 247

Query: 429 GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
           GH  WV        S    ++  D  +R+WD+ T   ++ + GH
Sbjct: 248 GHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 94/183 (51%), Gaps = 18/183 (9%)

Query: 308 FKGHMDGVLSLKFNH---RLLFTGSYDSTVAIW-----DTKSGNLIRRLTGHTDGVK--G 357
            +GH   V SL  +     LL + S D T+  W     D K G  +R   GH+  V+   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 358 IYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVK 415
           +  D    ++AS DKT+R+W+  TG     + GH+  V+SVD  KK  +I+S S DKT+K
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIK 132

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPK------SFTCYSSSDDKTLRMWDIRTNSCIKVF 469
           VW ++ +   TL GH +WV+ V++ P       S T  S+ +DK ++ W++        F
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 470 RGH 472
            GH
Sbjct: 193 IGH 195

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 90/227 (39%), Gaps = 56/227 (24%)

Query: 387 TYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESR------TCYTLRGHTEWVNCV 437
           T  GH   V S+ +      +++SAS DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE 497
            L        S+S DKTLR+WD+ T    + F GH   V  V            +D+K  
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD-----------IDKK-- 118

Query: 498 KVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW 557
                                     + ++S S D TIK+W +  G+C+ T  GH + V 
Sbjct: 119 -------------------------ASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVS 152

Query: 558 DIAA--------DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
            +          D+  I+S  +DK +K W+L   +    F GH + I
Sbjct: 153 QVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNI 199

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 68/152 (44%), Gaps = 15/152 (9%)

Query: 306 QLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--- 360
           Q F GH   V+S+  + +  ++ +GS D T+ +W  K G  +  L GH D V  +     
Sbjct: 101 QRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPN 159

Query: 361 -----DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKT 413
                D   +I+A  DK ++ WN       + + GH  ++  L+      +I SA  D  
Sbjct: 160 EKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGE 219

Query: 414 VKVWHVES-RTCYTLRGHTEWVNCVKLHPKSF 444
           + +W++ + +  YTL    E V  +   P  +
Sbjct: 220 IMLWNLAAKKAMYTLSAQDE-VFSLAFSPNRY 250

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 7/86 (8%)

Query: 523 PTHLLSCSLDNTIKLWEVSS-----GRCIRTQFGHVEGVWD--IAADNFRIVSGSHDKSI 575
           P  LLS S D T+  W+++      G  +R+  GH   V D  + AD    +S S DK++
Sbjct: 30  PNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTL 89

Query: 576 KVWDLQNGKCIQTFTGHKAPIVCVGI 601
           ++WD+  G+  Q F GHK+ ++ V I
Sbjct: 90  RLWDVATGETYQRFVGHKSDVMSVDI 115

>Scas_707.22
          Length = 730

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 126/564 (22%), Positives = 213/564 (37%), Gaps = 154/564 (27%)

Query: 99  KALDKESDRAIIKQTLDNFQHSNDKIR-RLMLEGILQLCCFPQLSYIADEVKQLIKIDFI 157
           K  +  +D  ++   L N Q     I+ + ++  IL       LS +   +   +K D +
Sbjct: 200 KTTNLSTDELVMNNLLTNLQTQLTPIQYKNLIFKILSNLNRTALSDLNSVLNGNLKRDIV 259

Query: 158 STLPEELSLKILGYLDCQSLCIASLTCKRWKTLADDDRVWYHMCEQHIDRKCPNCGWGLP 217
           S+LP E++LKI  +L    +      C  W  + +                        P
Sbjct: 260 SSLPIEIALKIFQHLSYDDIFNCQSVCSNWNAIINTT----------------------P 297

Query: 218 LLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGNEIGGGKSLINPGNSPNQTVAARARNS 277
           LL     + L ++E+ V        Q VAN N                           S
Sbjct: 298 LLW----KNLLISESFV------SAQEVANNNNK-------------------------S 322

Query: 278 RYYTRPWKVIYRERFQVESNWRNGRCRIQ--LFKGHMDGVLS-LKFNHRLLFTGSYDSTV 334
            ++    K  + E  ++  NW N   + +     GH   V++ L+F    + TG+ D  +
Sbjct: 323 SFF----KEKFIESLRILQNWYNPSFKPERTTLTGHATSVVTCLQFEDDYVITGADDRQL 378

Query: 335 AIWDTKSGNLIRRLTGHTDGVKGIYFD-DQKMITASLDKTIRVWNYITGSCISTYRGHQD 393
            I+D +S   ++ L+GH  GV  + +D D  +++ S D+++R+W+   G C   ++GH  
Sbjct: 379 RIYDARSKKFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHTS 438

Query: 394 SV--LSVDSYK--KIIVSASADKTVKVWHV--------ESRTCY-----------TLRGH 430
           +V  L + +YK  K IV+ S D T+ VW +        E    Y            LRGH
Sbjct: 439 TVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGH 498

Query: 431 TEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENL 490
              V  +  H       S S D  L +WDI    C+ V  GH  ++   I          
Sbjct: 499 MASVRTISGHGN--IVISGSYDNNLMVWDIAQMKCLYVLIGHTDRIYSTI---------- 546

Query: 491 VVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV----SSGRC- 545
             D K ++                            +S S+D+TIK+W++    ++G C 
Sbjct: 547 -YDHKRQRC---------------------------ISASMDSTIKVWDLDNIWNNGNCT 578

Query: 546 ---------------IRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
                          + T  GH   V  +   +  +VS + D S++ WD  +    + F+
Sbjct: 579 IITNSATPCTKITGSMLTLQGHTALVGLLRLSDKYLVSAAADGSLRGWDSNDYS--RKFS 636

Query: 591 GHK---APIVCVGIGDSSFVSGDE 611
            H    + I    + D+  VSG E
Sbjct: 637 YHHNNLSAITTFYMNDNILVSGSE 660

>Kwal_0.212
          Length = 303

 Score = 90.9 bits (224), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 136/307 (44%), Gaps = 35/307 (11%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD-DQKMITASLDKTIRVWNYITG 382
           +L +  YD T+  W+  +G   R +      V  +    D++ + A+    +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63

Query: 383 SC--ISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438
           +   ++++ GH+ +V S+      K +VS+S D T+KVW V + +      H   VN V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVV 123

Query: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL----TIKDTENLVVDE 494
           +HP      S   D  +R+WD+  N C+     H    +   PL       D   LV   
Sbjct: 124 IHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAGN 178

Query: 495 K-----IEKVPNPELEEDFAD-DCTGIFDPNLKYPT---------HLLSCSLDNTIKLWE 539
                 + ++P+   + D A+      F  + KY T         HL +CS D+T ++W 
Sbjct: 179 NKGNCYVWQMPH---QTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWS 235

Query: 540 VSSGRCIRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
           +     + T    H   VWD A  AD+  +V+   D  +++WDL   + ++ + GH    
Sbjct: 236 IDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGA 295

Query: 597 VCVGIGD 603
           +CV + D
Sbjct: 296 ICVALND 302

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/263 (20%), Positives = 103/263 (39%), Gaps = 52/263 (19%)

Query: 308 FKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG--IYFDDQ 363
           F+GH   V S+ F   ++ + + S D T+ +WD ++ + ++R   H   V    I+ +  
Sbjct: 71  FEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPS-VQRNYKHQAAVNEVVIHPNQG 129

Query: 364 KMITASLDKTIRVWNYITGSCISTYRGHQDS---VLSVDSYKKIIVSASADKTVKVWHVE 420
           ++I+   D  +R+W+     C+       D+    LSV S   ++V+ +      VW + 
Sbjct: 130 ELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMP 189

Query: 421 SRT-------CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHV 473
            +T           R H +++  V L        + S D T R+W I             
Sbjct: 190 HQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSI------------- 236

Query: 474 GQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDN 533
                              D+  +     +  + +  DC   F  +  Y   L++   D+
Sbjct: 237 -------------------DDNFQLETTLDNHQRWVWDCA--FSADSAY---LVTACSDH 272

Query: 534 TIKLWEVSSGRCIRTQFGHVEGV 556
            ++LW++S+   +R   GH +G 
Sbjct: 273 YVRLWDLSTREIVRQYGGHHKGA 295

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 77/184 (41%), Gaps = 17/184 (9%)

Query: 443 SFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP------LTIKDTENLVVDEKI 496
           S    S+  D T+R W+  T  C +  +    QV ++        L      N+ + +  
Sbjct: 2   SVILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIR 61

Query: 497 EKVPNPELE-EDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVE 554
              PNP    E    + T I F    K+   ++S S D TIK+W+V +   ++  + H  
Sbjct: 62  TTNPNPVTSFEGHRGNVTSIAFQQENKW---MVSSSEDGTIKVWDVRAPS-VQRNYKHQA 117

Query: 555 GVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH-KAPIVCVGIGD--SSFVSG 609
            V ++    +   ++S   D ++++WDL   +C+         P+  + +    S  V+G
Sbjct: 118 AVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177

Query: 610 DELG 613
           +  G
Sbjct: 178 NNKG 181

>Scas_624.11
          Length = 1205

 Score = 94.0 bits (232), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 130/275 (47%), Gaps = 19/275 (6%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASL--DKTIRVWNYITG 382
           +    + ST+ +WD + G L+ R   H   V+ + F   + I  S   D TI+VW+  T 
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETN 85

Query: 383 SCISTYRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKL 439
            C+ T  GH D + +V  +K++  I+SAS D+T+++W+ ++R     L GH  +V C + 
Sbjct: 86  KCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQF 145

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKV 499
           HP      S+S D+T+R+WDI       + + H           +   +NL+     + V
Sbjct: 146 HPTDDLVVSASLDETIRVWDIS-----GLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCV 200

Query: 500 PNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC--IRTQFGH---VE 554
               LE          F P L     ++S S D  +KLW+ +S +   + T  GH   V+
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPM---IVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVD 257

Query: 555 GVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589
            V       F I+S   DK++++WDL     ++ F
Sbjct: 258 CVIFHPTQKF-ILSVGEDKTLRIWDLDKRIPVKQF 291

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/272 (28%), Positives = 122/272 (44%), Gaps = 31/272 (11%)

Query: 344 LIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY 401
           ++ +    +   KGI F   +  ++ A    TI++W+Y  G+ +  +  H+  V SVD +
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFH 62

Query: 402 --KKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
             + I VS   D T+KVW +E+  C YTL GH +++  V  H +     S+SDD+T+R+W
Sbjct: 63  PTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIW 122

Query: 459 DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV----DEKIEKVPNPELEEDFADDCTG 514
           + +    I    GH      V+      T++LVV    DE I       L +  +   T 
Sbjct: 123 NWQNRKEIACLTGH---NHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTS 179

Query: 515 IFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF---GHVEGV-WDIAADNF-RIVSG 569
            FD  +    +LL               G C+  +F   GH  GV W         IVSG
Sbjct: 180 TFDDQMAAQQNLLDGGF-----------GDCV-VKFILEGHTRGVNWASFHPTLPMIVSG 227

Query: 570 SHDKSIKVWDLQNGKC--IQTFTGHKAPIVCV 599
           S D+ +K+W   + K   + T  GH   + CV
Sbjct: 228 SDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCV 259

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/355 (22%), Positives = 143/355 (40%), Gaps = 81/355 (22%)

Query: 268 QTVAARARNSRYY-TRPWKVIYRERFQVES-NWRNGRCRIQLFKGHMDGVLSLKFN--HR 323
           ++ + RA+   ++ +RPW ++      ++  ++R G   +  F+ H   V S+ F+    
Sbjct: 8   ESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTL-LHRFEDHEGPVRSVDFHPTQP 66

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYIT 381
           +  +G  D T+ +W  ++   +  L GH D ++ ++F  +   +I+AS D+TIR+WN+  
Sbjct: 67  IFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQN 126

Query: 382 GSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVESR----------------- 422
              I+   GH   V+    +    ++VSAS D+T++VW +                    
Sbjct: 127 RKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMA 186

Query: 423 --------------TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC--I 466
                           + L GHT  VN    HP      S SDD+ +++W   +     +
Sbjct: 187 AQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEV 246

Query: 467 KVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHL 526
              RGH   V                                  DC  IF P  K+   +
Sbjct: 247 DTCRGHTNNV----------------------------------DCV-IFHPTQKF---I 268

Query: 527 LSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-DNFRIVSGSHDKSIKVWDL 580
           LS   D T+++W++     ++      +  W IA+  N  +   +HD  I V+ L
Sbjct: 269 LSVGEDKTLRIWDLDKRIPVKQFKRENDRFWLIASHPNINLFGAAHDAGIMVFKL 323

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/198 (33%), Positives = 99/198 (50%), Gaps = 24/198 (12%)

Query: 308 FKGHMDGVLSLKFNH---RLLFTGSYDSTVAIW-----DTKSGNLIRRLTGHTDGVKGIY 359
            +GH   V SL  +     LL +GS D T+  W     + + G  +R   GH+  V+ + 
Sbjct: 14  LEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVV 73

Query: 360 F--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVK 415
              D    ++AS DKT+R+WN  TG+  + + GH   VLSV  D+    I+SAS DKT++
Sbjct: 74  VSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIR 133

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPKSF----------TCYSSSDDKTLRMWDIRTNSC 465
           VW+      Y L GHT+WV  V++ PK+           T  S+  DK +R W +  +S 
Sbjct: 134 VWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSY 193

Query: 466 -IKV-FRGHVGQVQKVIP 481
            I+  F GH   +  V P
Sbjct: 194 RIEADFIGHNNYINVVQP 211

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 115/268 (42%), Gaps = 36/268 (13%)

Query: 305 IQLFKGH----MDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360
           ++ +KGH     D V+S   N+ +  + S+D T+ +W+  +GN   R  GHT  V  +  
Sbjct: 59  VRSYKGHSHIVQDVVVSADGNYAV--SASWDKTLRLWNLATGNSEARFVGHTGDVLSVAI 116

Query: 361 D--DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVL------------SVDSYKKIIV 406
           D    K+I+AS DKTIRVWN + G C     GH D V              VD  +   V
Sbjct: 117 DANSSKIISASRDKTIRVWNTV-GDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFV 175

Query: 407 SASADKTVKVWHVES---RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463
           SA  DK V+ W +     R      GH  ++N V+  P      S+  D  + +W+++  
Sbjct: 176 SAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHK 235

Query: 464 SCIKVFRGH-----VGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDP 518
           S    F        +        LT      + + +   +V   EL+ +FA   T   DP
Sbjct: 236 SAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFA-GYTKAQDP 294

Query: 519 ---NLKYPTH---LLSCSLDNTIKLWEV 540
              +L +      L +   DN I++W+V
Sbjct: 295 HAVSLAWSADGQTLFAGYTDNVIRVWQV 322

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 68/175 (38%), Gaps = 47/175 (26%)

Query: 426 TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNS-----CIKVFRGHVGQVQKV 479
           TL GH  WV  +     +     S S DKTL  W +  N       ++ ++GH   VQ V
Sbjct: 13  TLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDV 72

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
           +                                    D N     + +S S D T++LW 
Sbjct: 73  VVSA---------------------------------DGN-----YAVSASWDKTLRLWN 94

Query: 540 VSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           +++G       GH   V  +A  A++ +I+S S DK+I+VW+   G C     GH
Sbjct: 95  LATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTV-GDCAYVLLGH 148

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 523 PTHLLSCSLDNTIKLWEVSS-----GRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSI 575
           P  L+S S D T+  W ++      G  +R+  GH   V D+  +AD    VS S DK++
Sbjct: 31  PNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTL 90

Query: 576 KVWDLQNGKCIQTFTGHKAPIVCVGI 601
           ++W+L  G     F GH   ++ V I
Sbjct: 91  RLWNLATGNSEARFVGHTGDVLSVAI 116

>Kwal_26.7570
          Length = 218

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 88/168 (52%), Gaps = 18/168 (10%)

Query: 308 FKGHMDGVLSLKFNH---RLLFTGSYDSTVAIW-----DTKSGNLIRRLTGHTDGVK--G 357
            +GH   V SL  +     LL +GS D ++  W     D + G  +R   GH+  V+   
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT 72

Query: 358 IYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVK 415
           +  D +  ++AS DKT+R+W   TG CI  + GH+  VLSV  D     IVSAS DKTVK
Sbjct: 73  VTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVK 132

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHP------KSFTCYSSSDDKTLRM 457
           VW+       TL GH +WV+ V++ P      ++ T  S+  DK +++
Sbjct: 133 VWNTLGECMVTLLGHNDWVSQVRVAPNESPEDETVTVISAGMDKVVKV 180

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 76/175 (43%), Gaps = 47/175 (26%)

Query: 426 TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMW-----DIRTNSCIKVFRGHVGQVQKV 479
           TL GH  WV  +   P +     S S DK+L  W     D +    ++ FRGH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQ-- 69

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                                          DCT    P+ +Y    LS S D T++LWE
Sbjct: 70  -------------------------------DCT--VTPDGEYA---LSASWDKTVRLWE 93

Query: 540 VSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           +++G+CI+   GH   V  +  D    +IVS S DK++KVW+   G+C+ T  GH
Sbjct: 94  LATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTL-GECMVTLLGH 147

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%), Gaps = 7/86 (8%)

Query: 523 PTHLLSCSLDNTIKLWEVSS-----GRCIRTQFGHVEGVWD--IAADNFRIVSGSHDKSI 575
           P  LLS S D ++  W+++      G  +R+  GH   V D  +  D    +S S DK++
Sbjct: 30  PNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTV 89

Query: 576 KVWDLQNGKCIQTFTGHKAPIVCVGI 601
           ++W+L  GKCIQ F GHK+ ++ V I
Sbjct: 90  RLWELATGKCIQRFVGHKSDVLSVTI 115

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 80/208 (38%), Gaps = 56/208 (26%)

Query: 387 TYRGHQDSVLSV---DSYKKIIVSASADKTVKVWHVESR------TCYTLRGHTEWVNCV 437
           T  GH   V S+    +   +++S S DK++  W +            + RGH+  V   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE 497
            + P      S+S DKT+R+W++ T  CI+ F GH   V  V            +D +  
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSV-----------TIDRRAS 120

Query: 498 KVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW 557
           ++                           +S S D T+K+W  + G C+ T  GH + V 
Sbjct: 121 QI---------------------------VSASRDKTVKVWN-TLGECMVTLLGHNDWVS 152

Query: 558 DIAA--------DNFRIVSGSHDKSIKV 577
            +          +   ++S   DK +KV
Sbjct: 153 QVRVAPNESPEDETVTVISAGMDKVVKV 180

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 12/87 (13%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHRL--LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG 357
            G+C IQ F GH   VLS+  + R   + + S D TV +W+T  G  +  L GH D V  
Sbjct: 96  TGKC-IQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTL-GECMVTLLGHNDWVSQ 153

Query: 358 IYFDDQK--------MITASLDKTIRV 376
           +     +        +I+A +DK ++V
Sbjct: 154 VRVAPNESPEDETVTVISAGMDKVVKV 180

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 89.7 bits (221), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 131/302 (43%), Gaps = 25/302 (8%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITG 382
           +L +  YD T+  W+  +G   R +      V  +    D++ + A+    +R+++  T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDIRTT 63

Query: 383 SC--ISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438
           +   ++++ GH+ +V S+   +  K +VS+S D T+KVW V S +      H   VN V 
Sbjct: 64  NPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEVV 123

Query: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK--- 495
           +HP      S   D  +++WD+  N C            + + +   D   LV       
Sbjct: 124 IHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIA-SDGSMLVAGNNKGN 182

Query: 496 --IEKVPNPELEEDFADDCTGIFDPNLKYPT---------HLLSCSLDNTIKLWEVSSGR 544
             + K+PN              F  + KY T         HL +CS D+T ++W V    
Sbjct: 183 CYVWKMPNHTDTASLKP--VTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDNF 240

Query: 545 CIRTQF-GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
            + T    H   VWD A  AD+  +V+   D  +++WDL   + ++ + GH    VCV +
Sbjct: 241 QLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

Query: 602 GD 603
            D
Sbjct: 301 ND 302

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 88/227 (38%), Gaps = 62/227 (27%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG--IYF 360
           +  F+GH   V S+ F  +++ + + S D T+ +WD +S + ++R   H   V    I+ 
Sbjct: 68  VTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSPS-VQRNYKHDAPVNEVVIHP 126

Query: 361 DDQKMITASLDKTIRVWNYITGSC------------------------------------ 384
           +  ++I+   D  I++W+     C                                    
Sbjct: 127 NQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKGNCYVW 186

Query: 385 -------------ISTYRGHQDSV----LSVDSYKKIIVSASADKTVKVWHVES--RTCY 425
                        ++ +R H   +    LSVD   K + + SAD T +VW VE   +   
Sbjct: 187 KMPNHTDTASLKPVTKFRSHSKYITRVLLSVDV--KHLATCSADHTARVWSVEDNFQLET 244

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
           TL  H+ WV        S    ++  D  +R+WD+ T   ++ + GH
Sbjct: 245 TLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 5/87 (5%)

Query: 315 VLSLKFNHRLLFTGSYDSTVAIWDTKSG-NLIRRLTGHTDGVKGIYF--DDQKMITASLD 371
           +LS+   H  L T S D T  +W  +    L   L  H+  V    F  D   ++TA  D
Sbjct: 214 LLSVDVKH--LATCSADHTARVWSVEDNFQLETTLDAHSRWVWDCAFSADSAYLVTACSD 271

Query: 372 KTIRVWNYITGSCISTYRGHQDSVLSV 398
             +R+W+  T   +  Y GH    + V
Sbjct: 272 HYVRLWDLSTREIVRQYGGHHKGAVCV 298

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 93/382 (24%), Positives = 151/382 (39%), Gaps = 97/382 (25%)

Query: 285 KVIYRERFQVESNWRNGRCRIQ--LFKGHMDGVLS-LKFNHRLLFTGSYDSTVAIWDTKS 341
           ++ + E   +  NW N +   Q    +GHM  V++ L+F    + TG+ D  + ++D+ +
Sbjct: 352 RLSFLENIFILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSIN 411

Query: 342 GNLIRRLTGHTDGVKGI-YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSV 398
              + +L+GH  GV  + Y     +++ S D+T+RVW+   G C   ++GH  +V  L +
Sbjct: 412 KKFLLQLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDI 471

Query: 399 DSYKKI--IVSASADKTVKVW---------------------HVESRTCY---TLRGHTE 432
             YK I  IV+ S D T+ VW                     H      Y    LRGH  
Sbjct: 472 VEYKNIKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMA 531

Query: 433 WVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV 492
            V  V  H       S S D TL +WD+    C+ +  GH  ++      TI D E    
Sbjct: 532 SVRTVSGHGN--IVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYS----TIYDHER--- 582

Query: 493 DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV----SSGRC--- 545
                                             +S S+D TI++W++    ++G C   
Sbjct: 583 -------------------------------KRCISASMDTTIRIWDLENIWNNGECSYA 611

Query: 546 -------------IRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
                        + T  GH   V  +   +  +VS + D SI+ WD  +    + F+ H
Sbjct: 612 TNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWDANDYS--RKFSYH 669

Query: 593 K---APIVCVGIGDSSFVSGDE 611
               + I    + D+  VSG E
Sbjct: 670 HTNLSAITTFYVSDNILVSGSE 691

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 150/359 (41%), Gaps = 53/359 (14%)

Query: 140 QLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKRW-KTLADDDRVWY 198
           +LS +   +K  +K D I++LP E+SLKI  YL  + +  +    + W K +     +W 
Sbjct: 258 ELSDLGTLIKDNLKRDLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWK 317

Query: 199 HM--CEQHIDRKCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGNEIGGG 256
            +   E  +  K      G   L++K ++  P     +  Q+  +   + N     I   
Sbjct: 318 KLLISENFVSPK------GFNSLNLKLSQKYP----KLSQQDRLRLSFLEN-----IFIL 362

Query: 257 KSLINPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWR-----NGRCRIQLFKGH 311
           K+  NP   P +T       S      ++  Y      +   R     N +  +QL  GH
Sbjct: 363 KNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLLQL-SGH 421

Query: 312 MDGVLSLKFNH-RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI----YFDDQKMI 366
             GV +LK+ H  +L +GS D TV +WD K G       GH   V+ +    Y + + ++
Sbjct: 422 DGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYIV 481

Query: 367 TASLDKTIRVWNYITGSCISTY-----------------------RGHQDSVLSVDSYKK 403
           T S D T+ VW     S +  +                       RGH  SV +V  +  
Sbjct: 482 TGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTVSGHGN 541

Query: 404 IIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR 461
           I+VS S D T+ VW V    C Y L GHT+ +       +   C S+S D T+R+WD+ 
Sbjct: 542 IVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLE 600

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 127/569 (22%), Positives = 219/569 (38%), Gaps = 144/569 (25%)

Query: 92  EKWMEKMKALDKESDRAIIKQTLD--NFQHSNDKIRRLMLEGILQLCCFPQLSYIADEVK 149
           E++ +K +A + E   A IK +L   N  H        ++  +L      +LS I+  ++
Sbjct: 203 EEYKDKERA-ETERLLATIKASLGAVNMNH--------LIYSLLSGMHRSELSDISTLLR 253

Query: 150 QLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKRWKTLADDDRVWYHMCEQHIDRKC 209
             +K DF+++LP E++LKIL  L  +S+       K W  L +                 
Sbjct: 254 DNLKRDFVTSLPLEITLKILNKLPFESISNCLQVSKSWNRLIN----------------- 296

Query: 210 PNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGNEIGGGKSLINPGNSPNQT 269
                G P L     ++L ++E+ V   + ++   V N                   N+ 
Sbjct: 297 -----GTPALW----KHLLLSESFVSKDSFDKKYPVEN-------------------NKL 328

Query: 270 VAARARNSRYYTRPWKVIYRERF----QVESNWRNGRCRIQ--LFKGHMDGVLS-LKFNH 322
                 +SRY         R+ F     +  NW N     Q    KGHM  V++ L+F  
Sbjct: 329 DPPFDNDSRY---------RQDFLMNCSILQNWYNPDFIPQRTTLKGHMTSVVTCLQFED 379

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKMITASLDKTIRVWNYIT 381
             + TG+ D  + I+D+ +   +  L+GH  GV  + Y  +  +++ S D+++R+WN   
Sbjct: 380 NYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHL 439

Query: 382 GSCISTYRGHQDSVLSVDSYK----KIIVSASADKTVKVW-------------------- 417
           G C   ++GH  +V  +D  +    K IV+ S D T+ +W                    
Sbjct: 440 GKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSN 499

Query: 418 ------HVESRTCY---TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKV 468
                 H      Y    LRGH   V  V  H +     S S D  L +WDI    C+ +
Sbjct: 500 NGPLFFHSPEENPYFVGVLRGHIASVRTVSGHGR--IVISGSYDNNLIVWDIIQMKCLYI 557

Query: 469 FRGHVGQVQKVI---------------PLTIKDTENLVVDEKIEKVPNPELEEDFADDCT 513
             GH  ++   I                + I D +N+  + +   V N  +       CT
Sbjct: 558 LMGHTDRIYSTIYDYKRNRCISASMDSTIKIWDLQNIWNNGECVNVTNATVP------CT 611

Query: 514 GIFDPNLKYPTH-------------LLSCSLDNTIKLWEVSS-GRCIRTQFGHVEGVWDI 559
            I  P +    H             L+S + D +++ W+ S   R       ++  +   
Sbjct: 612 KITGPMMTLQGHTALVGLLKLSDKFLVSAAADGSLRGWDSSDYSRKFAYHHNNLSAITTF 671

Query: 560 AADNFRIVSGSHDKSIKVWDLQNGKCIQT 588
              +  +VSGS  +   +++L+ GK I +
Sbjct: 672 YMTDNILVSGSEGQ-FNIYNLRTGKLIHS 699

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 96/215 (44%), Gaps = 23/215 (10%)

Query: 386 STYRGHQDSVLSVDSYK-KIIVSASADKTVKVW-HVESRTCYTLRGHTEWVNCVKLHPKS 443
           +T +GH  SV++   ++   +++ + DK ++++  +  +    L GH   V  +K +  +
Sbjct: 362 TTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALK-YAGN 420

Query: 444 FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV---DEKIEKVP 500
               S S D+++R+W+I    C  VF+GH   V+ +  +  +  + +V    D  +    
Sbjct: 421 GILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNTLHIWK 480

Query: 501 NPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR---CIRTQFGHVEGVW 557
            P++ +   D+      PN+            N   L+  S       +    GH+  V 
Sbjct: 481 LPQMSDSNIDEGM----PNV----------YSNNGPLFFHSPEENPYFVGVLRGHIASVR 526

Query: 558 DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
            ++     ++SGS+D ++ VWD+   KC+    GH
Sbjct: 527 TVSGHGRIVISGSYDNNLIVWDIIQMKCLYILMGH 561

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKSIKVWDLQNG 583
           ++++ + D  I++++  + + +    GH  GVW +  A N  +VSGS D+S+++W++  G
Sbjct: 381 YVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLG 440

Query: 584 KCIQTFTGHKAPIVCVGI 601
           KC   F GH + + C+ I
Sbjct: 441 KCTHVFKGHTSTVRCLDI 458

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 89.4 bits (220), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 124/278 (44%), Gaps = 18/278 (6%)

Query: 319 KFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRV 376
           K ++    TGS D T+ IW+  SG L   L  H   V+ +   ++   M + S DKT++ 
Sbjct: 125 KVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKC 184

Query: 377 WNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVESR-TCYTLRGHTEW 433
           W+    + I  Y GH   V +VD +    ++V+A  D  VKVW + +R    TL GH   
Sbjct: 185 WDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGP 244

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQ--KVIPLTIKDTENLV 491
           +  V+  P      SSS D ++R+WD+     +KV   H   V+   V P          
Sbjct: 245 ITKVRCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPSEFSFASACT 304

Query: 492 VDEKIEKVPNPELEEDF-ADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT-- 548
            D +   +P  EL  +F + D   I   ++     L + S + ++  ++  SG   +T  
Sbjct: 305 NDIRSWLLPKGELLTNFVSQDLDVINTVSINQDDVLFAGSDNGSLTFFDYKSGHKYQTFK 364

Query: 549 ---QFGHVEGVWDIAADNF-----RIVSGSHDKSIKVW 578
                G  E    I +  F     R+++G  D++IK+W
Sbjct: 365 TKEAPGSPESERGILSSTFDGTGLRLLTGETDRTIKIW 402

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 91/205 (44%), Gaps = 41/205 (20%)

Query: 405 IVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463
             + S DKT+K+W++ S +   TL+ H   V  + +  +    +S S+DKT++ WD+  N
Sbjct: 131 FATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKN 190

Query: 464 SCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYP 523
           + I+ + GH+  V  V    I  T ++VV                               
Sbjct: 191 TAIRNYHGHLSGVHTV---DIHPTVDVVV------------------------------- 216

Query: 524 THLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQ 581
               +   D+ +K+W++ +   + T  GH   +  +     + +++S S D SI++WDL 
Sbjct: 217 ----TAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLV 272

Query: 582 NGKCIQTFTGHKAPIVCVGIGDSSF 606
            GK ++  T H+  +  + +  S F
Sbjct: 273 AGKSMKVLTHHQRTVRDISVHPSEF 297

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 82/172 (47%), Gaps = 15/172 (8%)

Query: 297 NWRNGRCRIQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDG 354
           N  +G+ ++ L K H   V  L++   H  +F+ S D TV  WD +    IR   GH  G
Sbjct: 144 NLASGKLKVTL-KAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSG 202

Query: 355 VK--GIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV-----LSVDSYKKIIVS 407
           V    I+     ++TA  D  ++VW+  T   + T  GH+  +     L VD     ++S
Sbjct: 203 VHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQ---VIS 259

Query: 408 ASADKTVKVWH-VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
           +S D ++++W  V  ++   L  H   V  + +HP  F+ ++S+    +R W
Sbjct: 260 SSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPSEFS-FASACTNDIRSW 310

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 544 RCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGD 603
           R I    G V  +     DN    +GS+DK+IK+W+L +GK   T   H   +  + I +
Sbjct: 109 RVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISN 168

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 116/266 (43%), Gaps = 34/266 (12%)

Query: 350 GHTDGVKGIYFDDQ--KMITAS-LDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKI 404
            H D +  + FD     + TA  +D  +++W+Y     I    GH  ++  + VD    +
Sbjct: 402 AHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATISCMQVDKNYNM 461

Query: 405 IVSASADKTVKVWHVE-----------SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
           + + S D TVK+W+             S   +TL  H + V+   L+       ++S DK
Sbjct: 462 VATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSS--LYIDGANLMTASQDK 519

Query: 454 TLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCT 513
           T+R WD+ +  CI+VF  +   +       +K  E    D  I K  N           T
Sbjct: 520 TIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNE----DSMILKTVN-----------T 564

Query: 514 GIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDK 573
            I      +   L + + D  I+LW++ +G  +R   GH++ +  +  D   I+SGS D 
Sbjct: 565 PIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDG 624

Query: 574 SIKVWDLQNGKCIQTFTGHKAPIVCV 599
           +I++WDL++       +  K PI  +
Sbjct: 625 TIRLWDLRSNNLTDIISYEK-PISSL 649

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 96/204 (47%), Gaps = 40/204 (19%)

Query: 304 RIQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDT-------KSGN---LIRRLTGH 351
           +I   +GH+  +  + +  N+ ++ TGS D+TV +W+        + GN    +  L  H
Sbjct: 439 QIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAH 498

Query: 352 TDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTY---------------RGHQDSVL 396
            D V  +Y D   ++TAS DKTIR W+  +G CI  +               + ++DS++
Sbjct: 499 LDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMI 558

Query: 397 ----------SVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFT 445
                     S+ S+   + + + D  +++W + +      L GH + +  +K    + T
Sbjct: 559 LKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFD--ATT 616

Query: 446 CYSSSDDKTLRMWDIRTNSCIKVF 469
             S S D T+R+WD+R+N+   + 
Sbjct: 617 IISGSLDGTIRLWDLRSNNLTDII 640

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L TG+ D  + +WD ++G ++R L GH D +  + FD   +I+ SLD TIR+W+ +  + 
Sbjct: 577 LATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDGTIRLWD-LRSNN 635

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW 417
           ++    ++  + S+D   K IV AS +    ++
Sbjct: 636 LTDIISYEKPISSLDFDAKHIVVASNEHNTHIY 668

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/262 (17%), Positives = 104/262 (39%), Gaps = 62/262 (23%)

Query: 379 YITGSCISTY-RGHQDSVLSVD---SYKKIIVSASADKTVKVW-HVESRTCYTLRGHTEW 433
           Y +G  +ST  + H D++  +D    +  +  +   D  VK+W + + R    + GH   
Sbjct: 390 YNSGKKLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVAT 449

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR-GHVGQVQKVIPLTIKDTENLVV 492
           ++C+++        + S D T+++W+   N  I  +  G+  +    +   + +  +L +
Sbjct: 450 ISCMQVDKNYNMVATGSKDATVKLWN--ANDVIGRYEEGNNSEALHTLDAHLDEVSSLYI 507

Query: 493 DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT---Q 549
           D                               +L++ S D TI+ W++ SG+CI+     
Sbjct: 508 D-----------------------------GANLMTASQDKTIRRWDLYSGKCIQVFDVN 538

Query: 550 FGHVEG----------------------VWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQ 587
           F  +                        +  I + +  + +G+ D  I++WD++ G+ ++
Sbjct: 539 FPSLSAYKSSFMKSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVR 598

Query: 588 TFTGHKAPIVCVGIGDSSFVSG 609
              GH   I  +    ++ +SG
Sbjct: 599 VLEGHMDAITSLKFDATTIISG 620

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 67/175 (38%), Gaps = 25/175 (14%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRL----------- 348
           N    +     H+D V SL  +   L T S D T+  WD  SG  I+             
Sbjct: 487 NNSEALHTLDAHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYK 546

Query: 349 --------------TGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDS 394
                         T +T  +  I   D  + T + D  IR+W+  TG  +    GH D+
Sbjct: 547 SSFMKSNEDSMILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDA 606

Query: 395 VLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSS 449
           + S+      I+S S D T+++W + S     +  + + ++ +    K     S+
Sbjct: 607 ITSLKFDATTIISGSLDGTIRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASN 661

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 3/124 (2%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           + R G   +++ +GHMD + SLKF+   + +GS D T+ +WD +S NL   +  +   + 
Sbjct: 590 DMRTGEV-VRVLEGHMDAITSLKFDATTIISGSLDGTIRLWDLRSNNLT-DIISYEKPIS 647

Query: 357 GIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK-KIIVSASADKTVK 415
            + FD + ++ AS +    +++   G+        QD+      YK +  +   ++  + 
Sbjct: 648 SLDFDAKHIVVASNEHNTHIYDRNDGNKWDLQDEEQDTTSLFVKYKERYTMEGRSNGDIG 707

Query: 416 VWHV 419
           +W V
Sbjct: 708 IWIV 711

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 114/261 (43%), Gaps = 43/261 (16%)

Query: 370 LDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVES------ 421
           LD TI+VWN      +++  GH  +V  + +D Y  +I +   D  +K+W ++       
Sbjct: 432 LDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLI-TGGRDALLKMWDIQKAIDNDS 490

Query: 422 ----RTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKV----FRGH 472
                 C YT   H + +  +     +    S S D+T+R WD+    C++     F   
Sbjct: 491 IPSDEVCIYTFDSHIDEITALSFEANNLV--SGSQDRTIRQWDLNNGKCVQTLDINFATG 548

Query: 473 VGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLD 532
               + +I     +T N   D  I            A  C         Y   L + + D
Sbjct: 549 GNLSRSMIGSGFLNTNN---DHPIIG----------AIQC---------YDAALATGTKD 586

Query: 533 NTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
             ++LW++ SGR +RT  GH + V  +  D+  +V+GS D SI++WDL+ G    TF+ +
Sbjct: 587 GIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTLADTFS-Y 645

Query: 593 KAPIVCVGIGDSSFVSGDELG 613
           + P+ C+    +  V  ++ G
Sbjct: 646 EHPVTCLQFDLNKIVVANQEG 666

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 64/115 (55%), Gaps = 3/115 (2%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L TG+ D  V +WD +SG ++R L GH+D V  + FD   ++T SLD +IR+W+  TG+ 
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTL 639

Query: 385 ISTYR-GHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438
             T+   H  + L  D  K  IV A+ + TVKV++ + +  +   G     N V+
Sbjct: 640 ADTFSYEHPVTCLQFDLNK--IVVANQEGTVKVYNRQEKKHWFCGGDEHSENAVE 692

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 125/323 (38%), Gaps = 78/323 (24%)

Query: 298 WRNGRCRIQLFKGHMDGVLSLKFN---HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDG 354
           +  G   +     H D V  L FN     L   G  D T+ +W+      +  +TGH   
Sbjct: 397 YEPGANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLAT 456

Query: 355 VKGIYFDD-QKMITASLDKTIRVWNYITG----------SCISTYRGHQDSVLSVDSYKK 403
           V  +  D    +IT   D  +++W+               CI T+  H D + ++     
Sbjct: 457 VSCMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEAN 516

Query: 404 IIVSASADKTVKVWHVESRTC-------YTLRGH-------TEWVNCVKLHP--KSFTCY 447
            +VS S D+T++ W + +  C       +   G+       + ++N    HP   +  CY
Sbjct: 517 NLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCY 576

Query: 448 -----SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
                + + D  +R+WD+R+   ++   GH                              
Sbjct: 577 DAALATGTKDGIVRLWDLRSGRVVRTLEGH------------------------------ 606

Query: 503 ELEEDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA 561
                 +D  T + FD       +L++ SLDN+I++W++ +G    T F +   V  +  
Sbjct: 607 ------SDAVTSLQFD-----SLNLVTGSLDNSIRIWDLRTGTLADT-FSYEHPVTCLQF 654

Query: 562 DNFRIVSGSHDKSIKVWDLQNGK 584
           D  +IV  + + ++KV++ Q  K
Sbjct: 655 DLNKIVVANQEGTVKVYNRQEKK 677

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 11/113 (9%)

Query: 510 DDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-IVS 568
           +D     D NL + T   +  LD TIK+W +S  + + +  GH+  V  +  D +  +++
Sbjct: 411 EDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLIT 470

Query: 569 GSHDKSIKVWDLQNG----------KCIQTFTGHKAPIVCVGIGDSSFVSGDE 611
           G  D  +K+WD+Q             CI TF  H   I  +    ++ VSG +
Sbjct: 471 GGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNLVSGSQ 523

>Scas_711.11
          Length = 695

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 129/295 (43%), Gaps = 43/295 (14%)

Query: 309 KGHMDGVLSLKFN---HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKM 365
           K H D +  L F+     L   G  D  + IWD      I R+TGH   V  +   +  +
Sbjct: 369 KAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNNML 428

Query: 366 ITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTC- 424
           ++   D  +++WN   G  + ++R    +VL  ++     +S+SA            +C 
Sbjct: 429 VSGGKDALLKLWNLNVG--VQSFR----NVLPTNNSNLEPISSSA------------SCI 470

Query: 425 YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTI 484
           +T   H + +  V +  ++    S S D+T+R WDI +  C++               TI
Sbjct: 471 HTFDSHVDEITSVTVAGENL--ISGSQDRTIRQWDIPSGKCLQ---------------TI 513

Query: 485 KDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR 544
             +   +    I+   +P L    A   T I      +   L + + D  ++LW++ +G+
Sbjct: 514 DLSFVAIASPPIQVTDSPFLTTTKA---TAIIGALQCFDAALATGTRDGIVRLWDLRAGK 570

Query: 545 CIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            +R   GH   +  +  DN  IV+GS DK++++WDL++G      T  K P++ V
Sbjct: 571 VVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSGILSDMLTFEK-PVLSV 624

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 57/93 (61%), Gaps = 1/93 (1%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L TG+ D  V +WD ++G ++R L GH+  +  + FD++ ++T S+DKT+R+W+  +G  
Sbjct: 552 LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSG-I 610

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW 417
           +S     +  VLSVD  K  I  A+ D+  KV+
Sbjct: 611 LSDMLTFEKPVLSVDFDKNKIAIATHDEACKVY 643

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 122/287 (42%), Gaps = 62/287 (21%)

Query: 357 GIYFDDQKMITASLDKTIRVWNYITGSCISTY-RGHQDSVLSVD---SYKKIIVSASADK 412
           G ++ +Q   +  +  T++ + +  GS I+T  + H D++  +D    +  +  +   D 
Sbjct: 337 GQFYHNQNRNSRKITPTLQQY-FEKGSMINTIQKAHDDNITCLDFDLPFGTLCTAGHLDH 395

Query: 413 TVKVWHVE-SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
            +K+W +  S+    + GH   VNC+++        S   D  L++W++  N  ++ FR 
Sbjct: 396 VIKIWDLSRSKQIGRMTGHVATVNCMQITNNMLV--SGGKDALLKLWNL--NVGVQSFR- 450

Query: 472 HVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPT------- 524
                  V+P           +  +E + +       +  C   FD ++   T       
Sbjct: 451 ------NVLPTN---------NSNLEPISS-------SASCIHTFDSHVDEITSVTVAGE 488

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRT---QFGHVEG-------------------VWDIAAD 562
           +L+S S D TI+ W++ SG+C++T    F  +                     +  +   
Sbjct: 489 NLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVTDSPFLTTTKATAIIGALQCF 548

Query: 563 NFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSG 609
           +  + +G+ D  +++WDL+ GK ++   GH   I C+   + + V+G
Sbjct: 549 DAALATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTG 595

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 51/124 (41%), Gaps = 22/124 (17%)

Query: 510 DDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSG 569
           DD     D +L + T   +  LD+ IK+W++S  + I    GHV  V  +   N  +VSG
Sbjct: 372 DDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNNMLVSG 431

Query: 570 SHDKSIKVWDLQNG----------------------KCIQTFTGHKAPIVCVGIGDSSFV 607
             D  +K+W+L  G                       CI TF  H   I  V +   + +
Sbjct: 432 GKDALLKLWNLNVGVQSFRNVLPTNNSNLEPISSSASCIHTFDSHVDEITSVTVAGENLI 491

Query: 608 SGDE 611
           SG +
Sbjct: 492 SGSQ 495

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 134/342 (39%), Gaps = 90/342 (26%)

Query: 298 WRNGRCRIQLFKGHMDGVLS-LKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           +R GR       GH   V++  +F    + TG+ D  + ++D         L GH  GV 
Sbjct: 355 YRPGRT---CLDGHRTKVVTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVW 411

Query: 357 GI-YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK----KIIVSASAD 411
            + Y  D+ +++ S D+T+R+WN   G C   +RGH  +V  +D  +    K +V+ S D
Sbjct: 412 ALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRD 471

Query: 412 KTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
            T+ VW +               N    +P +   ++S +D             + V RG
Sbjct: 472 NTLHVWKLPDP------------NSPDYNPNAMRQFNSIEDNPF---------FVGVLRG 510

Query: 472 HVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSL 531
           H+  V+     T+    N+VV                    +G +D NL           
Sbjct: 511 HMASVR-----TVSGHGNIVV--------------------SGSYDHNL----------- 534

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQ----NGKC 585
                +W+++  + +    GH + ++    D+   R +S S D ++KVWDL     NG  
Sbjct: 535 ----MVWDIAKMKLLYVLTGHTDRIYSTLYDHKRKRCISASMDTTVKVWDLSDINNNGPV 590

Query: 586 --------------IQTFTGHKAPIVCVGIGDSSFVSGDELG 613
                         ++T  GH A +  +G+ D   VS    G
Sbjct: 591 SQINSTSALKVSGSVRTLCGHTALVGLLGLSDKYLVSAAADG 632

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 135/315 (42%), Gaps = 56/315 (17%)

Query: 348 LTGH-TDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-SYKKII 405
           L GH T  V    F+   +IT + DK I V++           GH+  V ++  +  +I+
Sbjct: 362 LDGHRTKVVTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEIL 421

Query: 406 VSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKL--HPKSFTCYSSSDDKTLRMW---- 458
           VS S D+TV++W+V++  C +  RGHT  V C+ +  H       + S D TL +W    
Sbjct: 422 VSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPD 481

Query: 459 ----DIRTNSC------------IKVFRGHVGQVQKV-----IPLTIKDTENLVVDEKIE 497
               D   N+             + V RGH+  V+ V     I ++     NL+V + I 
Sbjct: 482 PNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWD-IA 540

Query: 498 KVPNPELEEDFADDC-TGIFDPNLKYPTHLLSCSLDNTIKLWEVS--------------- 541
           K+    +     D   + ++D   K     +S S+D T+K+W++S               
Sbjct: 541 KMKLLYVLTGHTDRIYSTLYDHKRK---RCISASMDTTVKVWDLSDINNNGPVSQINSTS 597

Query: 542 ----SGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQN-GKCIQTFTGHKAPI 596
               SG  +RT  GH   V  +   +  +VS + D S++ WD  +  K       +++ I
Sbjct: 598 ALKVSG-SVRTLCGHTALVGLLGLSDKYLVSAAADGSLRGWDASDYSKRFSFHHTNQSAI 656

Query: 597 VCVGIGDSSFVSGDE 611
               + D+  VSG E
Sbjct: 657 TTFFVSDNILVSGSE 671

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 68/134 (50%), Gaps = 22/134 (16%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK 364
           + + +GHM  V ++  +  ++ +GSYD  + +WD     L+  LTGHTD +    +D ++
Sbjct: 505 VGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHKR 564

Query: 365 M--ITASLDKTIRVWNY-------------------ITGSCISTYRGHQDSVLSVDSYKK 403
              I+AS+D T++VW+                    ++GS + T  GH   V  +    K
Sbjct: 565 KRCISASMDTTVKVWDLSDINNNGPVSQINSTSALKVSGS-VRTLCGHTALVGLLGLSDK 623

Query: 404 IIVSASADKTVKVW 417
            +VSA+AD +++ W
Sbjct: 624 YLVSAAADGSLRGW 637

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 140 QLSYIADEVKQLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKRWKTLA-DDDRVWY 198
           +LS ++  +K  +K DF+  LP E+S+ IL  LD + +C   L  + W  L  +   +W 
Sbjct: 242 ELSDLSTYLKDHLKRDFLQYLPMEVSMNILNNLDFEDICSCLLVNRTWNNLIRNSPYLWK 301

Query: 199 HM 200
           HM
Sbjct: 302 HM 303

>Scas_630.6
          Length = 621

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 116/259 (44%), Gaps = 41/259 (15%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWH 418
           D + + T + DK IR+WN      +   +GH+  + S+D +   + +VS S D+++++W 
Sbjct: 352 DGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWD 411

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVFRGHVGQVQ 477
           +++  C       + V  V + P      ++ S D+++R+WD  T   ++          
Sbjct: 412 LKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERL-------- 463

Query: 478 KVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKL 537
                   D++N   +   + V +    +D                 H++S SLD T+KL
Sbjct: 464 --------DSDNESGNGHQDSVYSVAFTKDGQ---------------HVVSGSLDRTVKL 500

Query: 538 WEVS-----SGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
           W +      +G+C  T  GH + V  +A   D+  I SGS D+ + +WD  +G  I    
Sbjct: 501 WNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQ 560

Query: 591 GHKAPIVCVGIGDSSFVSG 609
           GH+  ++ V   +S+   G
Sbjct: 561 GHRKSVISVATVNSNVDDG 579

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 98/191 (51%), Gaps = 21/191 (10%)

Query: 302 RCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           R  + + KGH   + SL +  + + L +GS D ++ IWD K+G     L+   DGV  + 
Sbjct: 373 RKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIE-DGVTTVA 431

Query: 360 F--DDQKMITA-SLDKTIRVWNYITGSCIS-------TYRGHQDSVLSVDSYK--KIIVS 407
              ++ K+I A SLD+++R+W+  TG  +        +  GHQDSV SV   K  + +VS
Sbjct: 432 VSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVS 491

Query: 408 ASADKTVKVWHVESRTCYTLR------GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR 461
            S D+TVK+W++      T +      GH ++V  V         +S S D+ + +WD  
Sbjct: 492 GSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKD 551

Query: 462 TNSCIKVFRGH 472
           + + I + +GH
Sbjct: 552 SGNPILMLQGH 562

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 118/283 (41%), Gaps = 64/283 (22%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDD-QKMITASLDKTIRVWNYI 380
             L TG+ D  + IW+ K   ++  L GH   +  + YF D QK+++ S D++IR+W+  
Sbjct: 354 EFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLK 413

Query: 381 TGSCISTYRGHQDSVLSV---DSYKKIIVSASADKTVKVWHVESRTCYTLR--------- 428
           TG C S     +D V +V    +  K+I + S D++V++W  +S T + +          
Sbjct: 414 TGQC-SLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIW--DSSTGFLVERLDSDNESG 470

Query: 429 -GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI-----RTNSCIKVFRGHVGQVQKVIPL 482
            GH + V  V          S S D+T+++W++      T  C   + GH   V  V   
Sbjct: 471 NGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVA-- 528

Query: 483 TIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSS 542
               T N   D+K                             ++ S S D  + +W+  S
Sbjct: 529 ----TSN---DDK-----------------------------YIFSGSKDRGVIIWDKDS 552

Query: 543 GRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKC 585
           G  I    GH + V  +A  N  +  G   K+ K++   +G C
Sbjct: 553 GNPILMLQGHRKSVISVATVNSNVDDG---KNYKLFATGSGDC 592

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 75/189 (39%), Gaps = 70/189 (37%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNH---RLLFTGSYDSTVAIWDTKSGNLIRRL----- 348
           + + G+C + L     DGV ++  +    +L+  GS D +V IWD+ +G L+ RL     
Sbjct: 411 DLKTGQCSLTL--SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNE 468

Query: 349 --TGHTDGVKGIYF--DDQKMITASLDKTIRVWNYI-----TGSCISTYRGHQD------ 393
              GH D V  + F  D Q +++ SLD+T+++WN       TG C  TY GH+D      
Sbjct: 469 SGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVA 528

Query: 394 ------------------------------------SVLSVDSYK---------KIIVSA 408
                                               SV+SV +           K+  + 
Sbjct: 529 TSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATG 588

Query: 409 SADKTVKVW 417
           S D   ++W
Sbjct: 589 SGDCKARIW 597

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 44/90 (48%), Gaps = 12/90 (13%)

Query: 301 GRCRIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358
           G+C +  + GH D VLS+  ++  + +F+GS D  V IWD  SGN I  L GH   V  +
Sbjct: 511 GKCEVT-YIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISV 569

Query: 359 Y-----FDDQK----MITASLDKTIRVWNY 379
                  DD K      T S D   R+W Y
Sbjct: 570 ATVNSNVDDGKNYKLFATGSGDCKARIWKY 599

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 117/265 (44%), Gaps = 44/265 (16%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWH 418
           D + + T + DK IR+W+  T   + T +GH+  + S+D +     +VS S D+TV++W 
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWD 422

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVFRGHVGQVQ 477
           + +  C       + V  V + P      ++ S D+T+R+WD  T   ++          
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERL-------- 474

Query: 478 KVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKL 537
                   D+EN +     + V        F  D  G+           +S SLD ++KL
Sbjct: 475 --------DSENELSTGHKDSV----YSVVFTRDGQGV-----------ISGSLDRSVKL 511

Query: 538 WEV-------SSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIKVWDLQNGKCIQT 588
           W++       S   C  T  GH + V  +A   D+  I+SGS D+ +  WD  +G  +  
Sbjct: 512 WDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLM 571

Query: 589 FTGHKAPIVCVGIGDSSFVSGDELG 613
             GH+  ++ V + +  F  G ++G
Sbjct: 572 LQGHRNSVISVAVVN-GFPLGPDVG 595

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 122/301 (40%), Gaps = 72/301 (23%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFD-DQKMITASLDKTIRVWNYI 380
           + L TG+ D  + IWD  +  ++  L GH   +  + YF    K+++ S D+T+R+W+  
Sbjct: 365 KYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLR 424

Query: 381 TGSCISTYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESRTCYTLR--------- 428
           TG C  T    +D V +V       K I + S D+TV+VW  +S T + +          
Sbjct: 425 TGQCSLTLS-IEDGVTTVAVSPGDGKYIAAGSLDRTVRVW--DSETGFLVERLDSENELS 481

Query: 429 -GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT-------NSCIKVFRGHVGQVQKVI 480
            GH + V  V          S S D+++++WD+R         +C   + GH     K  
Sbjct: 482 TGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH-----KDF 536

Query: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV 540
            L++  T++   DE                              ++LS S D  +  W+ 
Sbjct: 537 VLSVATTQD---DE------------------------------YILSGSKDRGVLFWDT 563

Query: 541 SSGRCIRTQFGHVEGVWDIAADN-FRI-------VSGSHDKSIKVWDLQNGKCIQTFTGH 592
           +SG  +    GH   V  +A  N F +        +GS D   ++W     K   T TG 
Sbjct: 564 ASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTK-KSNPTATGA 622

Query: 593 K 593
           K
Sbjct: 623 K 623

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 112/267 (41%), Gaps = 34/267 (12%)

Query: 359 YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWH 418
           + +D + +    +KT +V+   TG  ++  R   DSV  V++  +     + + T     
Sbjct: 284 FSNDGEYLATGCNKTTQVYKVSTGELLA--RLSDDSVAGVNN--EASTGPANNGTADNGG 339

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
             S T         ++  V   P      + ++DK +R+WD+ T   +   +GH   +  
Sbjct: 340 ENSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYS 399

Query: 479 VIPLTIKDTENLVV---DEKIE----KVPNPELEEDFADDCT--GIFDPNLKYPTHLLSC 529
           +      D   LV    D  +     +     L     D  T   +   + KY   + + 
Sbjct: 400 LDYFPAGD--KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKY---IAAG 454

Query: 530 SLDNTIKLWEVSSGRCI-------RTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDL 580
           SLD T+++W+  +G  +           GH + V+ +    D   ++SGS D+S+K+WDL
Sbjct: 455 SLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDL 514

Query: 581 Q--NGK-----CIQTFTGHKAPIVCVG 600
           +  NG+     C  T+TGHK  ++ V 
Sbjct: 515 RGLNGQKSHATCEVTYTGHKDFVLSVA 541

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 35/82 (42%), Gaps = 10/82 (12%)

Query: 308 FKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF----- 360
           + GH D VLS+        + +GS D  V  WDT SGN +  L GH + V  +       
Sbjct: 530 YTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFP 589

Query: 361 ---DDQKMITASLDKTIRVWNY 379
              D     T S D   R+W Y
Sbjct: 590 LGPDVGVFATGSGDCKARIWKY 611

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 112/253 (44%), Gaps = 45/253 (17%)

Query: 367 TASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTC 424
             SLD +++VW+      I+T  GH  S+  + +D Y  +I +   D  +K+W ++    
Sbjct: 415 AGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYSTLI-TGGRDAVLKLWDIDKAMA 473

Query: 425 --------------YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKV-- 468
                         YT   H + +  +     +    S S D+T+R WD+ +  C +   
Sbjct: 474 DEASNSSEDNDACLYTFDSHVDEITAISFDGDNLV--SGSQDRTVRQWDLNSGKCTQTID 531

Query: 469 --FRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHL 526
             F     + Q+ IPL      N V+   + K P P +    A  C   FD  L   T  
Sbjct: 532 ISFATGPMRSQRNIPL-----RNSVL---LTKEP-PAIG---ALQC---FDAALATGTK- 575

Query: 527 LSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCI 586
                D  ++LW++ SG+ +R   GH + +  +  D+  +V+G+ D+SI++WDL+ G   
Sbjct: 576 -----DGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTGILS 630

Query: 587 QTFTGHKAPIVCV 599
             F  ++ PI  +
Sbjct: 631 DVF-AYEQPITSL 642

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 57/94 (60%), Gaps = 1/94 (1%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L TG+ D  V +WD +SG ++R L GHTD +  + FD   ++T ++D++IR+W+  TG  
Sbjct: 570 LATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTG-I 628

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWH 418
           +S    ++  + S+      IV ++ + TVK+++
Sbjct: 629 LSDVFAYEQPITSLHFDLDKIVISNNEPTVKIYN 662

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 53/86 (61%), Gaps = 2/86 (2%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           + R+G+  +++ +GH D + SL+F+   L TG+ D ++ IWD ++G ++  +  +   + 
Sbjct: 583 DLRSGKV-VRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTG-ILSDVFAYEQPIT 640

Query: 357 GIYFDDQKMITASLDKTIRVWNYITG 382
            ++FD  K++ ++ + T++++N   G
Sbjct: 641 SLHFDLDKIVISNNEPTVKIYNRKDG 666

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 65/149 (43%), Gaps = 24/149 (16%)

Query: 296 SNWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSG------------- 342
           S+  N  C +  F  H+D + ++ F+   L +GS D TV  WD  SG             
Sbjct: 479 SSEDNDAC-LYTFDSHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATG 537

Query: 343 ------NLIRR----LTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQ 392
                 N+  R    LT     +  +   D  + T + D  +R+W+  +G  +    GH 
Sbjct: 538 PMRSQRNIPLRNSVLLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHT 597

Query: 393 DSVLSVDSYKKIIVSASADKTVKVWHVES 421
           D++ S+      +V+ + D+++++W + +
Sbjct: 598 DAITSLQFDSVNLVTGAMDRSIRIWDLRT 626

>Kwal_27.12667
          Length = 721

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 115/275 (41%), Gaps = 46/275 (16%)

Query: 350 GHTDGVKGIYFDDQ--KMITAS-LDKTIRVWNYITGSCISTYRGHQDSVLSV---DSYKK 403
            H D +  + FD     M TA  LD ++++WN    + I    GH  SV  +   DS+  
Sbjct: 402 AHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHS- 460

Query: 404 IIVSASADKTVKVWHVESRTCYTLRGHTEWVN--CV-----------KLHPKSFTCYSSS 450
            +++   D  +K+W +E        G TE     CV            LH +  +  S S
Sbjct: 461 -LITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGS 519

Query: 451 DDKTLRMWDIRTNSCIKVF------RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPEL 504
            D+T+R WD+ T  C++        RG  G   K+                     NP  
Sbjct: 520 QDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKI------------------SSNNPRS 561

Query: 505 EEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNF 564
                 +   +      Y   + + + D  ++LW++ SG+ IRT  GH + V  +  D+ 
Sbjct: 562 SILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQFDSV 621

Query: 565 RIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            +V+GS D+SI++WDL+ G     F  + +PI  +
Sbjct: 622 NLVTGSLDRSIRIWDLRTGLLADAF-AYNSPISSL 655

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 113/271 (41%), Gaps = 74/271 (27%)

Query: 379 YITGSCISTY-RGHQDSVLSVD---SYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEW 433
           Y  G+ IS++ + H DS+  +D    +  +  +   D +VK+W++  +T    L GH   
Sbjct: 390 YEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLAS 449

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVD 493
           V+C+++   S +  +   D  L++WDI                                 
Sbjct: 450 VSCMQME-DSHSLITGGRDALLKLWDI--------------------------------- 475

Query: 494 EKIEKVPNPELEEDFADDCTGIFDPNLKYPT-------HLLSCSLDNTIKLWEVSSGRCI 546
           EK E++ N    E   + C   FD ++   T        L+S S D TI+ W++++G+C+
Sbjct: 476 EKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCL 535

Query: 547 RT------QFGHVEGVWDIAADNFR----------------------IVSGSHDKSIKVW 578
           +T        G   G   I+++N R                      + +G+ D  +++W
Sbjct: 536 QTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLW 595

Query: 579 DLQNGKCIQTFTGHKAPIVCVGIGDSSFVSG 609
           DL++G+ I+T  GH   +  +     + V+G
Sbjct: 596 DLRSGQVIRTLEGHTDAVTGLQFDSVNLVTG 626

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 48/83 (57%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           N R  I L       + +L+     + TG+ D  V +WD +SG +IR L GHTD V G+ 
Sbjct: 558 NPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQ 617

Query: 360 FDDQKMITASLDKTIRVWNYITG 382
           FD   ++T SLD++IR+W+  TG
Sbjct: 618 FDSVNLVTGSLDRSIRIWDLRTG 640

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 90/213 (42%), Gaps = 48/213 (22%)

Query: 302 RCRIQLFKGHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGN--------------LI 345
           + +I    GH+  V  + ++ +H L+ TG  D+ + +WD +                  +
Sbjct: 437 KTQIGALPGHLASVSCMQMEDSHSLI-TGGRDALLKLWDIEKAEELYNDGATEGEEELCV 495

Query: 346 RRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTY------RG--------- 390
                H D +  ++F+   +++ S D+TIR W+  TG C+ T       RG         
Sbjct: 496 HTFDAHVDEITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKIS 555

Query: 391 -----------HQDS--VLSVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNC 436
                      H D   + ++  Y   + + + D  V++W + S +   TL GHT+ V  
Sbjct: 556 SNNPRSSILLTHNDPPVIGALQCYDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTG 615

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF 469
           ++    S    + S D+++R+WD+RT      F
Sbjct: 616 LQF--DSVNLVTGSLDRSIRIWDLRTGLLADAF 646

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/317 (19%), Positives = 122/317 (38%), Gaps = 88/317 (27%)

Query: 309 KGHMDGVLSLKFN---HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD-QK 364
           K H D +  L F+     +   G  D +V IW+      I  L GH   V  +  +D   
Sbjct: 401 KAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHS 460

Query: 365 MITASLDKTIRVWN-------YITGS-------CISTYRGHQDSVLSVDSYKKIIVSASA 410
           +IT   D  +++W+       Y  G+       C+ T+  H D + ++      +VS S 
Sbjct: 461 LITGGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGSQ 520

Query: 411 DKTVKVWHVESRTC-------YTLRGHTEWVNCVKL-HPKS--------------FTCY- 447
           D+T++ W + +  C       +  RG +   + +   +P+S                CY 
Sbjct: 521 DRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYD 580

Query: 448 ----SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPE 503
               + + D  +R+WD+R+   I+   GH                               
Sbjct: 581 AAMATGTKDGLVRLWDLRSGQVIRTLEGHT------------------------------ 610

Query: 504 LEEDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD 562
                 D  TG+ FD       +L++ SLD +I++W++ +G  +   F +   +  +  D
Sbjct: 611 ------DAVTGLQFD-----SVNLVTGSLDRSIRIWDLRTG-LLADAFAYNSPISSLQFD 658

Query: 563 NFRIVSGSHDKSIKVWD 579
              I+  +++  ++V++
Sbjct: 659 LEHILVSNNESVVQVYN 675

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 52/117 (44%), Gaps = 15/117 (12%)

Query: 510 DDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI-AADNFRIVS 568
           DD     D +L + T   +  LD+++K+W +S    I    GH+  V  +   D+  +++
Sbjct: 404 DDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLASVSCMQMEDSHSLIT 463

Query: 569 GSHDKSIKVWDLQNGK--------------CIQTFTGHKAPIVCVGIGDSSFVSGDE 611
           G  D  +K+WD++  +              C+ TF  H   I  +    +S VSG +
Sbjct: 464 GGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNSLVSGSQ 520

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 132/291 (45%), Gaps = 55/291 (18%)

Query: 349 TGHTDGVKGI----------YFDDQKMI-TASLDKTIRVWNYITGS----CISTYRGHQD 393
           T H+  +  I          + D   ++ T S D  I V+++ + +     I ++  H  
Sbjct: 163 TAHSKAITSIEVIEAHNFEEFIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDS 222

Query: 394 SVLSVDSYKK----IIVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYS 448
           +V S  +++K    ++ S+S D TVKVW V +SR   +   H+EWV  + +  +     S
Sbjct: 223 TVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYI--LS 280

Query: 449 SSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDF 508
            S D TLR+    + + + V  GH   +++V+ +   D+       KI   P  +  E  
Sbjct: 281 GSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDS-------KICTSPYRDQNEHS 333

Query: 509 ADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV-----------------SSGRCIRTQFG 551
           A      F P L++  +  S + DNTIK+WEV                 ++ +C+ T  G
Sbjct: 334 A------FAP-LRF-KYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRG 385

Query: 552 HVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTG-HKAPIVCVGI 601
           H   V D+      + S S D++IK WDL  G C++T++  H   I C+ I
Sbjct: 386 HTSWVKDLKLRGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDI 436

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 97/214 (45%), Gaps = 49/214 (22%)

Query: 305 IQLFKGHMDGVLSLKF----NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360
           I+ F  H   V S K     N  LL + S D+TV +W       ++  + H++ VK I  
Sbjct: 214 IRSFNAHDSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDV 273

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQ------------DSVLSVDSYK------ 402
            D+ +++ SLD T+R+ ++ +G+ +S   GH+            DS +    Y+      
Sbjct: 274 LDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSPYRDQNEHS 333

Query: 403 -------KIIVSASADKTVKVWHVE--------------SRTCY----TLRGHTEWVNCV 437
                  K   SA+ D T+K+W V               + T +    TLRGHT WV  +
Sbjct: 334 AFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDL 393

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
           KL       +S SDD+T++ WD+ T +C+K +  
Sbjct: 394 KLRGDHL--FSCSDDETIKCWDLNTGNCVKTWSS 425

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 73/185 (39%), Gaps = 38/185 (20%)

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVD 493
           V  +KLHP     Y  +D   L  +DI               +   IPL +    +  + 
Sbjct: 126 VTAIKLHPSLAIVYVGTDTGRLIAYDI---------------LNYTIPLAVTTAHSKAI- 169

Query: 494 EKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSG----RCIRTQ 549
             IE +     EE F D  T +            + S D  I +++ SS     + IR+ 
Sbjct: 170 TSIEVIEAHNFEE-FIDSTTLVS-----------TTSKDAQINVYDHSSNTGELKLIRSF 217

Query: 550 FGHVEGV-----WDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDS 604
             H   V     W    ++  + S S D ++KVW + + +C+Q+F+ H   +  + + D 
Sbjct: 218 NAHDSTVSSQKTWQ-KDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDE 276

Query: 605 SFVSG 609
             +SG
Sbjct: 277 YILSG 281

>Scas_603.5
          Length = 589

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 108/259 (41%), Gaps = 73/259 (28%)

Query: 381 TGSCISTYRG-HQDSVLSVD---SYKKIIVSASADKTVKVWHVESR-TCYTLRGHTEWVN 435
           +GS + T    + D+V  +D   S K +  +   + ++KVW +E+      L  H   V 
Sbjct: 282 SGSHLGTLDSVYTDTVTCLDFDLSTKMLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVT 341

Query: 436 CVKLHPKSFTCYSSSDDKTLRMWDI------------RTNSCIKVFRGHVGQVQKVIPLT 483
           C++LHP S T  + S D TL++WD+              +SCI  F  H  ++  V    
Sbjct: 342 CMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVS--- 398

Query: 484 IKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSG 543
             D E                                    +LLS S D +I+ W++++G
Sbjct: 399 -YDNE------------------------------------YLLSASRDKSIRQWDLTTG 421

Query: 544 RCIRT---QFGH----------VEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
            C++T      H          VE +  + A    + +GS D  I++WDL++GK ++T  
Sbjct: 422 NCVQTLEATLSHNSGTNIKDSTVEALQSVGA---ALATGSKDGIIRLWDLRSGKVVRTLL 478

Query: 591 GHKAPIVCVGIGDSSFVSG 609
            H+ PI  +    +  ++G
Sbjct: 479 KHQGPITSLQFDSTKIITG 497

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 102/225 (45%), Gaps = 28/225 (12%)

Query: 283 PWKVIYRERFQVESN--WRNGRCRIQLFKGHMDGVLSLKFN--HRLLFT-GSYDSTVAIW 337
           P +V++  +   E+N   ++G     L   + D V  L F+   ++L+T G Y++++ +W
Sbjct: 263 PAQVMFFHKNDKENNEDLKSGSHLGTLDSVYTDTVTCLDFDLSTKMLYTAGKYNTSIKVW 322

Query: 338 DTKSGNLIRRLTGHTDGVK--GIYFDDQKMITASLDKTIRVWNYITG------------S 383
           D ++ + +  L  H   V    ++ D + +IT S D T+++W+                S
Sbjct: 323 DLETNDQVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDS 382

Query: 384 CISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCY-TLRG---HTEWVN---- 435
           CI+T+  H   + SV    + ++SAS DK+++ W + +  C  TL     H    N    
Sbjct: 383 CINTFEAHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDS 442

Query: 436 -CVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
               L        + S D  +R+WD+R+   ++    H G +  +
Sbjct: 443 TVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSL 487

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 81/177 (45%), Gaps = 25/177 (14%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWDT---------KSGNL---IRRLTGHTDGVKGIYFDDQ 363
           + L  + + L TGS D+T+ +WD           + N+   I     HT  +  + +D++
Sbjct: 343 MQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFEAHTAEITSVSYDNE 402

Query: 364 KMITASLDKTIRVWNYITGSCISTYRG----------HQDSVLSVDSYKKIIVSASADKT 413
            +++AS DK+IR W+  TG+C+ T                +V ++ S    + + S D  
Sbjct: 403 YLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGI 462

Query: 414 VKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF 469
           +++W + S +   TL  H   +  ++    S    + S D  + + D+RT + ++ +
Sbjct: 463 IRLWDLRSGKVVRTLLKHQGPITSLQF--DSTKIITGSTDANISVSDLRTGNILETY 517

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 5/94 (5%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L TGS D  + +WD +SG ++R L  H   +  + FD  K+IT S D  I V +  TG+ 
Sbjct: 454 LATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANISVSDLRTGNI 513

Query: 385 ISTYRGHQDSVLSVDSYK--KIIVSASADKTVKV 416
           + TY  H D+ ++   ++  K++V+A   K V+V
Sbjct: 514 LETY--HCDAPINTFDFENDKLVVAADT-KDVRV 544

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDG-V 355
           + R+G+    L K H   + SL+F+   + TGS D+ +++ D ++GN++   T H D  +
Sbjct: 467 DLRSGKVVRTLLK-HQGPITSLQFDSTKIITGSTDANISVSDLRTGNILE--TYHCDAPI 523

Query: 356 KGIYFDDQKMITASLDKTIRVWNYITGS---CISTYRGHQDSVLSVDSYKKIIVSASADK 412
               F++ K++ A+  K +RV N   GS   C       + + +SV   KK+++   ++ 
Sbjct: 524 NTFDFENDKLVVAADTKDVRVINRNNGSHWNC-DIKVPDESTTVSVKLKKKLMIEGRSNG 582

Query: 413 TVKVWHV 419
            + +WH+
Sbjct: 583 VINLWHI 589

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 10/122 (8%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTG---HTDG------- 354
           I  F+ H   + S+ +++  L + S D ++  WD  +GN ++ L     H  G       
Sbjct: 384 INTFEAHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDST 443

Query: 355 VKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTV 414
           V+ +      + T S D  IR+W+  +G  + T   HQ  + S+      I++ S D  +
Sbjct: 444 VEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANI 503

Query: 415 KV 416
            V
Sbjct: 504 SV 505

>Kwal_27.11585
          Length = 823

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 126/333 (37%), Gaps = 95/333 (28%)

Query: 304 RIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIW----DTKSGNLIRRLTGHTDGVKG 357
            ++L++GH D + SL    N   L T S D TV +W    D++      R TGH   V  
Sbjct: 392 EVELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTA 451

Query: 358 IYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW 417
           +           L   +R                       +++ + I++AS D T+K W
Sbjct: 452 V----------GLPNVMR-----------------------NTWPEFIITASNDLTIKKW 478

Query: 418 HVESRTC------------YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC 465
            V   T             YT R H + +N + + P      ++S DKT ++W++ +   
Sbjct: 479 SVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSG-- 536

Query: 466 IKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL-KYPT 524
                                                ELE   A+   G++D    +Y  
Sbjct: 537 -------------------------------------ELEGTLANHKRGLWDVTFCQYDK 559

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWDLQN 582
            L +CS D TIK+W + S   ++T  GH   V        N +IVS   D  IKVWDL  
Sbjct: 560 LLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLST 619

Query: 583 GKCIQTFTGHKAPIVCVGI--GDSSFVSGDELG 613
           G+CI+T   H   I  + +      FV+ D  G
Sbjct: 620 GECIRTLDAHSNRIWALSVLSDGKEFVTADADG 652

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 72/151 (47%), Gaps = 9/151 (5%)

Query: 315 VLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDK 372
            LS+  N  +  T SYD T  IW+  SG L   L  H  G+  + F   D+ + T S DK
Sbjct: 509 ALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDK 568

Query: 373 TIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY-TLRG 429
           TI+VW+  + S + T  GH ++V   S  +  K IVS  AD  +KVW + +  C  TL  
Sbjct: 569 TIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDA 628

Query: 430 HTE--WVNCVKLHPKSFTCYSSSDDKTLRMW 458
           H+   W   V    K F   ++  D   + W
Sbjct: 629 HSNRIWALSVLSDGKEFV--TADADGVFQFW 657

 Score = 36.2 bits (82), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 61/137 (44%), Gaps = 17/137 (12%)

Query: 491 VVDEK--IEKVPNPEL----EEDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSG 543
           VVDE   +E  P   L    E D   + T +   PN +Y   L   S    ++++++SS 
Sbjct: 36  VVDEVNIMELSPTKRLIHTIENDDEQEITALKLTPNGEY---LCFVSQAQLLRIYKLSSK 92

Query: 544 RCIRT-QFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI- 601
           + IR+ +      V D  + +  +  G  D S+ V D++NG    +F GH A I  V   
Sbjct: 93  KIIRSMKVSSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFH 152

Query: 602 GDSS-----FVSGDELG 613
           G+ S       SGD  G
Sbjct: 153 GEQSGSIWRLASGDTSG 169

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQ------KMITASLDKTIRVW 377
           L+  G  D +V + D ++G +     GH   +  + F  +      ++ +      ++VW
Sbjct: 115 LVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVW 174

Query: 378 NYITGSCISTYRGHQDSVLSVD 399
           + +  +CI T + H  +V  +D
Sbjct: 175 DLVRRNCIHTIQEHAAAVRGLD 196

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 395 VLSVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKS----FTCYSS 449
           V+  DS   ++     D +V V  +E+    ++ +GH   ++ VK H +     +   S 
Sbjct: 106 VMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASG 165

Query: 450 SDDKTLRMWDIRTNSCIKVFRGHVGQVQ 477
                +++WD+   +CI   + H   V+
Sbjct: 166 DTSGMVKVWDLVRRNCIHTIQEHAAAVR 193

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVWDI------AADNFRIVSGSHDKSIKVWDLQNGKC 585
           D ++ + ++ +G    +  GH   +  +      +   +R+ SG     +KVWDL    C
Sbjct: 122 DGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNC 181

Query: 586 IQTFTGHKAPI 596
           I T   H A +
Sbjct: 182 IHTIQEHAAAV 192

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 6/59 (10%)

Query: 308 FKGHMDGVLSLKFNHRL------LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360
           FKGH   + S+KF+         L +G     V +WD    N I  +  H   V+G+ F
Sbjct: 139 FKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDF 197

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 118/272 (43%), Gaps = 40/272 (14%)

Query: 342 GNLIRRLTGHTDGVKGIYFDDQKMI---TASLDKTIRVWNYITGSCISTYRGHQDSVLS- 397
           G L + L  H D +  +  + Q  +   TA+LD  I++W+  T  C+    GH+ +V + 
Sbjct: 270 GQLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTT 329

Query: 398 --VDSYKKIIVSASADKTVKVWHVESRT-----------CYTLRGHTEWVNCVKLHPKSF 444
             +D   +++ SA  D +VKVW V++               T  GH + V    L     
Sbjct: 330 RFIDD-TRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTA--LATTGN 386

Query: 445 TCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPEL 504
              S S+DKTLR WD+ +  CI+     +    K++P ++          K++  P+   
Sbjct: 387 AIVSGSNDKTLRHWDLGSGKCIQSIDLTIAL--KMVPQSV---------SKLDITPSFNT 435

Query: 505 EEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNF 564
                 DC             L++ + D  + LW++  GR + +  GH   +  +     
Sbjct: 436 PLIGGADCI---------DNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGS 486

Query: 565 RIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
            +++GS DKS ++WDL+ G   +  +  K  +
Sbjct: 487 ELITGSMDKSTRIWDLRMGSVAELLSFEKEVV 518

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 90/206 (43%), Gaps = 34/206 (16%)

Query: 308 FKGHMDGVLSLKFNHRLLF---TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQ 363
            K H D + SL  N +L     T + D+ + +WD  +   +  L+GH   V    F DD 
Sbjct: 276 LKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDDT 335

Query: 364 KMI-TASLDKTIRVW----------NYITGSCISTYRGHQDSVLSVDSYKKIIVSASADK 412
           +++ +A  D +++VW          N     C++T+ GH+DSV ++ +    IVS S DK
Sbjct: 336 RLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSNDK 395

Query: 413 TVKVWHVESRTC-------YTLRGHTEWVNCVKLHPKSFT------------CYSSSDDK 453
           T++ W + S  C         L+   + V+ + + P   T              + + D 
Sbjct: 396 TLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKDG 455

Query: 454 TLRMWDIRTNSCIKVFRGHVGQVQKV 479
            + +WD+R    +    GH G +  +
Sbjct: 456 IVYLWDLRIGRVVGSLEGHRGPITSL 481

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 97/219 (44%), Gaps = 37/219 (16%)

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSD-DKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTI 484
           TL+ H +++N + ++ +     S+++ D  +++WDI T  C+ V  GH   V       I
Sbjct: 275 TLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTT--RFI 332

Query: 485 KDTENLV-----VDEKIEKVPNPELEEDFADD--CTGIFDPNLKYPTHL-------LSCS 530
            DT  L         K+  V N   ++  A+D  C   FD +    T L       +S S
Sbjct: 333 DDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGS 392

Query: 531 LDNTIKLWEVSSGRCIRT--------QFGHVEGVWDI----------AAD--NFRIVSGS 570
            D T++ W++ SG+CI++                 DI           AD  +  +V+G+
Sbjct: 393 NDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGT 452

Query: 571 HDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSG 609
            D  + +WDL+ G+ + +  GH+ PI  +    S  ++G
Sbjct: 453 KDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELITG 491

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           L TG+ D  V +WD + G ++  L GH   +  + +   ++IT S+DK+ R+W+   GS 
Sbjct: 448 LVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDLRMGS- 506

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW 417
           ++     +  V+SV+  +  +++A   + VK++
Sbjct: 507 VAELLSFEKEVVSVEESQTQLINALEGEPVKIY 539

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 61/145 (42%), Gaps = 21/145 (14%)

Query: 295 ESNWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRL------ 348
           + N  +  C +  F GH D V +L      + +GS D T+  WD  SG  I+ +      
Sbjct: 359 DGNANDNLC-LATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIAL 417

Query: 349 --------------TGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDS 394
                         + +T  + G    D  ++T + D  + +W+   G  + +  GH+  
Sbjct: 418 KMVPQSVSKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGP 477

Query: 395 VLSVDSYKKIIVSASADKTVKVWHV 419
           + S+      +++ S DK+ ++W +
Sbjct: 478 ITSLKYMGSELITGSMDKSTRIWDL 502

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLT 349
           R GR  +   +GH   + SLK+    L TGS D +  IWD + G++   L+
Sbjct: 463 RIGRV-VGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDLRMGSVAELLS 512

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 84/166 (50%), Gaps = 10/166 (6%)

Query: 302 RCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           +  +QL +GH   V ++ F  +  LL +   D+  AIWD +SG  I +L GH   + G+ 
Sbjct: 288 KVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVD 347

Query: 360 F--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK----IIVSASADKT 413
           +  +  ++ TA  D T+RVW+       S    HQ + L V  +KK     +VS   D+ 
Sbjct: 348 WSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDV-KFKKNNGTFLVSCGHDRL 406

Query: 414 VKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
           V +++ ++ +   +L GHT+ V  V +     T YS   D++L+ W
Sbjct: 407 VNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 103/265 (38%), Gaps = 47/265 (17%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK--GIYFDDQKMITASLDKTIRVWN 378
           NH  L +G  D+ V +WD  S N    L GH   V    ++   +   +AS D T  +W+
Sbjct: 228 NH--LLSGGGDNLVKLWDMTS-NSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWD 284

Query: 379 YITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVN 435
                 +    GH  +V ++   S   ++ SA  D    +W + S      L GH   ++
Sbjct: 285 LERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAIS 344

Query: 436 CVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK 495
            V   P  +   ++  D T+R+WDIR          H     +V  L +K  +N      
Sbjct: 345 GVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAH-----QVAALDVKFKKN------ 393

Query: 496 IEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEG 555
                             G F         L+SC  D  + ++   + + + +  GH + 
Sbjct: 394 -----------------NGTF---------LVSCGHDRLVNIFNADNWQKLASLEGHTDR 427

Query: 556 VW--DIAADNFRIVSGSHDKSIKVW 578
           V+  DI  D   I SG  D+S+K W
Sbjct: 428 VFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 98/248 (39%), Gaps = 45/248 (18%)

Query: 358 IYFDDQKMITASLDKTIRVWNYIT-GSCISTYRGHQDSVLSVDSYK--KIIVSASADKTV 414
           ++ D Q++ T     +I+V +  T G   S    H+  +  +D +     ++S   D  V
Sbjct: 180 VHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLV 239

Query: 415 KVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG 474
           K+W + S +   LRGH   V+ VK+HP      S+S D T  +WD+     +++  GH  
Sbjct: 240 KLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSK 299

Query: 475 QVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNT 534
            V  +                            F  D              L S  LD  
Sbjct: 300 AVYTIA---------------------------FQSD-----------GALLASAGLDAV 321

Query: 535 IKLWEVSSGRCIRTQFGH---VEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTG 591
             +W++ SG  I    GH   + GV D + + +++ +   D +++VWD++N         
Sbjct: 322 CAIWDLRSGEPIMKLEGHAGAISGV-DWSPNGYQLATAGADGTVRVWDIRNVGTESALLA 380

Query: 592 HKAPIVCV 599
           H+   + V
Sbjct: 381 HQVAALDV 388

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 100/202 (49%), Gaps = 21/202 (10%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           +  GS D  + +++  +G  +     H D ++ +     +  +++AS D T+++WN+   
Sbjct: 70  IIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKN 129

Query: 383 SCIS-TYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHVESRTC-YTLRGHTE-WVNC 436
             +  T+ GH+  V+SV    K      +A  D TVK+W +   T  +TLR H E  VN 
Sbjct: 130 WALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNF 189

Query: 437 VKLHPKSFTCY--SSSDDKTLRMWDIRTNSCIKVFRGHVGQV-----QKVIPLTIKDTEN 489
           V  +P     Y  +SSDD+T+++WD +T SC+    GH+  V       ++P+ I  +E+
Sbjct: 190 VDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSED 249

Query: 490 LVVD------EKIEKVPNPELE 505
             V        K+E+  N  LE
Sbjct: 250 GTVKIWNSNTYKLERTLNLGLE 271

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 119/269 (44%), Gaps = 44/269 (16%)

Query: 330 YDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCIST 387
           Y     IW+ ++   +R ++     V+   F  +K  +I  S D  IRV+NY TG  +  
Sbjct: 33  YSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVD 92

Query: 388 YRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY--TLRGHTEWVNCVKLHPKS 443
           +  H D +  L+V   +  ++SAS D TVK+W+ E       T  GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKD 152

Query: 444 FTCYSSS-DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
              ++++  D T+++W +             GQ          +T N  +   +EK  N 
Sbjct: 153 PNTFATACLDHTVKIWSL-------------GQ----------ETSNFTLRAHLEKGVN- 188

Query: 503 ELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD 562
                F D     + P    P +L++ S D T+K+W+  +  C+ T  GH+  V      
Sbjct: 189 -----FVD-----YYPFQDKP-YLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYH 237

Query: 563 NFR--IVSGSHDKSIKVWDLQNGKCIQTF 589
                I+SGS D ++K+W+    K  +T 
Sbjct: 238 PMLPIIISGSEDGTVKIWNSNTYKLERTL 266

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 75/159 (47%), Gaps = 17/159 (10%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLIRRLTGHTD 353
           NW       Q F+GH   V+S+ FN +      T   D TV IW          L  H +
Sbjct: 125 NWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLE 184

Query: 354 GVKGIYF-------DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK---K 403
             KG+ F       D   +IT+S D+T++VW+Y T SC++T  GH  +V S   Y     
Sbjct: 185 --KGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNV-SYAVYHPMLP 241

Query: 404 IIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHP 441
           II+S S D TVK+W+  + +   TL    E   CV  HP
Sbjct: 242 IIISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHP 280

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 103/258 (39%), Gaps = 48/258 (18%)

Query: 346 RRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSY 401
           +     TD VKGI F   +  ++         +WNY T + + +    +  V +      
Sbjct: 7   KTFVSRTDRVKGIDFHPSEPWVLITLYSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPR 66

Query: 402 KKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           K  I+  S D  ++V++  +         H +++  + +HP      S+SDD T+++W+ 
Sbjct: 67  KSWIIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNW 126

Query: 461 RTNSCI-KVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN 519
             N  + + F GH                                 E F    T  F+P 
Sbjct: 127 EKNWALEQTFEGH---------------------------------EHFVMSVT--FNP- 150

Query: 520 LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVE-GVWDIAADNFR----IVSGSHDKS 574
            K P    +  LD+T+K+W +       T   H+E GV  +    F+    +++ S D++
Sbjct: 151 -KDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRT 209

Query: 575 IKVWDLQNGKCIQTFTGH 592
           +KVWD Q   C+ T  GH
Sbjct: 210 VKVWDYQTKSCVATLEGH 227

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/338 (23%), Positives = 139/338 (41%), Gaps = 86/338 (25%)

Query: 311 HMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRL-----TGHTDG--------- 354
           H   V  +KF  N   L TG  + T  I++  +GNL+  L     TG  D          
Sbjct: 317 HDSVVCCVKFSNNGEYLATGC-NKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLY 375

Query: 355 VKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASA 410
           ++ + F  D + + T + DK IR+W+      +   RGH+  + S+D ++    +VS S 
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSG 435

Query: 411 DKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVF 469
           D+T+++W + +  C       + V  V + P +    ++ S D+T+R+WD  +NS   V 
Sbjct: 436 DRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWD--SNSGFLVE 493

Query: 470 R---------GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL 520
           R         GH   V  V+    +D +N+V                             
Sbjct: 494 RLDSEGETGVGHKDSVYSVV--FTRDGKNIV----------------------------- 522

Query: 521 KYPTHLLSCSLDNTIKLWEV-------------SSGRCIRTQFGHVEGVWDIAA--DNFR 565
                  S SLD ++KLW +             + G C  T  GH + V  +    ++  
Sbjct: 523 -------SGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQY 575

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGD 603
           I+SGS D+ +  WD  +G  +    GH+  ++ V + +
Sbjct: 576 ILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVAN 613

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 6/100 (6%)

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDK 573
           F P+ K+   L + + D  I++W+++  + +    GH + ++  D      ++VSGS D+
Sbjct: 381 FSPDGKF---LATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDR 437

Query: 574 SIKVWDLQNGKCIQTFTGHKA-PIVCVGIGDSSFVSGDEL 612
           +I++WDL  G+C  T +       V V  G+ ++V+   L
Sbjct: 438 TIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSL 477

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 76.3 bits (186), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 89/179 (49%), Gaps = 22/179 (12%)

Query: 308 FKGHMDGVLSLKFNH---RLLFTGSYDSTVAIW-----DTKSGNLIRRLTGHTDGVKGIY 359
            +GH   V SL  +     LL + S D T+  W     D K G  ++   GH+  V+   
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDCT 72

Query: 360 FDDQKM--ITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVK 415
             +     ++ S DKT+R+W+  TG    T+ GH+  V+SV  D    +I+S S DK++K
Sbjct: 73  LTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIK 132

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPKS-----FTCYSSSDDKTLR-MWDIRTNSCIKV 468
           VW ++     TL GH +WV+ V++   S      T  S+ +DK ++ +W    NS  KV
Sbjct: 133 VWSIKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGNDKMVKVLW----NSAAKV 187

 Score = 66.6 bits (161), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 79/188 (42%), Gaps = 47/188 (25%)

Query: 426 TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMW-----DIRTNSCIKVFRGHVGQVQKV 479
           TL GH  WV  +     +     S+S DKTL  W     D +    +K F+GH   VQ  
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQ-- 69

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                                          DCT     N  Y    LS S D T++LW+
Sbjct: 70  -------------------------------DCT--LTENGAYA---LSGSWDKTLRLWD 93

Query: 540 VSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIV 597
           V++G   +T  GH   V  +A D     I+SGS DKSIKVW ++ G C+ T  GH   + 
Sbjct: 94  VATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSIK-GDCLATLIGHNDWVS 152

Query: 598 CVGIGDSS 605
            V I +SS
Sbjct: 153 QVRIANSS 160

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 90/237 (37%), Gaps = 64/237 (27%)

Query: 387 TYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESR------TCYTLRGHTEWVNCV 437
           T  GH   V S+ +      +++SAS DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE 497
            L        S S DKTLR+WD+ T    + F GH G V  V            +D+K  
Sbjct: 72  TLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSV-----------AIDKK-- 118

Query: 498 KVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW 557
                                     + ++S S D +IK+W +  G C+ T  GH + V 
Sbjct: 119 -------------------------ASMIISGSRDKSIKVWSI-KGDCLATLIGHNDWVS 152

Query: 558 DIAA-------DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFV 607
            +         D   ++S  +DK +KV  L N       +  K P+  +  GD  + 
Sbjct: 153 QVRIANSSDDDDKVTVISAGNDKMVKV--LWN-------SAAKVPMYTLSAGDEVYA 200

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 121/302 (40%), Gaps = 66/302 (21%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLF--TGSYDSTVAIWDTKSG----NLIRRLTGHTDGVKGI 358
           +++++GH D + SL      L+  T S D+T  +W         ++  +  GH+  V  +
Sbjct: 381 VEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAV 440

Query: 359 YFDD-------QKMITASLDKTIRVWNYITGSC--------ISTYRGHQD----SVLSVD 399
              +       + ++TAS D TI+ W     +         +S Y  H      + LSV 
Sbjct: 441 GLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVS 500

Query: 400 SYKKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
               I  +AS DKT K+W++E+     TL  H   +  V          +SS DKT+++W
Sbjct: 501 PNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIW 560

Query: 459 DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDP 518
            + T S +K   GH   VQ+                                 C+ I   
Sbjct: 561 SLDTFSVMKTLEGHTNAVQR---------------------------------CSFI--- 584

Query: 519 NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIK 576
                  L+SC  D  IK+W+ SSG C++T  GH   +W ++   D   IVS   D   +
Sbjct: 585 --NKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQ 642

Query: 577 VW 578
            W
Sbjct: 643 FW 644

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 104/253 (41%), Gaps = 64/253 (25%)

Query: 365 MITASLDKTIRVWNYITGSC----ISTYRGHQDSVLSV-------DSYKKIIVSASADKT 413
           + TAS D T  VW Y   SC     + Y GH  +V +V         Y + +++AS D T
Sbjct: 403 IATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLT 462

Query: 414 VKVWHVESRTC-----------YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           +K W +   T            YT   H + +N + + P      ++S DKT ++W++  
Sbjct: 463 IKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLE- 521

Query: 463 NSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL-K 521
                                                 N ELE   A+   G++D +  +
Sbjct: 522 --------------------------------------NGELEATLANHKRGLWDVSFCQ 543

Query: 522 YPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWD 579
           Y   L + S D T+K+W + +   ++T  GH   V   +  N +  ++S   D  IK+WD
Sbjct: 544 YDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWD 603

Query: 580 LQNGKCIQTFTGH 592
             +G+C++T  GH
Sbjct: 604 CSSGECLKTLDGH 616

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 66/331 (19%), Positives = 125/331 (37%), Gaps = 80/331 (24%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTD-----GVKGIYFDDQKMITASLDKTIRVW 377
           R+++T   D+   + D++SG++++R     +     GV  I  + Q  +  S D+T+++ 
Sbjct: 256 RIIYTAGGDAIFQLIDSESGSVLKRTNKPIEELFIIGVLPILSNSQMFLVLS-DQTLQLI 314

Query: 378 NY-----------ITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRT--- 423
           N               S I+   G    +  V      +  A+   ++++  V   +   
Sbjct: 315 NVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVGPELNKLALATNSPSLRIIPVPDLSGPE 374

Query: 424 ------CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC-IKVFRGHVGQV 476
                      GH + +N +          ++S D T  +W    NSC   ++  ++G  
Sbjct: 375 ASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHS 434

Query: 477 QKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL---KYPTHLLSCSLDN 533
             V                                 T +  PN+    YP  LL+ S D 
Sbjct: 435 AAV---------------------------------TAVGLPNIVSKGYPEFLLTASNDL 461

Query: 534 TIKLWEVSSG------RCIR----TQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQ 581
           TIK W +         + I+    T+  H + +    ++ ++    + S+DK+ K+W+L+
Sbjct: 462 TIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLE 521

Query: 582 NGKCIQTFTGHKAPIVCVGIGDSSFVSGDEL 612
           NG+   T   HK      G+ D SF   D+L
Sbjct: 522 NGELEATLANHKR-----GLWDVSFCQYDKL 547

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 30/166 (18%), Positives = 71/166 (42%), Gaps = 16/166 (9%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDS-VLSVDSYKKIIVSASADKTVKVWHV 419
           D Q +   S  + +++++  TG  + + +    S +L  DS   ++     D ++ V  +
Sbjct: 72  DGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVGGTDGSIIVVDI 131

Query: 420 ES-RTCYTLRGHTEWVNCVK----LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG 474
           E+    ++ +GH   ++ +K    L+ K +   S   +  +++WD+    C+   + H  
Sbjct: 132 ENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTS 191

Query: 475 QVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL 520
            V+ +  + + D +           P+  L     DD   ++D N+
Sbjct: 192 AVRGLDIIEVPDNDE----------PSLNLLSGGRDDIINLWDFNM 227

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 496 IEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT-QFGHVE 554
           + K+ N + +E  A   T    P+ +Y T++    L   +K++ + +G+ +R+ +     
Sbjct: 53  LHKISNEDEQEITALKLT----PDGQYLTYVSQAQL---LKIFHLKTGKVVRSMKISSPS 105

Query: 555 GVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
            + D  + +  +  G  D SI V D++NG    +F GH   I
Sbjct: 106 YILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTI 147

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 14/86 (16%)

Query: 308 FKGHMDGVLSLKFNHRL------LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF- 360
           FKGH   + SLKF  +L      L +G  +  V +WD      +  L  HT  V+G+   
Sbjct: 140 FKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDII 199

Query: 361 ----DDQ---KMITASLDKTIRVWNY 379
               +D+    +++   D  I +W++
Sbjct: 200 EVPDNDEPSLNLLSGGRDDIINLWDF 225

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 114/281 (40%), Gaps = 68/281 (24%)

Query: 350 GHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGS----CISTYRGHQDSVLSV----- 398
           GH+D +  +    D Q + TAS DKT  +W++   S      +T+ GH  SV +V     
Sbjct: 388 GHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNV 447

Query: 399 --DSYKKIIVSASADKTVKVWHVE-------------SRTCYTLRGHTEWVNCVKLHPKS 443
              +Y K I++AS D TVK W +                + YT   H + +N + + P  
Sbjct: 448 MEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPND 507

Query: 444 FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPE 503
               ++S DKT ++W++ T   +     H                               
Sbjct: 508 SIFATASYDKTCKLWNVDTGEPVATLANHK------------------------------ 537

Query: 504 LEEDFADDCTGIFDPNL-KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD 562
                     G++D +  +    + +CS D T+K+W + S   ++T  GH   V   +  
Sbjct: 538 ---------RGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFM 588

Query: 563 N--FRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           N   ++VS   D  IKVWD+ +G CI+   GH   I  + +
Sbjct: 589 NKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSV 629

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/305 (23%), Positives = 118/305 (38%), Gaps = 68/305 (22%)

Query: 304 RIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIW----DTKSGNLIRRLTGHTDGVKG 357
            + L++GH D + SL      + L T S D T  +W     +K   +     GH   V  
Sbjct: 382 EVNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSA 441

Query: 358 IYFDD-------QKMITASLDKTIRVWN------------YITGSCISTYRGHQDSV--L 396
           +   +       + +ITAS D T++ W             +I  S I T   H+  +  +
Sbjct: 442 VCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAI 501

Query: 397 SVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTL 455
           S+     I  +AS DKT K+W+V++     TL  H   +  V          + S DKT+
Sbjct: 502 SMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTV 561

Query: 456 RMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGI 515
           ++W + + + +K   GH   VQ+                                 C+  
Sbjct: 562 KIWSLESFTVLKTLEGHTNAVQR---------------------------------CSF- 587

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDK 573
               +     L+S   D  IK+W+++SG CI+   GH   +W ++   D   I+S   D 
Sbjct: 588 ----MNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADS 643

Query: 574 SIKVW 578
             + W
Sbjct: 644 VFQFW 648

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 106/254 (41%), Gaps = 40/254 (15%)

Query: 289 RERFQVESNWRNGRCRIQL---FKGHMDGVLSL-------KFNHRLLFTGSYDSTVAIWD 338
           +++  +  +W N   R  +   F GH   V ++       K   + + T S D TV  W+
Sbjct: 410 KDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWE 469

Query: 339 --------------TKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITG 382
                          KS    R    H   +  I    +D    TAS DKT ++WN  TG
Sbjct: 470 IPPMKNDLNEVPFIVKSSIYTRH--AHEKDINAISMAPNDSIFATASYDKTCKLWNVDTG 527

Query: 383 SCISTYRGHQDSVLSVD--SYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKL 439
             ++T   H+  +  V     +K I + S DKTVK+W +ES T   TL GHT  V     
Sbjct: 528 EPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSF 587

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKV 499
             K     S+  D  +++WDI +  CIK   GH     ++  L++ +  +L++    + V
Sbjct: 588 MNKQKQLVSAGADGLIKVWDIASGDCIKNLDGH---SNRIWALSVLEDGDLIISADADSV 644

Query: 500 PNPELEEDFADDCT 513
                   F  DCT
Sbjct: 645 ------FQFWKDCT 652

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 53/115 (46%), Gaps = 22/115 (19%)

Query: 509 ADDCTGIFDPNL---KYPTHLLSCSLDNTIKLWEVSSGR------------CIRTQFGHV 553
           A   + +  PN+    YP ++++ S D T+K WE+   +             I T+  H 
Sbjct: 436 AASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHE 495

Query: 554 EGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSF 606
           + +  I  A ++    + S+DK+ K+W++  G+ + T   HK      G+ D SF
Sbjct: 496 KDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKR-----GLWDVSF 545

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 12/84 (14%)

Query: 308 FKGHMDGVLSLKF------NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF- 360
           FKGH   + SLKF      N  LL +G  +    +WD  +      +  H+  ++GI F 
Sbjct: 141 FKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFT 200

Query: 361 --DDQ---KMITASLDKTIRVWNY 379
             DD+    +IT   D  + +W +
Sbjct: 201 KNDDKDVLNLITGGRDNVLNLWRF 224

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 52/114 (45%), Gaps = 11/114 (9%)

Query: 491 VVDEK--IEKVPNPELEE--DFADD--CTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSG 543
           V+DE   I+ +PN +L    D AD+   TGI   P+ KY   L+  S    +K+  V +G
Sbjct: 38  VLDEINIIQLIPNRKLLHSIDNADEQEITGISLTPDGKY---LIYVSQSQLVKIVNVETG 94

Query: 544 RCIRT-QFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
              R+ +      V      +  +  G  D SI V D++NG    +F GH   I
Sbjct: 95  VITRSLKVSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTI 148

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 121/277 (43%), Gaps = 50/277 (18%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           + T  Y   V +W+ ++   +R +      V+   F  +K  +I  S D  IRV+NY TG
Sbjct: 28  VLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTG 87

Query: 383 SCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY--TLRGHTEWVNCVK 438
             +  +  H D +  ++V   K  ++S S D TVK+W+ E+      T  GH  +V CV 
Sbjct: 88  EKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVA 147

Query: 439 LHPKSFTCYSSS-DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE 497
            +PK  + ++S   D+T+++W +             GQ      LT      +     ++
Sbjct: 148 FNPKDPSTFASGCLDRTVKVWSL-------------GQSTPNFTLTTGQERGV---NYVD 191

Query: 498 KVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW 557
             P P+                     ++++ S D TIK+W+  +  C+ T  GH+    
Sbjct: 192 YYPLPD-------------------KPYMITASDDLTIKIWDYQTKSCVATLEGHMS--- 229

Query: 558 DIAADNFR-----IVSGSHDKSIKVWDLQNGKCIQTF 589
           +++   F      I+SGS D ++K+W+    K  +T 
Sbjct: 230 NVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTL 266

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 78/165 (47%), Gaps = 11/165 (6%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDT-KSGNLIRRLTGHT 352
           NW N     Q F+GH   V+ + FN +      +G  D TV +W   +S       TG  
Sbjct: 125 NWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQE 184

Query: 353 DGVKGIYF----DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIV 406
            GV  + +    D   MITAS D TI++W+Y T SC++T  GH  +V     +    II+
Sbjct: 185 RGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIII 244

Query: 407 SASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSS 450
           S S D T+K+W+  + +   TL    E   C+  HP     Y +S
Sbjct: 245 SGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIAS 289

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 95/202 (47%), Gaps = 21/202 (10%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           +  GS D  + +++  +G  +     H D ++ I     K  +++ S D T+++WN+   
Sbjct: 70  IIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENN 129

Query: 383 SCIS-TYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHV-ESRTCYTLR-GHTEWVNC 436
             +  T+ GH+  V+ V    K      S   D+TVKVW + +S   +TL  G    VN 
Sbjct: 130 WALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNY 189

Query: 437 VKLHPKSFTCY--SSSDDKTLRMWDIRTNSCIKVFRGHVGQV-----QKVIPLTIKDTEN 489
           V  +P     Y  ++SDD T+++WD +T SC+    GH+  V        +P+ I  +E+
Sbjct: 190 VDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSED 249

Query: 490 LVVD------EKIEKVPNPELE 505
             +        K+EK  N  LE
Sbjct: 250 GTLKIWNSSTYKVEKTLNVGLE 271

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 106/262 (40%), Gaps = 48/262 (18%)

Query: 346 RRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSY 401
           +  +  +D VKGI F   +  ++T      + +WNY T   + + +  +  V +    + 
Sbjct: 7   KTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIAR 66

Query: 402 KKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           K  I+  S D  ++V++  +         H +++  + +HP      S SDD T+++W+ 
Sbjct: 67  KNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNW 126

Query: 461 RTNSCI-KVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN 519
             N  + + F GH               E+ V+                   C   F+P 
Sbjct: 127 ENNWALEQTFEGH---------------EHFVM-------------------CVA-FNP- 150

Query: 520 LKYPTHLLSCSLDNTIKLWEVS-SGRCIRTQFGHVEGV----WDIAADNFRIVSGSHDKS 574
            K P+   S  LD T+K+W +  S        G   GV    +    D   +++ S D +
Sbjct: 151 -KDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLT 209

Query: 575 IKVWDLQNGKCIQTFTGHKAPI 596
           IK+WD Q   C+ T  GH + +
Sbjct: 210 IKIWDYQTKSCVATLEGHMSNV 231

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 48/90 (53%), Gaps = 6/90 (6%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQNG 583
           ++  S D  I+++  ++G  +     H + +  IA    +  ++SGS D ++K+W+ +N 
Sbjct: 70  IIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENN 129

Query: 584 KCI-QTFTGHKAPIVCVGIG---DSSFVSG 609
             + QTF GH+  ++CV       S+F SG
Sbjct: 130 WALEQTFEGHEHFVMCVAFNPKDPSTFASG 159

>Scas_679.28
          Length = 815

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 108/274 (39%), Gaps = 72/274 (26%)

Query: 350 GHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYR------GHQDSVLSVD-- 399
           GH D +  +   D    M TAS D T  VW Y   S I+ ++      GH  +V +V   
Sbjct: 384 GHEDLLNSLDTTDDGLWMATASKDHTAIVWKY--NSIINKFQPYVKFIGHSATVTAVGLP 441

Query: 400 -----SYKKIIVSASADKTVKVWHVESRTC-------------YTLRGHTEWVNCVKLHP 441
                 Y + +++AS D T+K W +   +              YT R H + +N + + P
Sbjct: 442 NVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISP 501

Query: 442 KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPN 501
                 ++S DKT ++WD+                                        N
Sbjct: 502 NDSIFATASYDKTCKIWDLE---------------------------------------N 522

Query: 502 PELEEDFADDCTGIFDPNL-KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA 560
            EL    ++   G++D    +Y   + +CS D TIK+W + +   ++T  GH   V    
Sbjct: 523 GELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCM 582

Query: 561 ADN--FRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
             N   ++VS   D  IK+WD   G C++T  GH
Sbjct: 583 FINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGH 616

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 85/345 (24%), Positives = 136/345 (39%), Gaps = 80/345 (23%)

Query: 266 PNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKFNHRLL 325
           PN    A A NS    R   V   E+ ++  N       +++++GH D + SL      L
Sbjct: 348 PNHDKLALATNSPTL-RIIPVPSSEQEELPIN-------VEMYEGHEDLLNSLDTTDDGL 399

Query: 326 F--TGSYDSTVAIWDTKSGNLIRRL------TGHTDGVKGIYFDD-------QKMITASL 370
           +  T S D T  +W  K  ++I +        GH+  V  +   +       + ++TAS 
Sbjct: 400 WMATASKDHTAIVW--KYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYPEFLLTASN 457

Query: 371 DKTIRVWNYITGSC----------ISTY--RGHQDSV--LSVDSYKKIIVSASADKTVKV 416
           D TI+ W     S           +S Y  R H+  +  L++     I  +AS DKT K+
Sbjct: 458 DLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATASYDKTCKI 517

Query: 417 WHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQ 475
           W +E+     TL  H   +  V          + S DKT+++W + T S +K   GH   
Sbjct: 518 WDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNA 577

Query: 476 VQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTI 535
           VQ+ + +                  N +L+                    L+S   D  I
Sbjct: 578 VQRCMFI------------------NKQLQ--------------------LVSSGADGLI 599

Query: 536 KLWEVSSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIKVW 578
           K+W+ S+G C++T  GH   +W +    D   IVS   D   + W
Sbjct: 600 KIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFW 644

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 92/415 (22%), Positives = 155/415 (37%), Gaps = 121/415 (29%)

Query: 308 FKGHMDGVLSLKF------NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF- 360
            KGH   + +LKF      N  LL +G  +  V +WD      +  +  H++ V+G+   
Sbjct: 144 LKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVR 203

Query: 361 ---DDQKMITASLDKTIRVWNY-ITGSC--ISTYRGHQDSVLSVDS-------YKKIIVS 407
              D+ ++I+   D    +WN+ +   C  + T   HQ     V+S       +  +I +
Sbjct: 204 EVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTIPVHQ----QVESCGFINHEHDDLIYT 259

Query: 408 ASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHP--KSFTCYSSSDDKTLRMWDIRTN- 463
           A  D  ++   +E  T     + H E +  + + P  ++   Y    D+TL + DI++N 
Sbjct: 260 AGGDALLQFISLEKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNL 319

Query: 464 -----------SCIKVFRGHVGQVQKVIPLTIKDTENLVVDE---KIEKVPNPELEE--- 506
                      SCI    G +  ++ V P    D   L  +    +I  VP+ E EE   
Sbjct: 320 LNESSDIIEIESCIAGNNGTIADMKFVGP--NHDKLALATNSPTLRIIPVPSSEQEELPI 377

Query: 507 ---------------DFADD-------------------------------------CTG 514
                          D  DD                                      T 
Sbjct: 378 NVEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTA 437

Query: 515 IFDPNLK---YPTHLLSCSLDNTIKLWEVSSGRCI------------RTQFGHVEGV--W 557
           +  PN+    YP  LL+ S D TIK W++                   T+  H + +   
Sbjct: 438 VGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINAL 497

Query: 558 DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGDEL 612
            I+ ++    + S+DK+ K+WDL+NG+   T + HK      G+ D +F   D+L
Sbjct: 498 AISPNDSIFATASYDKTCKIWDLENGELTATLSNHKR-----GLWDVAFCQYDKL 547

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 92/199 (46%), Gaps = 27/199 (13%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD- 361
           +   KGH   + SL +  +   L +GS D TV IWD  +G     L+   DGV  +    
Sbjct: 441 VMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIE-DGVTTVAVSP 499

Query: 362 -DQKMITA-SLDKTIRVWNYITGSCISTY-------RGHQDSVLSVDSYK--KIIVSASA 410
            + K I A SLD+T+RVW+  TG  +           GH+DSV SV   +  K +VS S 
Sbjct: 500 GEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSL 559

Query: 411 DKTVKVW----------HVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           D++VK+W          H E    YT  GH ++V  V          S S D+ +  WD 
Sbjct: 560 DRSVKLWNLNGLSGQKSHAECEVTYT--GHKDFVLSVATTQNDEYILSGSKDRGVLFWDT 617

Query: 461 RTNSCIKVFRGHVGQVQKV 479
           ++ + + + +GH   V  V
Sbjct: 618 KSGNPLLMLQGHRNSVISV 636

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 106/229 (46%), Gaps = 35/229 (15%)

Query: 403 KIIVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR 461
           K + + + DK +++W +E++    TL+GH + +  +   P      S S D+T+R+WD+ 
Sbjct: 419 KFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLT 478

Query: 462 TNSC------------IKVFRGH-----VGQVQKVIPLTIKDTENLVVDEKIEKVPNPEL 504
           T +C            + V  G       G + + + +   DT  LV  E+++     EL
Sbjct: 479 TGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLV--ERLDS--ENEL 534

Query: 505 EEDFADDC-TGIFDPNLKYPTHLLSCSLDNTIKLWEV-------SSGRCIRTQFGHVEGV 556
                D   + +F  + K    ++S SLD ++KLW +       S   C  T  GH + V
Sbjct: 535 GTGHRDSVYSVVFTRDGK---GVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFV 591

Query: 557 WDIAA--DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGD 603
             +A   ++  I+SGS D+ +  WD ++G  +    GH+  ++ V + +
Sbjct: 592 LSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVTVAN 640

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 114/286 (39%), Gaps = 71/286 (24%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YF-DDQKMITASLDKTIRVWNYI 380
           + L TG+ D  + IWD ++  ++  L GH   +  + YF    K+++ S D+T+R+W+  
Sbjct: 419 KFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLT 478

Query: 381 TGSCISTYRGHQDSVLSV---DSYKKIIVSASADKTVKVWHVESRTCYTLR--------- 428
           TG+C S     +D V +V       K I + S D+TV+VW  +S T + +          
Sbjct: 479 TGTC-SLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVW--DSDTGFLVERLDSENELG 535

Query: 429 -GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS-------CIKVFRGHVGQVQKVI 480
            GH + V  V          S S D+++++W++   S       C   + GH     K  
Sbjct: 536 TGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGH-----KDF 590

Query: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV 540
            L++  T+N   DE                              ++LS S D  +  W+ 
Sbjct: 591 VLSVATTQN---DE------------------------------YILSGSKDRGVLFWDT 617

Query: 541 SSGRCIRTQFGHVEGVWDIAADNFR--------IVSGSHDKSIKVW 578
            SG  +    GH   V  +   N            +GS D   ++W
Sbjct: 618 KSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDK 573
           F P+ K+   L + + D  I++W++ + + + T  GH + ++  D      ++VSGS D+
Sbjct: 414 FSPDGKF---LATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDR 470

Query: 574 SIKVWDLQNGKCIQTFTGHKA-PIVCVGIGDSSFVSGDEL 612
           ++++WDL  G C  T +       V V  G+  F++   L
Sbjct: 471 TVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSL 510

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 81/193 (41%), Gaps = 30/193 (15%)

Query: 433 WVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV 492
           ++  V   P      + ++DK +R+WD+ T   +   +GH    Q +  L    + N +V
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGH---EQDIYSLDYFPSGNKLV 464

Query: 493 DEKIEK--------VPNPELEEDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSG 543
               ++             L     D  T +   P       + + SLD T+++W+  +G
Sbjct: 465 SGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEG--KFIAAGSLDRTVRVWDSDTG 522

Query: 544 RCI-------RTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDL-------QNGKCIQ 587
             +           GH + V+ +    D   +VSGS D+S+K+W+L        + +C  
Sbjct: 523 FLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEV 582

Query: 588 TFTGHKAPIVCVG 600
           T+TGHK  ++ V 
Sbjct: 583 TYTGHKDFVLSVA 595

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 40/89 (44%), Gaps = 11/89 (12%)

Query: 301 GRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358
             C +  + GH D VLS+    N   + +GS D  V  WDTKSGN +  L GH + V  +
Sbjct: 578 AECEV-TYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISV 636

Query: 359 YFDDQKMI--------TASLDKTIRVWNY 379
              +   +        T S D   R+W Y
Sbjct: 637 TVANGHPLGPEYGVFATGSGDCKARIWKY 665

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 85/176 (48%), Gaps = 17/176 (9%)

Query: 307 LFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV-KGIYFDDQKM 365
           L  GH   V +L+     L + S+D T  +W  + G   R L+GH   V   +     + 
Sbjct: 103 LLAGHSGNVCALEARDGQLVSSSWDQTARVW--REGTEERALSGHNATVWHALALGYDRF 160

Query: 366 ITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRT 423
           +TAS DKTI++W+      ++TY  H D V  L++        S S D +VKV  ++ +T
Sbjct: 161 LTASADKTIKLWD--GARDLATYNVHTDVVRHLALAPDGHHFASCSNDGSVKVHTLDGKT 218

Query: 424 CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
             T  GH  +V CVK  P      S  +DKT+R+WD+          GHV QV ++
Sbjct: 219 VRTFDGHESFVYCVKYLPDG-GLVSCGEDKTVRVWDM---------SGHVRQVIRL 264

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 107/273 (39%), Gaps = 67/273 (24%)

Query: 344 LIRRLTGHTDGVKGIY-FDDQKMITASLDKTIRVWNYIT-------GSCISTYRGHQDSV 395
           L   L GH+  VK +    D ++ + S D T+RVW   T       G+ + +   + ++V
Sbjct: 10  LSSSLLGHSMDVKSVVAISDTQIASGSRDGTVRVWTRDTSDSRLWSGAILHSTERYVNAV 69

Query: 396 -------LSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYS 448
                  L     ++ ++ A +   ++V        Y L GH+   N   L  +     S
Sbjct: 70  CYEENEQLVFFGGQEAVIGAVSPLVLEV----QDASYLLAGHSG--NVCALEARDGQLVS 123

Query: 449 SSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDF 508
           SS D+T R+W  R  +  +   GH   V   + L                          
Sbjct: 124 SSWDQTARVW--REGTEERALSGHNATVWHALALG------------------------- 156

Query: 509 ADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRI 566
                  +D         L+ S D TIKLW+    R + T   H + V    +A D    
Sbjct: 157 -------YD-------RFLTASADKTIKLWD--GARDLATYNVHTDVVRHLALAPDGHHF 200

Query: 567 VSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            S S+D S+KV  L +GK ++TF GH++ + CV
Sbjct: 201 ASCSNDGSVKVHTL-DGKTVRTFDGHESFVYCV 232

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 116/312 (37%), Gaps = 49/312 (15%)

Query: 163 ELSLKILGY-LDCQSLC------IASL----TCKRWKTLADDDRVW----YHMCEQHIDR 207
           ELS  +LG+ +D +S+       IAS     T + W     D R+W     H  E++++ 
Sbjct: 9   ELSSSLLGHSMDVKSVVAISDTQIASGSRDGTVRVWTRDTSDSRLWSGAILHSTERYVNA 68

Query: 208 KCPNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGNEIGGGKSLINPGNSPN 267
            C      L     + A    V+   +  Q+ +    +A  +GN                
Sbjct: 69  VCYEENEQLVFFGGQEAVIGAVSPLVLEVQDASYL--LAGHSGN---------------- 110

Query: 268 QTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVL-SLKFNHRLLF 326
              A  AR+ +  +  W        Q    WR G    +   GH   V  +L   +    
Sbjct: 111 -VCALEARDGQLVSSSWD-------QTARVWREG-TEERALSGHNATVWHALALGYDRFL 161

Query: 327 TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSC 384
           T S D T+ +WD      +     HTD V+ +    D     + S D +++V + + G  
Sbjct: 162 TASADKTIKLWDGARD--LATYNVHTDVVRHLALAPDGHHFASCSNDGSVKV-HTLDGKT 218

Query: 385 ISTYRGHQDSVLSVDSYKKI-IVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKS 443
           + T+ GH+  V  V       +VS   DKTV+VW +       +R     +  + + P  
Sbjct: 219 VRTFDGHESFVYCVKYLPDGGLVSCGEDKTVRVWDMSGHVRQVIRLCATSLWSLDVLPNG 278

Query: 444 FTCYSSSDDKTL 455
                 SD K L
Sbjct: 279 DIVVGGSDGKIL 290

>Kwal_23.6240
          Length = 913

 Score = 75.1 bits (183), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 128/300 (42%), Gaps = 43/300 (14%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QK 364
           +GH D   ++ +  +   + T S D  + IWD  SG  +     HT  V  + F    Q 
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQV 397

Query: 365 MITASLDKTIRVWNYITGSCISTYRGH---QDSVLSVDSYKKIIVSASADK-TVKVWHVE 420
           + +ASLD T+R W+ +      T+      Q + L+ D   +++ + S D   V VW V+
Sbjct: 398 LFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQ 457

Query: 421 S-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           + +   TL GH   V+C+    ++    S+S DKT+R+W I             G+ Q+V
Sbjct: 458 TGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSI------------FGRSQQV 505

Query: 480 IPLTI-KDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLW 538
            PL +  D  +L V     +V    L     D     FD +     + +    D      
Sbjct: 506 EPLEVYADVLSLSVRPDGNEVAAATL-----DGQILFFDVHEGKQVNAIDGKKD------ 554

Query: 539 EVSSGRCIRTQFG--------HVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
            + SGR +  +F         H   + D + D   IV+  ++ SI ++D+ N   ++ FT
Sbjct: 555 -ILSGRHLEDRFTSQNSARSKHFTTI-DYSFDGLSIVAAGNNNSICLYDIPNSVLLKRFT 612

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 134/331 (40%), Gaps = 48/331 (14%)

Query: 303 CRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKS---GNLIRRLTGHTDGVKG 357
            R ++  GH   ++SL +  + R L + S D T  IW   S   G       GH D V G
Sbjct: 137 VRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMG 196

Query: 358 IYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVK 415
            +F  D +++ T S D  +  W Y       +    +++ +              D ++ 
Sbjct: 197 AFFSADQERIYTVSKDGAVFQWEYTPRPGFESPEQDEETEI--------------DPSLY 242

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQ 475
            W +  +  +        V CV  H  S T     ++   R++++   + I+     +GQ
Sbjct: 243 SWRITKKNYF--YASQARVKCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLS--MGQ 298

Query: 476 VQKVIPLTIKDTENLVV--DEKIEKVPNPELE-EDFADDCTGIFDPN--LKYP---THLL 527
              V  + + D+   +     K+ ++   E + E +     G FD    + Y    + ++
Sbjct: 299 -NAVNTVCVNDSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVV 357

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIV-SGSHDKSIKVWDLQNGKC 585
           + S D  IK+W+V SG C+ T   H   V  +A A   +++ S S D +++ WDL   + 
Sbjct: 358 TASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRN 417

Query: 586 IQTFTGHK------------APIVCVGIGDS 604
            +TFT  +              +VC G  DS
Sbjct: 418 FRTFTAAERIQFNCLAADPSGEVVCAGSVDS 448

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 79/195 (40%), Gaps = 49/195 (25%)

Query: 414 VKVWHVESRTCYTLR--GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
           V  W  ES   Y L+  GH +  N V   P      ++S+D  +++WD+ +  C+  F+ 
Sbjct: 325 VYEWQSES---YILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQE 381

Query: 472 HVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSL 531
           H   V  +                            FA           K    L S SL
Sbjct: 382 HTAAVSALA---------------------------FA-----------KRGQVLFSASL 403

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVWD--IAAD--NFRIVSGSHDK-SIKVWDLQNGKCI 586
           D T++ W++   R  RT F   E +    +AAD     + +GS D  ++ VW +Q G+ +
Sbjct: 404 DGTVRAWDLVRYRNFRT-FTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQTGQLV 462

Query: 587 QTFTGHKAPIVCVGI 601
           +T  GH+ P+ C+  
Sbjct: 463 ETLDGHEGPVSCLSF 477

>Scas_629.12
          Length = 671

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 94/208 (45%), Gaps = 31/208 (14%)

Query: 302 RCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           R  + + KGH   V SL +  N   L +GS D TV IWD ++G     L+    GV  + 
Sbjct: 419 RKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEY-GVTTVA 477

Query: 360 F--DDQKMITA-SLDKTIRVWNYITGSCISTY-------RGHQDSVLSVDSYK--KIIVS 407
              +D K I A SLD+ +RVW+  TG  +           GH+DSV SV   +    +VS
Sbjct: 478 VSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVS 537

Query: 408 ASADKTVKVWHVE---------------SRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSD 451
            S DKTVK+W++                S TC  T  GH ++V  V          S S 
Sbjct: 538 GSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSK 597

Query: 452 DKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           D+ +  WD  + + + + +GH   V  V
Sbjct: 598 DRGILFWDKESGNPLLMLQGHRNSVISV 625

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 118/303 (38%), Gaps = 63/303 (20%)

Query: 359 YFDDQKMITASLDKTIRVWNYITGSCIS-----------TYRGHQDSVLSVDSY------ 401
           + +D + +    +KT +++    G  I+           T      S  S D Y      
Sbjct: 336 FSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCF 395

Query: 402 ---KKIIVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
               + + + + DK +++W ++ R     L+GH + V  +   P      S S D+T+R+
Sbjct: 396 SPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRI 455

Query: 458 WDIRTNSCIKVFRGHVGQVQKVI---------------PLTIKDTENLVVDEKIEKVPNP 502
           WD+RT  C        G     +                + + D+    + E+++     
Sbjct: 456 WDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDS--EN 513

Query: 503 ELEEDFADDCTGIF---DPNLKYPTHLLSCSLDNTIKLWEV---------------SSGR 544
           EL     D    +    D N      ++S SLD T+KLW +               +S  
Sbjct: 514 ELGTGHRDSVYSVVFTRDGN-----EVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASAT 568

Query: 545 CIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIG 602
           C  T  GH + V  +  + D+  I+SGS D+ I  WD ++G  +    GH+  ++ V + 
Sbjct: 569 CEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVA 628

Query: 603 DSS 605
           + S
Sbjct: 629 NGS 631

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 111/279 (39%), Gaps = 49/279 (17%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDD-QKMITASLDKTIRVWNYI 380
             L TG+ D  + IWD +   ++  L GH   V  + YF + +K+++ S D+T+R+W+  
Sbjct: 400 EFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLR 459

Query: 381 TGSC---ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLR--------- 428
           TG C   +S   G     +S +   K I + S D+ V+VW  +S T + +          
Sbjct: 460 TGQCSLTLSIEYGVTTVAVSPND-GKFIAAGSLDRAVRVW--DSTTGFLVERLDSENELG 516

Query: 429 -GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDT 487
            GH + V  V          S S DKT+++W++R +          G       +T    
Sbjct: 517 TGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGH 576

Query: 488 ENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIR 547
           ++ V+     +           DD             ++LS S D  I  W+  SG  + 
Sbjct: 577 KDFVLSVTTSQ-----------DD------------KYILSGSKDRGILFWDKESGNPLL 613

Query: 548 TQFGHVEGVWDIAADNFR--------IVSGSHDKSIKVW 578
              GH   V  +A  N            +GS D   ++W
Sbjct: 614 MLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 53/100 (53%), Gaps = 6/100 (6%)

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDK 573
           F P+ ++   L + + D  I++W++   + +    GH + V+  D   +  ++VSGS D+
Sbjct: 395 FSPDGEF---LATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDR 451

Query: 574 SIKVWDLQNGKCIQTFT-GHKAPIVCVGIGDSSFVSGDEL 612
           ++++WDL+ G+C  T +  +    V V   D  F++   L
Sbjct: 452 TVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSL 491

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 64/169 (37%), Gaps = 67/169 (39%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNH-RLLFTGSYDSTVAIWDTKSGNLIRRL------- 348
           + R G+C + L   +    +++  N  + +  GS D  V +WD+ +G L+ RL       
Sbjct: 457 DLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELG 516

Query: 349 TGHTDGVKGIYF--DDQKMITASLDKTIRVWNY---------------ITGSCISTYRGH 391
           TGH D V  + F  D  ++++ SLDKT+++WN                 + +C  TY GH
Sbjct: 517 TGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGH 576

Query: 392 QD------------------------------------------SVLSV 398
           +D                                          SV+SV
Sbjct: 577 KDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISV 625

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 120/274 (43%), Gaps = 44/274 (16%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           + T  Y   V IW+ ++   +R +      V+   F  +K  ++  S D  +RV+NY TG
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTG 87

Query: 383 SCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY--TLRGHTEWVNCVK 438
             ++ +  H D +  ++V   K  I++ S D TVK+W+ E+      T +GH  +V CV 
Sbjct: 88  EKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVA 147

Query: 439 LHPKSFTCYSSS-DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE 497
            +PK    ++S   D  +++W +        F  H GQ + V                ++
Sbjct: 148 FNPKDPNVFASGCLDHKVKVWSL--GQSTPNFTLHTGQEKGV--------------NYVD 191

Query: 498 KVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV- 556
             P P+                     ++++ S D T+K+++  +  C+ T  GH+  V 
Sbjct: 192 YYPLPD-------------------KPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVS 232

Query: 557 WDIAADNFRIV-SGSHDKSIKVWDLQNGKCIQTF 589
           + +      I+ SGS D ++K+W+    K  +T 
Sbjct: 233 FAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTL 266

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 108/247 (43%), Gaps = 48/247 (19%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           +  GS D+ V +++  +G  +     H D ++ I     K  ++T S D T+++WN+   
Sbjct: 70  IVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWEND 129

Query: 383 -SCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHV-ESRTCYTLR-GHTEWVNC 436
            S   T++GH+  V+ V    K   +  S   D  VKVW + +S   +TL  G  + VN 
Sbjct: 130 WSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQEKGVNY 189

Query: 437 VKLHPKSFTCY--SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDE 494
           V  +P     Y  +SSDD T++++D +T SC+    GH+  V                  
Sbjct: 190 VDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVS----------------- 232

Query: 495 KIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVE 554
                        FA     +F P L     ++S S D T+KLW  S+ +  +T    +E
Sbjct: 233 -------------FA-----VFHPTLPI---IISGSEDGTVKLWNSSTYKLEKTLNLGLE 271

Query: 555 GVWDIAA 561
             W IA 
Sbjct: 272 RSWCIAT 278

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 75/158 (47%), Gaps = 15/158 (9%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLIRRLTGHTD 353
           NW N     Q FKGH   V+ + FN +   +  +G  D  V +W    G      T HT 
Sbjct: 125 NWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL--GQSTPNFTLHTG 182

Query: 354 GVKGIYF-------DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK--KI 404
             KG+ +       D   MIT+S D T+++++Y T SC++T  GH  +V     +    I
Sbjct: 183 QEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPI 242

Query: 405 IVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHP 441
           I+S S D TVK+W+  + +   TL    E   C+  HP
Sbjct: 243 IISGSEDGTVKLWNSSTYKLEKTLNLGLERSWCIATHP 280

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 105/262 (40%), Gaps = 48/262 (18%)

Query: 346 RRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSY 401
           +  +  ++ VKGI     +  ++T      + +WNY T   + + +     V +    + 
Sbjct: 7   KTFSKRSNRVKGIDLHPSEPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITR 66

Query: 402 KKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           K  IV  S D  V+V++  +         H +++  + +HP      + SDD T+++W+ 
Sbjct: 67  KNWIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNW 126

Query: 461 RTN-SCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN 519
             + S  + F+GH               E+ V+                   C   F+P 
Sbjct: 127 ENDWSLEQTFKGH---------------EHFVM-------------------CVA-FNP- 150

Query: 520 LKYPTHLLSCSLDNTIKLWEVS-SGRCIRTQFGHVEGV----WDIAADNFRIVSGSHDKS 574
            K P    S  LD+ +K+W +  S        G  +GV    +    D   +++ S D +
Sbjct: 151 -KDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTT 209

Query: 575 IKVWDLQNGKCIQTFTGHKAPI 596
           +K++D Q   C+ T  GH + +
Sbjct: 210 VKIFDYQTKSCVATLEGHMSNV 231

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQNG 583
           ++  S DN ++++  ++G  +     H + +  IA    +  I++GS D ++K+W+ +N 
Sbjct: 70  IVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWEND 129

Query: 584 KCI-QTFTGHKAPIVCVGI 601
             + QTF GH+  ++CV  
Sbjct: 130 WSLEQTFKGHEHFVMCVAF 148

>Scas_558.3
          Length = 725

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 83/165 (50%), Gaps = 11/165 (6%)

Query: 310 GHMDGVLSLKFNH-RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV---KGIYFDDQKM 365
           GH   V +L + H   + +GS+D+T  +W   +G L   L GH   V   K I  ++   
Sbjct: 100 GHHSNVCALSYKHMSAIISGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVEENTF 157

Query: 366 ITASLDKTIRVWNYITGSCISTYRG-HQDSV--LSVDSYKKIIVSASADKTVKVWHVESR 422
           ITAS D+T+++W       + T+ G H D +  + V S  K I + S D T+K+  ++  
Sbjct: 158 ITASADRTVKLWK--ENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGN 215

Query: 423 TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK 467
               L GH  +V  VKL  +     S  +D++LR+WDI  N  IK
Sbjct: 216 IKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDINNNFNIK 260

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/311 (22%), Positives = 119/311 (38%), Gaps = 99/311 (31%)

Query: 344 LIRRLTGHTDGVKGIY-FDDQKMITASLDKTIRVWN-----------------YITGSC- 384
           L   L GHT  VK I   DD ++ + S D T+R+W                  ++   C 
Sbjct: 4   LSATLLGHTQDVKDIVVIDDSQVASVSRDGTLRLWKHNDNGTWQDIVMATSEKFLNAVCY 63

Query: 385 -------------------------------ISTYRGHQDSVLSVDSYKKI--IVSASAD 411
                                          + T  GH  +V ++ SYK +  I+S S D
Sbjct: 64  DKDHELLFYSGQESLINGVSLLDIESIDKDPLYTLIGHHSNVCAL-SYKHMSAIISGSWD 122

Query: 412 KTVKVWHVESRTCYTLRGHTEWVNCVKL-HPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
            T KVW +     ++L GH   V   K+   +  T  ++S D+T+++W  + N  +K F 
Sbjct: 123 TTAKVW-INGALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLW--KENKLLKTFS 179

Query: 471 GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCS 530
           G    V       I++ E L   ++I                               +CS
Sbjct: 180 GIHSDV-------IRNIEVLSSGKEIA------------------------------TCS 202

Query: 531 LDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQT 588
            D TIK+ ++  G   +   GH   V+++  +    ++VS   D+S+++WD+ N   I+ 
Sbjct: 203 NDGTIKISDLD-GNIKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDINNNFNIKQ 261

Query: 589 FTGHKAPIVCV 599
               K P V +
Sbjct: 262 VI--KLPAVSI 270

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 15/180 (8%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITG 382
           +  GS D  + +++  +G  +     H D ++ I     K  ++T S D TI++WN+   
Sbjct: 70  VVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKN 129

Query: 383 -SCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHV-ESRTCYTLRGH-TEWVNC 436
             C  T+ GH+  V+SV    K      S   D T+KVW + +    +TL+ H T+ VN 
Sbjct: 130 WGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNY 189

Query: 437 VKLHPKSFTCY--SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI-----PLTIKDTEN 489
           V  +P     Y  ++SDD T+++WD +T S +    GH+  V   +     P+ I  +E+
Sbjct: 190 VDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTLPIIISGSED 249

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 118/269 (43%), Gaps = 44/269 (16%)

Query: 330 YDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCIST 387
           Y   + IW+ ++   +R +      V+   F  +K  ++  S D  +RV+NY TG  ++ 
Sbjct: 33  YSGRIEIWNYETQTQVRSIPLCDAPVRAGRFIARKNWVVVGSDDFKLRVYNYNTGEKVTE 92

Query: 388 YRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESR-TCY-TLRGHTEWVNCVKLHPKS 443
           +  H D +  ++V   K  +++ S D T+K+W+ E    C  T  GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKD 152

Query: 444 FTCYSSS-DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
              ++S   D T+++W I                Q V   T+K  E   V+  ++  P  
Sbjct: 153 PNQFASGCLDHTIKVWSIG---------------QDVPNFTLKAHETKGVN-YVDYYP-- 194

Query: 503 ELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV-WDIAA 561
                            L+   +L++ S D TIK+W+  +   + T  GH+  V + +  
Sbjct: 195 -----------------LQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFH 237

Query: 562 DNFRIV-SGSHDKSIKVWDLQNGKCIQTF 589
               I+ SGS D ++K+W+    K  +T 
Sbjct: 238 PTLPIIISGSEDGTLKIWNANTYKLEKTL 266

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 79/172 (45%), Gaps = 25/172 (14%)

Query: 297 NW-RNGRCRIQLFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLIRRLTGHT 352
           NW +N  C+ Q F GH   V+S+ FN +      +G  D T+ +W    G  +   T   
Sbjct: 125 NWEKNWGCQ-QTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSI--GQDVPNFTLKA 181

Query: 353 DGVKGIYF-------DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK--- 402
              KG+ +       D   +IT S D TI+VW+Y T S ++T  GH  +V    SY    
Sbjct: 182 HETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANV----SYAVFH 237

Query: 403 ---KIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSS 450
               II+S S D T+K+W+  + +   TL    E   C+  HP     Y +S
Sbjct: 238 PTLPIIISGSEDGTLKIWNANTYKLEKTLNIGLERSWCIATHPSGKRNYIAS 289

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 105/262 (40%), Gaps = 48/262 (18%)

Query: 346 RRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSY 401
           ++L+  TD VKGI F  ++  ++       I +WNY T + + +       V +    + 
Sbjct: 7   KKLSARTDRVKGIDFHPEEPWVLITLYSGRIEIWNYETQTQVRSIPLCDAPVRAGRFIAR 66

Query: 402 KKIIVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           K  +V  S D  ++V++  +    T    H +++  + +HP      + SDD T+++W+ 
Sbjct: 67  KNWVVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNW 126

Query: 461 RTN-SCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN 519
             N  C + F GH   V  V                                    F+P 
Sbjct: 127 EKNWGCQQTFTGHEHFVMSVA-----------------------------------FNP- 150

Query: 520 LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGH-VEGV----WDIAADNFRIVSGSHDKS 574
            K P    S  LD+TIK+W +       T   H  +GV    +    D   +++ S D +
Sbjct: 151 -KDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGT 209

Query: 575 IKVWDLQNGKCIQTFTGHKAPI 596
           IKVWD Q    + T  GH A +
Sbjct: 210 IKVWDYQTKSNVATLEGHMANV 231

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQ-NGKCIQT 588
           D  ++++  ++G  +     H + +  IA    +  +++GS D +IK+W+ + N  C QT
Sbjct: 76  DFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQT 135

Query: 589 FTGHKAPIVCVGIG---DSSFVSG 609
           FTGH+  ++ V       + F SG
Sbjct: 136 FTGHEHFVMSVAFNPKDPNQFASG 159

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 109/269 (40%), Gaps = 62/269 (23%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWH 418
           D + + T + D+ IR+W+      +   +GH+  + S+D +     +VS S D+TV++W 
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVF-------R 470
           + +  C       + V  V + P      ++ S D+ +R+WD  T   ++          
Sbjct: 514 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGT 573

Query: 471 GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCS 530
           GH   V  V+                           F  D   +           +S S
Sbjct: 574 GHKDSVYSVV---------------------------FTRDGQSV-----------VSGS 595

Query: 531 LDNTIKLWEV------------SSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIK 576
           LD ++KLW +            +SG C  T  GH + V  +A   ++  I+SGS D+ + 
Sbjct: 596 LDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVL 655

Query: 577 VWDLQNGKCIQTFTGHKAPIVCVGIGDSS 605
            WD ++G  +    GH+  ++ V + + S
Sbjct: 656 FWDKKSGNPLLMLQGHRNSVISVAVANGS 684

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 98/205 (47%), Gaps = 28/205 (13%)

Query: 302 RCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           R  + + +GH   + SL +  +   L +GS D TV IWD ++G     L+   DGV  + 
Sbjct: 475 RKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIE-DGVTTVA 533

Query: 360 FD--DQKMITA-SLDKTIRVWNYITGSCIS-------TYRGHQDSVLSVDSYK--KIIVS 407
               D K I A SLD+ +RVW+  TG  +        +  GH+DSV SV   +  + +VS
Sbjct: 534 VSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVS 593

Query: 408 ASADKTVKVWHVE------------SRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKT 454
            S D++VK+W+++            S TC  T  GH ++V  V          S S D+ 
Sbjct: 594 GSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRG 653

Query: 455 LRMWDIRTNSCIKVFRGHVGQVQKV 479
           +  WD ++ + + + +GH   V  V
Sbjct: 654 VLFWDKKSGNPLLMLQGHRNSVISV 678

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 98/231 (42%), Gaps = 62/231 (26%)

Query: 403 KIIVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR 461
           K + + + D+ +++W +E+R     L+GH + +  +   P      S S D+T+R+WD+R
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 462 TNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLK 521
           T  C              + L+I+D    V                       +   + K
Sbjct: 516 TGQC-------------SLTLSIEDGVTTV----------------------AVSPGDGK 540

Query: 522 YPTHLLSCSLDNTIKLWEVSSGRCIR-------TQFGHVEGVWDI--AADNFRIVSGSHD 572
           Y   + + SLD  +++W+  +G  +        +  GH + V+ +    D   +VSGS D
Sbjct: 541 Y---IAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLD 597

Query: 573 KSIKVWDLQN------------GKCIQTFTGHKAPIVCVGI--GDSSFVSG 609
           +S+K+W+LQN            G C  T+ GHK  ++ V     D   +SG
Sbjct: 598 RSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 648

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/291 (23%), Positives = 116/291 (39%), Gaps = 76/291 (26%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDD-QKMITASLDKTIRVWNYI 380
           + L TG+ D  + IWD ++  ++  L GH   +  + YF    K+++ S D+T+R+W+  
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 381 TGSCISTYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESRTCYTLR--------- 428
           TG C S     +D V +V       K I + S D+ V+VW  +S T + +          
Sbjct: 516 TGQC-SLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESG 572

Query: 429 -GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR------------TNSCIKVFRGHVGQ 475
            GH + V  V       +  S S D+++++W+++            + +C   + GH   
Sbjct: 573 TGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGH--- 629

Query: 476 VQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTI 535
             K   L++  T+N   DE                              ++LS S D  +
Sbjct: 630 --KDFVLSVATTQN---DE------------------------------YILSGSKDRGV 654

Query: 536 KLWEVSSGRCIRTQFGHVEGVWDIAADNFR--------IVSGSHDKSIKVW 578
             W+  SG  +    GH   V  +A  N            +GS D   ++W
Sbjct: 655 LFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 53/100 (53%), Gaps = 6/100 (6%)

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDK 573
           F P+ K+   L + + D  I++W++ + + +    GH + ++  D      ++VSGS D+
Sbjct: 451 FSPDGKF---LATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDR 507

Query: 574 SIKVWDLQNGKCIQTFTGHKA-PIVCVGIGDSSFVSGDEL 612
           ++++WDL+ G+C  T +       V V  GD  +++   L
Sbjct: 508 TVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSL 547

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 67/168 (39%), Gaps = 68/168 (40%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKSGNLIRRL----- 348
           + R G+C + L     DGV ++     + + +  GS D  V +WD+++G L+ RL     
Sbjct: 513 DLRTGQCSLTL--SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENE 570

Query: 349 --TGHTDGVKGIYF--DDQKMITASLDKTIRVWNYI------------TGSCISTYRGHQ 392
             TGH D V  + F  D Q +++ SLD+++++WN              +G+C  TY GH+
Sbjct: 571 SGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHK 630

Query: 393 D------------------------------------------SVLSV 398
           D                                          SV+SV
Sbjct: 631 DFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISV 678

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 11/90 (12%)

Query: 300 NGRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG 357
           +G C +  + GH D VLS+    N   + +GS D  V  WD KSGN +  L GH + V  
Sbjct: 619 SGTCEVT-YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVIS 677

Query: 358 IYFDDQKMI--------TASLDKTIRVWNY 379
           +   +   +        T S D   R+W Y
Sbjct: 678 VAVANGSPLGPEYNVFATGSGDCKARIWKY 707

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/368 (22%), Positives = 142/368 (38%), Gaps = 122/368 (33%)

Query: 315 VLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKMITASLDKT 373
            L +  + R +++GSYD  V  W+  SG + ++ +GHT  VK + Y  + ++++A  D++
Sbjct: 108 ALDVSDDFRHIYSGSYDGVVRTWNM-SGKVEKQYSGHTGAVKAVKYISNTRIVSAGNDRS 166

Query: 374 IRVW--------------------NYITGSCISTYRGHQDSVLSVD-SYKKIIVSASADK 412
           +R+W                    N   G  ++   GH+  V+S+D +    I+SAS D 
Sbjct: 167 LRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSRILSASYDN 226

Query: 413 TVKVWHVESRTCY---TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD--IRTNSCIK 467
           TV +W     T Y   T   H E +     +P +    ++   + L + D  IR  + + 
Sbjct: 227 TVALW----STIYKEMTAIDHLEEIQ----NPNNKISTAAKKRRKLTLKDGTIRRRAPLS 278

Query: 468 VFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLL 527
           +   H G V++VI                          D  D+  G             
Sbjct: 279 LLESHTGPVEQVI-------------------------FDHGDNTVG------------Y 301

Query: 528 SCSLDNTIKLWEVSSGRCIRTQ-------------------------------------- 549
           S S D+TIK W++ + RCI T+                                      
Sbjct: 302 SVSQDHTIKTWDLVTARCIDTKTTSYPLLSIAQMPTLNLLACGSSVRHITLHDPRVSSSA 361

Query: 550 -------FGH---VEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
                   GH   V G+   + + + + S SHD ++KVWD+++   + T T  + P V  
Sbjct: 362 KITQKQLVGHKNFVVGLDTCSENEYLLCSASHDGTVKVWDVRSTSPMYTIT-RQDPTVEK 420

Query: 600 GIGDSSFV 607
           G+ D  F 
Sbjct: 421 GVNDKVFA 428

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 90/223 (40%), Gaps = 54/223 (24%)

Query: 295 ESNWRNGRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDT------------- 339
           E N  +G+  + + +GH   V+SL    N R+L + SYD+TVA+W T             
Sbjct: 189 EENIEDGKT-LAILEGHKAPVVSLDVASNSRIL-SASYDNTVALWSTIYKEMTAIDHLEE 246

Query: 340 --------------------KSGNLIRR-----LTGHTDGVKGIYF---DDQKMITASLD 371
                               K G + RR     L  HT  V+ + F   D+    + S D
Sbjct: 247 IQNPNNKISTAAKKRRKLTLKDGTIRRRAPLSLLESHTGPVEQVIFDHGDNTVGYSVSQD 306

Query: 372 KTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYT----- 426
            TI+ W+ +T  CI T +     +LS+     + + A       +   + R   +     
Sbjct: 307 HTIKTWDLVTARCIDT-KTTSYPLLSIAQMPTLNLLACGSSVRHITLHDPRVSSSAKITQ 365

Query: 427 --LRGHTEWVNCVKL-HPKSFTCYSSSDDKTLRMWDIRTNSCI 466
             L GH  +V  +       +   S+S D T+++WD+R+ S +
Sbjct: 366 KQLVGHKNFVVGLDTCSENEYLLCSASHDGTVKVWDVRSTSPM 408

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 87/239 (36%), Gaps = 63/239 (26%)

Query: 394 SVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
           S L V    + I S S D  V+ W++  +      GHT  V  VK +  +    S+ +D+
Sbjct: 107 SALDVSDDFRHIYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVK-YISNTRIVSAGNDR 165

Query: 454 TLRMWDIRT-NSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDC 512
           +LR+W  +  +  +    G     +      I+D + L +   +E    P +  D A + 
Sbjct: 166 SLRLWKTKNDDGSVSNNTGDENDEEN-----IEDGKTLAI---LEGHKAPVVSLDVASN- 216

Query: 513 TGIFDPNLKYPTHLLSCSLDNTIKLW---------------------EVSSG-------- 543
                      + +LS S DNT+ LW                     ++S+         
Sbjct: 217 -----------SRILSASYDNTVALWSTIYKEMTAIDHLEEIQNPNNKISTAAKKRRKLT 265

Query: 544 ------------RCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
                         + +  G VE V     DN    S S D +IK WDL   +CI T T
Sbjct: 266 LKDGTIRRRAPLSLLESHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARCIDTKT 324

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 81/161 (50%), Gaps = 9/161 (5%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYIT 381
           L F  S    + +++ +S + I +  GH D    + +  D  +++TAS D  I+VW+  +
Sbjct: 317 LAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITS 376

Query: 382 GSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWH-VESRTCYTLRGHTEWV--NC 436
           G C++T+  H  SV +V   K+  ++ S+S D TV+ W  +  R   T  G TE +  NC
Sbjct: 377 GFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQFNC 435

Query: 437 VKLHPKS-FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
           + + P     C  S D+  + +W ++T   +    GH G V
Sbjct: 436 LAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPV 476

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 87/185 (47%), Gaps = 21/185 (11%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QK 364
           +GH D   SL +  +   + T S D  + +WD  SG  +     HT  V  + F    Q 
Sbjct: 342 QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQV 401

Query: 365 MITASLDKTIRVWNYITGSCISTYRGH---QDSVLSVDSYKKIIVSASADK-TVKVWHVE 420
           M ++SLD T+R W+ I      T+ G    Q + L+VD   +++ + S D   + VW V+
Sbjct: 402 MFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 461

Query: 421 S-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           + +    L GH   V+C+    ++    S+S DKT+R+W I             G+ Q+V
Sbjct: 462 TGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI------------FGRSQQV 509

Query: 480 IPLTI 484
            P+ +
Sbjct: 510 EPIEV 514

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 128/306 (41%), Gaps = 32/306 (10%)

Query: 303 CRIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIW--DTKSGNLIRR-LTGHTDGVKG 357
            R ++  GH   + SL ++   R + T S D +  IW  D++  NL      GH D V G
Sbjct: 137 VRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMG 196

Query: 358 IYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVK 415
            +F  D +K+ T S D  + VW +       T R   D     +   K       D +  
Sbjct: 197 AFFSHDQEKIYTVSKDGAVFVWEF-------TKRPSDDDDNESEDDDK---QEEVDISKY 246

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQ 475
            W +  +  +    +   V CV  HP +            R++D+   + I+     +GQ
Sbjct: 247 SWRITKKHFF--YANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQL--SMGQ 302

Query: 476 VQKVIPLTIKDTENLVV--DEKIEKVPNPELE-EDFADDCTGIFDP--NLKYP---THLL 527
              V  +++  T   +     K+ ++   E + E +     G FD   +L Y    + ++
Sbjct: 303 -NPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVV 361

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKC 585
           + S D  IK+W+++SG C+ T   H   V  +  A     + S S D +++ WDL   + 
Sbjct: 362 TASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRN 421

Query: 586 IQTFTG 591
            +TFTG
Sbjct: 422 FRTFTG 427

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 106/267 (39%), Gaps = 46/267 (17%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK---MITASLDKTIRVWNY 379
           RLL  G       ++D     LI++L+   + V  +  +         +S    + V+ +
Sbjct: 273 RLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEW 332

Query: 380 ITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNC 436
            + S I   +GH DS   L+       +V+AS D  +KVW + S  C  T   HT  V  
Sbjct: 333 QSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTA 392

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKI 496
           V+   +    +SSS D T+R WD+      + F G   ++Q            L VD   
Sbjct: 393 VQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQ---------FNCLAVDPSG 442

Query: 497 EKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDN-TIKLWEVSSGRCIRTQFGHVEG 555
           E V            C G               SLDN  I +W V +G+ +    GH   
Sbjct: 443 EVV------------CAG---------------SLDNFDIHVWSVQTGQLLDALSGHEGP 475

Query: 556 V--WDIAADNFRIVSGSHDKSIKVWDL 580
           V     + +N  + S S DK+I++W +
Sbjct: 476 VSCLSFSQENSVLASASWDKTIRIWSI 502

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 74/191 (38%), Gaps = 47/191 (24%)

Query: 417 WHVESRTCYTLR--GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG 474
           W  ES   Y L+  GH +  N +   P      ++S+D  +++WDI +  C+  F  H  
Sbjct: 332 WQSES---YILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTS 388

Query: 475 QVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNT 534
            V  V                            FA           K    + S SLD T
Sbjct: 389 SVTAV---------------------------QFA-----------KRGQVMFSSSLDGT 410

Query: 535 IKLWEVSSGRCIRTQFGHVEGVWD-IAAD--NFRIVSGSHDK-SIKVWDLQNGKCIQTFT 590
           ++ W++   R  RT  G     ++ +A D     + +GS D   I VW +Q G+ +   +
Sbjct: 411 VRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALS 470

Query: 591 GHKAPIVCVGI 601
           GH+ P+ C+  
Sbjct: 471 GHEGPVSCLSF 481

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 11/133 (8%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK- 356
           +G C +  F+ H   V +++F  R  ++F+ S D TV  WD       R  TG T+ ++ 
Sbjct: 376 SGFC-LATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQF 433

Query: 357 ---GIYFDDQKMITASLDK-TIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASA 410
               +    + +   SLD   I VW+  TG  +    GH+  V  LS      ++ SAS 
Sbjct: 434 NCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASW 493

Query: 411 DKTVKVWHVESRT 423
           DKT+++W +  R+
Sbjct: 494 DKTIRIWSIFGRS 506

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 114/284 (40%), Gaps = 69/284 (24%)

Query: 350 GHTDGVKGI--YFDDQKMITASLDKTIRVWNYITGSC----ISTYRGHQDSVLSVD---- 399
           GHTD +  +    D   + TAS D ++ +W Y   S      + + GH   V ++     
Sbjct: 380 GHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALPNV 439

Query: 400 ---SYKKIIVSASADKTVKVW--------------HVESRTCYTLRGHTEWVNCVKLHPK 442
              ++ + +++AS D T+K W              H+   + YT R H + +N + + P 
Sbjct: 440 MNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPN 499

Query: 443 SFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
                ++S DKT ++W++ T                                        
Sbjct: 500 DSIFATASYDKTCKIWNVDTG--------------------------------------- 520

Query: 503 ELEEDFADDCTGIFDPNL-KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA- 560
           E+E   A+   G++     +Y   L +CS D +I LW + S   ++T  GH   V  ++ 
Sbjct: 521 EVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSF 580

Query: 561 -ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGD 603
              N ++VS   D  +K+WD   G+C++T   H   I  + + +
Sbjct: 581 INGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAVAN 624

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/305 (22%), Positives = 119/305 (39%), Gaps = 69/305 (22%)

Query: 306 QLFKGHMDGVLSLKFNHRLLF--TGSYDSTVAIW----DTKSGNLIRRLTGHTDGVKGIY 359
           ++++GH D + SL      L+  T S D +V +W     + S     +  GH   V  I 
Sbjct: 376 EMYEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIA 435

Query: 360 FDD-------QKMITASLDKTIRVWN-------------YITGSCISTYRGHQDSV--LS 397
             +       + ++TAS D TI+ W              +I  +   T R H+  +  +S
Sbjct: 436 LPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAIS 495

Query: 398 VDSYKKIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLR 456
           +     I  +AS DKT K+W+V++     TL  H   +  V      +   + S D+++ 
Sbjct: 496 MSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSIN 555

Query: 457 MWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIF 516
           +W + + + +K   GH   VQ+V                                     
Sbjct: 556 LWSLESFTVLKTLEGHTNAVQRV----------------------------------SFI 581

Query: 517 DPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKS 574
           + N      L+S   D  +K+W+ S+G C+RT   H   +W +A   D   I++   D  
Sbjct: 582 NGN----KQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGV 637

Query: 575 IKVWD 579
            + W+
Sbjct: 638 FQFWE 642

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 98/242 (40%), Gaps = 46/242 (19%)

Query: 403 KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           +II +  A +  +V  +E+       GHT+ +N +          ++S D ++ +W    
Sbjct: 357 RIIPTPQASEDKEVMEIETEM---YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNE 413

Query: 463 NSC----IKVFRGHVGQVQKV-IP---------LTIKDTENLVVDEKIEKVPNP------ 502
            S        F GH G V  + +P           +  + +L +  K  KVPNP      
Sbjct: 414 ASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTI--KRWKVPNPNDRKAI 471

Query: 503 EL----------EEDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFG 551
           EL                D   I   PN    +   + S D T K+W V +G    T   
Sbjct: 472 ELPHIVKASEYTRRAHEKDINAISMSPN---DSIFATASYDKTCKIWNVDTGEVEATLAN 528

Query: 552 HVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSG 609
           H  G+W +A    ++ + + S D+SI +W L++   ++T  GH   +  V     SF++G
Sbjct: 529 HKRGLWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRV-----SFING 583

Query: 610 DE 611
           ++
Sbjct: 584 NK 585

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 70/327 (21%), Positives = 128/327 (39%), Gaps = 53/327 (16%)

Query: 308 FKGHMDGVLSLKFNHR------LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD 361
            KGH   + S+KF         LL +G  +  V IWD      I  +  HT  V+G+   
Sbjct: 139 LKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIR 198

Query: 362 DQK-----MITASLDKTIRVWNY-ITGSC----ISTYRGHQDSVLSVDSYKKIIVSASAD 411
            Q+     +++   D  + V ++ +   C        +   +S   +     +I +A  D
Sbjct: 199 VQEGAESLLLSGGRDDVVHVHHFDMKKKCKLLQTIPVKRQIESCGFIGDNTSLIYTAGGD 258

Query: 412 KTVKVWHVES-RTCYTLRGHTEWVNCVKLHP--KSFTCYSSSDDKTLRMWDI-----RTN 463
              ++  +ES ++        E +  V + P   S  CY    D+TL + D+     +T 
Sbjct: 259 AVYQIISLESGKSIKQTAQPVEELFIVGVLPVQNSTKCYLVLSDQTLFLIDVEKALSQTE 318

Query: 464 SCIKVFR------GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEED--FADDCTGI 515
             I++ +      G +  ++ V P ++           +  +P P+  ED    +  T +
Sbjct: 319 KMIEIEKKIAGNHGTIADMRLVGP-SLNRLALATNSPTLRIIPTPQASEDKEVMEIETEM 377

Query: 516 FDPNLKYPTH---------LLSCSLDNTIKLW---EVSSGRCIRTQF-GHVEGVWDIAAD 562
           ++ +               L + S D+++ LW   E SS     T+F GH   V  IA  
Sbjct: 378 YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALP 437

Query: 563 NFR-------IVSGSHDKSIKVWDLQN 582
           N         +++ S+D +IK W + N
Sbjct: 438 NVMNRNWPEFLLTASNDLTIKRWKVPN 464

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 41/90 (45%), Gaps = 16/90 (17%)

Query: 523 PTHLLSC----------SLDNTIKLWEVSSGRCIRTQFGH------VEGVWDIAADNFRI 566
           P ++L C            D ++ ++++++G    +  GH      V+   ++ +  + +
Sbjct: 103 PAYVLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLL 162

Query: 567 VSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
            SG  +  +K+WDL   +CI T   H A +
Sbjct: 163 ASGDTNGMVKIWDLVKRRCIHTVQEHTAAV 192

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 119/300 (39%), Gaps = 70/300 (23%)

Query: 345 IRRLTGHTDGVKGI--YFDDQKMITASLDKTIRVWNYITGS----CISTYRGHQDSVLSV 398
           ++   GHTD +  +    D   + TAS D ++ +W Y          + + GH  SV +V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 399 D-------SYKKIIVSASADKTVKVWHVESRTC-------------YTLRGHTEWVNCVK 438
                   S+ + I++AS D T+K W V   T              YT R H + +N + 
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAIS 502

Query: 439 LHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEK 498
           + P      ++S DKT ++W++                                      
Sbjct: 503 ISPNDSLFATASYDKTCKIWNL-------------------------------------- 524

Query: 499 VPNPELEEDFADDCTGIFDPNL-KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW 557
             + E +   A+   G++D    +Y   L +CS D TIK+W + S   ++T  GH   V 
Sbjct: 525 -DDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQ 583

Query: 558 --DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGD--SSFVSGDELG 613
                  N +++S   D  + +WDL  G+ ++T   H   I  + + +   SFV+ D  G
Sbjct: 584 RCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADG 643

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 71/157 (45%), Gaps = 11/157 (7%)

Query: 315 VLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDK 372
            +S+  N  L  T SYD T  IW+   G     L  H  G+  + F   D+ + T S DK
Sbjct: 500 AISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDK 559

Query: 373 TIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVES-RTCYTLRG 429
           TI++W+  + + + T  GH ++V   S  +  K ++S  AD  V +W + +  +  TL  
Sbjct: 560 TIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDA 619

Query: 430 HTE--WVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS 464
           H    W   V    +SF   ++  D     W  R NS
Sbjct: 620 HNNRIWALAVMNDGESFV--TADADGFFEFW--RDNS 652

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 81/160 (50%), Gaps = 7/160 (4%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYIT 381
           L F  S    + +++ +S + I +  GH D +  + +  D  +++TA+ D  I++W+ ++
Sbjct: 328 LAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVS 387

Query: 382 GSCISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLRGHTEWV--NCV 437
           G C++T+  H  SV SV   K  +I+ S+S D TVK W +     +     TE +  +C+
Sbjct: 388 GFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCL 447

Query: 438 KLHPKS-FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
              P     C  S D+  +++W ++T   +    GH G V
Sbjct: 448 AADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPV 487

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 125/297 (42%), Gaps = 39/297 (13%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQK 364
           +GH D + +L +  +   + T + D  + IWD  SG  +     HT  V  + F  + Q 
Sbjct: 353 QGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQI 412

Query: 365 MITASLDKTIRVWNYITGSCISTYRGH---QDSVLSVDSYKKIIVSASADKT-VKVWHVE 420
           M ++SLD T++ W+ +      T+      Q S L+ D   +++ + S D   ++VW V+
Sbjct: 413 MFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQ 472

Query: 421 S-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           + +   TL GH   V+C+    ++    S+S DKT+R+W I             G+ Q+V
Sbjct: 473 TGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVWSI------------FGRSQQV 520

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
            P+           E    V +  +  D         +  L +     S  + N     +
Sbjct: 521 EPI-----------EAYSDVLDISMRPDGKQVAVSTLNGQLSFFDVETSRQVGNIDCKRD 569

Query: 540 VSSGRCIRTQFGHVEGVWD-------IAADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589
           + SGR +  +F                + D   IV+G ++ SI ++D+ N   I+ F
Sbjct: 570 IISGRHLEDRFTSKNSARSKYFTTIHYSFDGLSIVAGGNNNSICLYDIPNEVLIKRF 626

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 80/195 (41%), Gaps = 49/195 (25%)

Query: 414 VKVWHVESRTCYTLR--GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
           V  W  ES   Y L+  GH + +N +   P      ++++D  +++WDI +  C+  F  
Sbjct: 340 VYEWQSES---YILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEE 396

Query: 472 HVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSL 531
           H   V  V                            FA +   +F           S SL
Sbjct: 397 HTSSVTSV---------------------------QFAKNGQIMF-----------SSSL 418

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVWD--IAAD--NFRIVSGSHDK-SIKVWDLQNGKCI 586
           D T+K W++   R  RT F   E +    +AAD     + +GS D   I+VW +Q G+ +
Sbjct: 419 DGTVKAWDLMRFRNFRT-FTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLL 477

Query: 587 QTFTGHKAPIVCVGI 601
            T +GH+ P+ C+  
Sbjct: 478 DTLSGHEGPVSCLSF 492

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 82/178 (46%), Gaps = 20/178 (11%)

Query: 300 NGRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG 357
           +G C +  F+ H   V S++F  N +++F+ S D TV  WD       R  T      + 
Sbjct: 387 SGFC-LATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTA----TER 441

Query: 358 IYFD-------DQKMITASLDKT-IRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVS 407
           I F         + +   SLD   I+VW+  TG  + T  GH+  V  LS      I+ S
Sbjct: 442 IQFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILAS 501

Query: 408 ASADKTVKVWHVESRT--CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463
           AS DKT++VW +  R+     +  +++ ++ + + P       S+ +  L  +D+ T+
Sbjct: 502 ASWDKTIRVWSIFGRSQQVEPIEAYSDVLD-ISMRPDGKQVAVSTLNGQLSFFDVETS 558

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 134/331 (40%), Gaps = 68/331 (20%)

Query: 311 HMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLT---GHTDGVKGIYFDDQKM 365
           H   V  +KF++    L TG  + T  I+    G L+ R +    HTD   G   +D   
Sbjct: 490 HTSVVCCVKFSNDGEFLATGC-NKTTQIYRVSDGELVARFSDENAHTDKADG---NDNAE 545

Query: 366 ITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESR-TC 424
              S   T  +  YI   C S                K + + + DK +++W +E +   
Sbjct: 546 AETSAGATTDL--YIRSVCFS-------------PDGKFLATGAEDKLIRIWDIEQKKIV 590

Query: 425 YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC------------IKVFRG- 471
             L+GH + +  +   P      S S D+T+R+WD++T  C            + V  G 
Sbjct: 591 MVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGD 650

Query: 472 ----HVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIF---DPNLKYPT 524
                 G + + + +   DT  LV  E+++     EL     D    +    D N     
Sbjct: 651 GKFIAAGSLDRAVRVWDSDTGFLV--ERLDS--ENELGTGHKDSVYSVVFTRDGN----- 701

Query: 525 HLLSCSLDNTIKLWEV------------SSGRCIRTQFGHVEGVWDIAA--DNFRIVSGS 570
            ++S SLD ++KLW +            +SG C  T  GH + V  +A   D+  I+SGS
Sbjct: 702 GVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGS 761

Query: 571 HDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
            D+ +  WD  +G  +    GH+  ++ V +
Sbjct: 762 KDRGVLFWDKVSGNPLLMLQGHRNSVISVAV 792

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 93/202 (46%), Gaps = 28/202 (13%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD- 361
           + + KGH   + SL +  +   L +GS D TV IWD K+G     L+   DGV  +    
Sbjct: 590 VMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIE-DGVTTVAVSP 648

Query: 362 -DQKMITA-SLDKTIRVWNYITGSCISTY-------RGHQDSVLSVDSYK--KIIVSASA 410
            D K I A SLD+ +RVW+  TG  +           GH+DSV SV   +    +VS S 
Sbjct: 649 GDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSL 708

Query: 411 DKTVKVWHVE------------SRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
           D++VK+W++             S TC  T  GH ++V  V          S S D+ +  
Sbjct: 709 DRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLF 768

Query: 458 WDIRTNSCIKVFRGHVGQVQKV 479
           WD  + + + + +GH   V  V
Sbjct: 769 WDKVSGNPLLMLQGHRNSVISV 790

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 122/303 (40%), Gaps = 81/303 (26%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDD-QKMITASLDKTIRVWNYI 380
           + L TG+ D  + IWD +   ++  L GH   +  + YF    K+++ S D+T+R+W+  
Sbjct: 568 KFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLK 627

Query: 381 TGSCISTYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESRTCYTLR--------- 428
           TG C  T    +D V +V       K I + S D+ V+VW  +S T + +          
Sbjct: 628 TGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW--DSDTGFLVERLDSENELG 684

Query: 429 -GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR------------TNSCIKVFRGHVGQ 475
            GH + V  V          S S D+++++W++R            + +C   + GH   
Sbjct: 685 TGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGH--- 741

Query: 476 VQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTI 535
             K   L++  TE+   DE                              ++LS S D  +
Sbjct: 742 --KDFVLSVATTED---DE------------------------------YILSGSKDRGV 766

Query: 536 KLWEVSSGRCIRTQFGHVEGVWDIAAD-------NFRI-VSGSHDKSIKVWDLQNGKCIQ 587
             W+  SG  +    GH   V  +A +       N+ I  +GS D   ++W     K I+
Sbjct: 767 LFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW-----KYIK 821

Query: 588 TFT 590
           T T
Sbjct: 822 TTT 824

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 54/102 (52%), Gaps = 10/102 (9%)

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNF----RIVSGSH 571
           F P+ K+   L + + D  I++W++   + +    GH + ++ +  D F    ++VSGS 
Sbjct: 563 FSPDGKF---LATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSL--DYFPSGDKLVSGSG 617

Query: 572 DKSIKVWDLQNGKCIQTFTGHKA-PIVCVGIGDSSFVSGDEL 612
           D+++++WDL+ G+C  T +       V V  GD  F++   L
Sbjct: 618 DRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSL 659

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 88/181 (48%), Gaps = 21/181 (11%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV---K 356
           +G   +    GH   V SL F   ++ +GS+D T  +W  K G+L+  L  H   V   K
Sbjct: 87  SGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVW--KEGSLVYNLQAHNASVWDAK 144

Query: 357 GIYFDDQKMITASLDKTIRVWNYITGSCISTYRG-HQDSV--LSV--DSYKKIIVSASAD 411
            + F + K +TAS DKTI++W       I T+ G H D V  L+V  D +    +S S D
Sbjct: 145 VVSFSENKFLTASADKTIKLWQ--NDKVIKTFSGIHNDVVRHLAVVDDGH---FISCSND 199

Query: 412 KTVKVWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKV 468
             +K+  V+  T   LR   GH  +V C+KL P      S  +D+T+R+W     S  +V
Sbjct: 200 GLIKL--VDMHTGDVLRTYEGHESFVYCIKLLPNG-DIVSCGEDRTVRIWSKENGSLKQV 256

Query: 469 F 469
            
Sbjct: 257 I 257

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 97/231 (41%), Gaps = 46/231 (19%)

Query: 387 TYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTC 446
           T  GHQ +V S+     +++S S DKT KVW  E    Y L+ H   V   K+   S   
Sbjct: 94  TLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK-EGSLVYNLQAHNASVWDAKVVSFSENK 152

Query: 447 Y-SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELE 505
           + ++S DKT+++W  + +  IK F G    V + +          VVD+           
Sbjct: 153 FLTASADKTIKLW--QNDKVIKTFSGIHNDVVRHLA---------VVDDG---------- 191

Query: 506 EDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-DNF 564
                              H +SCS D  IKL ++ +G  +RT  GH   V+ I    N 
Sbjct: 192 -------------------HFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNG 232

Query: 565 RIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI---VCVGIGDSSFVSGDEL 612
            IVS   D+++++W  +NG   Q  T     I    C+  GD    S D L
Sbjct: 233 DIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNL 283

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 107/264 (40%), Gaps = 51/264 (19%)

Query: 323 RLLFTGSYDST---VAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNY 379
            LL  G  D+    V ++ T   + +  L GH   V  + F D  +I+ S DKT +VW  
Sbjct: 67  ELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK- 125

Query: 380 ITGSCISTYRGHQDSVLS---VDSYKKIIVSASADKTVKVWHVESRTCYTLRG-HTEWVN 435
             GS +   + H  SV     V   +   ++ASADKT+K+W    +   T  G H + V 
Sbjct: 126 -EGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQ-NDKVIKTFSGIHNDVVR 183

Query: 436 CVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK 495
            + +        S S+D  +++ D+ T   ++ + GH               E+ V    
Sbjct: 184 HLAVVDDGHFI-SCSNDGLIKLVDMHTGDVLRTYEGH---------------ESFVY--C 225

Query: 496 IEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEG 555
           I+ +PN +                      ++SC  D T+++W   +G   +        
Sbjct: 226 IKLLPNGD----------------------IVSCGEDRTVRIWSKENGSLKQVITLPAIS 263

Query: 556 VWDI-AADNFRIVSGSHDKSIKVW 578
           +W +    N  I+ GS D  ++++
Sbjct: 264 IWSVDCMSNGDIIVGSSDNLVRIF 287

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589
           ++ N + L+  S    + T  GH   V  ++  +  ++SGS DK+ KVW  + G  +   
Sbjct: 76  TMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVW--KEGSLVYNL 133

Query: 590 TGHKAPI 596
             H A +
Sbjct: 134 QAHNASV 140

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 125/272 (45%), Gaps = 32/272 (11%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYIT 381
           L F  S    + +++ +S + I +  GH D    + +  D  +++TA+ D  I+VW+  +
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVAS 372

Query: 382 GSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVESRTCYTLRGHTEWV--NCV 437
           G C++T+  H  +V +V   KK  ++ SAS D TV+ W +     + +   TE V   C+
Sbjct: 373 GFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCL 432

Query: 438 KLHPKS-FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV---- 492
            + P        S+D   + +W ++T   +    GH G V   +  ++   EN V+    
Sbjct: 433 AVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPV-SCLAFSM---ENAVLASAS 488

Query: 493 -DEKIE------KVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC 545
            D+ I       +    E  E FAD       P+ K   H+   +L   + +++++SG+ 
Sbjct: 489 WDKTIRIWSIFGRSQQVEPLEVFADILAITITPDGK---HVAVSTLKGQLTIFDIASGK- 544

Query: 546 IRTQFGHVEGVWDIAADNF---RIVSGSHDKS 574
              Q G+++   DI +  F   R  S + ++S
Sbjct: 545 ---QIGNIDCRKDIISGRFLQDRFTSKNSERS 573

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 82/348 (23%), Positives = 133/348 (38%), Gaps = 56/348 (16%)

Query: 303 CRIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGN---LIRRLTGHTDGVKG 357
            R ++  GH   + S  ++H  R L T S D T  +W   S +   +   L GH D V G
Sbjct: 137 VRYRVHAGHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLG 196

Query: 358 IYFDD--QKMITASLDKTIRVWNYIT-----GSCISTYRGHQDSVLSVDSYKKIIVSASA 410
            YF+   +K+ T S D  +  W YI+     G           S LS    KK    A+ 
Sbjct: 197 AYFNSTQEKIYTISKDGAVFTWEYISKAQKEGLDEEDLEDEDLSKLSWRITKKNFFYANQ 256

Query: 411 DKTVK--VWHVESRTCYTLRGHTEW--------------------VNCVKL-HPKSFTCY 447
            K VK   +H+ S        + E+                    VN V + +   +  +
Sbjct: 257 AK-VKCCTFHINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAF 315

Query: 448 SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEED 507
            SS    L +++ ++ S I   +GH      +      D   +V   +  K+   ++   
Sbjct: 316 GSSKLGQLLVYEWQSESYILKQQGHFDATNSLT--YSPDGSRVVTAAEDGKIKVWDVASG 373

Query: 508 FADDCTGIFDPNLKYPTH---------LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV-- 556
           F   C   F+ +    T          L S SLD T++ W++   R  R  F   E V  
Sbjct: 374 F---CLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRV-FTATERVQF 429

Query: 557 --WDIAADNFRIVSGSHDK-SIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
               +      + +GS D   + VW +Q G+ + T +GH+ P+ C+  
Sbjct: 430 TCLAVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAF 477

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 86/212 (40%), Gaps = 41/212 (19%)

Query: 374 IRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY-TLRGH 430
           + V+ + + S I   +GH D+   L+       +V+A+ D  +KVW V S  C  T   H
Sbjct: 323 LLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEH 382

Query: 431 TEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENL 490
           T  V  V+   K    +S+S D T+R WD+      +VF        + +  T    E  
Sbjct: 383 TSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTA-----TERVQFTCLAVE-- 435

Query: 491 VVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF 550
                    P+ E+    + D   +F                    +W V +G+ + T  
Sbjct: 436 ---------PSGEVVSAGSTDSFDVF--------------------VWSVQTGQLLDTLS 466

Query: 551 GHVEGVWDIA--ADNFRIVSGSHDKSIKVWDL 580
           GH   V  +A   +N  + S S DK+I++W +
Sbjct: 467 GHEGPVSCLAFSMENAVLASASWDKTIRIWSI 498

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 19/137 (13%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIR----RLTGHTD 353
           +G C +  F+ H   V +++F  +  +LF+ S D TV  WD     LIR    R+   T+
Sbjct: 372 SGFC-LATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWD-----LIRYRNFRVFTATE 425

Query: 354 GVK----GIYFDDQKMITASLDK-TIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIV 406
            V+     +    + +   S D   + VW+  TG  + T  GH+  V  L+      ++ 
Sbjct: 426 RVQFTCLAVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLA 485

Query: 407 SASADKTVKVWHVESRT 423
           SAS DKT+++W +  R+
Sbjct: 486 SASWDKTIRIWSIFGRS 502

>Kwal_23.6429
          Length = 750

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/331 (22%), Positives = 133/331 (40%), Gaps = 58/331 (17%)

Query: 311 HMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITA 368
           H   V  ++F+H    L TG  + T  ++   +G LI RL+           +D     +
Sbjct: 399 HSSVVCCVRFSHDGEFLATGC-NKTTQVYKVSTGELIARLS-----------EDASSAPS 446

Query: 369 SLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVESR-TCY 425
             D +    N      ++T       + SV      K + + + DK +++W + +R    
Sbjct: 447 GADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVM 506

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC------------IKVFRG-- 471
           TL+GH + +  +   P      S S D+T+R+WD+RT  C            + V  G  
Sbjct: 507 TLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDG 566

Query: 472 ---HVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH-LL 527
                G + + +   I D+E   + E+++     EL     D    +         H ++
Sbjct: 567 KLIAAGSLDRTV--RIWDSETGFLVERLDS--ENELGTGHKDSVYSVV---FTRDGHGVV 619

Query: 528 SCSLDNTIKLWEVSSGRCIR------------TQFGHVEGVWDIAA---DNFRIVSGSHD 572
           S SLD ++KLW + S                 T  GH + V  +A    D F I+SGS D
Sbjct: 620 SGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEF-ILSGSKD 678

Query: 573 KSIKVWDLQNGKCIQTFTGHKAPIVCVGIGD 603
           + +  WD  +G  +    GH+  ++ V + +
Sbjct: 679 RGVLFWDTPSGNPLLMLQGHRNSVISVAVAN 709

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 94/204 (46%), Gaps = 32/204 (15%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD- 361
           +   +GH   + SL +  +   L +GS D TV IWD ++G     L+   DGV  +    
Sbjct: 505 VMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIE-DGVTTVAVSP 563

Query: 362 -DQKMITA-SLDKTIRVWNYITGSCISTY-------RGHQDSVLSV----DSYKKIIVSA 408
            D K+I A SLD+T+R+W+  TG  +           GH+DSV SV    D +   +VS 
Sbjct: 564 GDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG--VVSG 621

Query: 409 SADKTVKVWHVESR-------------TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTL 455
           S D++VK+W++ S              +  T  GH ++V  V          S S D+ +
Sbjct: 622 SLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGV 681

Query: 456 RMWDIRTNSCIKVFRGHVGQVQKV 479
             WD  + + + + +GH   V  V
Sbjct: 682 LFWDTPSGNPLLMLQGHRNSVISV 705

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 114/291 (39%), Gaps = 76/291 (26%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDD-QKMITASLDKTIRVWNYI 380
           + L TG+ D  + IWD  +  ++  L GH   +  + YF    K+++ S D+T+R+W+  
Sbjct: 483 KFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 542

Query: 381 TGSCISTYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESRTCYTLR--------- 428
           TG C  T    +D V +V       K+I + S D+TV++W  +S T + +          
Sbjct: 543 TGQCSLTLS-IEDGVTTVAVSPGDGKLIAAGSLDRTVRIW--DSETGFLVERLDSENELG 599

Query: 429 -GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR------------TNSCIKVFRGHVGQ 475
            GH + V  V          S S D+++++W++R            T +    + GH   
Sbjct: 600 TGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGH--- 656

Query: 476 VQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTI 535
             K   L++  T+N   DE I                              LS S D  +
Sbjct: 657 --KDFVLSVATTQN---DEFI------------------------------LSGSKDRGV 681

Query: 536 KLWEVSSGRCIRTQFGHVEGVWDIAADNFR--------IVSGSHDKSIKVW 578
             W+  SG  +    GH   V  +A  N            +GS D   ++W
Sbjct: 682 LFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 56/102 (54%), Gaps = 10/102 (9%)

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNF----RIVSGSH 571
           F P+ K+   L + + D  I++W++++ R + T  GH + ++ +  D F    ++VSGS 
Sbjct: 478 FSPDGKF---LATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSL--DYFPSGDKLVSGSG 532

Query: 572 DKSIKVWDLQNGKCIQTFTGHKA-PIVCVGIGDSSFVSGDEL 612
           D+++++WDL+ G+C  T +       V V  GD   ++   L
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSL 574

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 63/143 (44%), Gaps = 24/143 (16%)

Query: 306 QLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRR------------LTGH 351
           +L  GH D V S+ F      + +GS D +V +W+ +S N                 TGH
Sbjct: 597 ELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGH 656

Query: 352 TDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK------- 402
            D V  +    +D+ +++ S D+ +  W+  +G+ +   +GH++SV+SV           
Sbjct: 657 KDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPE 716

Query: 403 -KIIVSASADKTVKVWHVESRTC 424
             +  + S D   ++W    +T 
Sbjct: 717 YGVFATGSGDCKARIWKYSKQTS 739

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 129/282 (45%), Gaps = 51/282 (18%)

Query: 348 LTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC----ISTYRGHQDSVLSVDSYKK 403
            T +T+  K  Y     ++TAS D  I V+ +++  C    I +  GH+  V +V  ++K
Sbjct: 208 FTNYTNSSKKNYL---VIVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIVSAVKIWQK 264

Query: 404 ----IIVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
                I S S D+TVK+W   +  +  T + H++WV  + +        S S D TLR+ 
Sbjct: 265 NNDVHIASCSRDQTVKIWDFHNGWSLKTFQPHSQWVRSIDVLGDYII--SGSHDTTLRLT 322

Query: 459 DIRTNSCIKVFRGHVGQVQKVIPL-TIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
              + + + V  GH   ++KV  +  I+D+  +       + P+ +  +++         
Sbjct: 323 HWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEIRF-----RTPSTDRYKNWG-------- 369

Query: 518 PNLKYPTHLLSCSLDNTIKLWEV-----------------SSGRCIRTQFGHVEGVWDIA 560
             ++Y    +S S D TIK+WE+                 S+ RC+ T  GH+  V DI+
Sbjct: 370 --MQY---CVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWVRDIS 424

Query: 561 ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTG-HKAPIVCVGI 601
                + S + DKS++ WDL  G+C+  +   H   + C+ +
Sbjct: 425 IRGQYLFSCADDKSVRCWDLNTGQCLHVWEKLHTGFVNCLDL 466

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 100/228 (43%), Gaps = 51/228 (22%)

Query: 298 WRNGRCRIQLFK---GHMDGVLSLKF----NHRLLFTGSYDSTVAIWDTKSGNLIRRLTG 350
           W +  C+ Q  +   GH   V ++K     N   + + S D TV IWD  +G  ++    
Sbjct: 236 WVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQP 295

Query: 351 HTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--------------- 395
           H+  V+ I      +I+ S D T+R+ ++ +G+ +S   GH+  +               
Sbjct: 296 HSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEI 355

Query: 396 ----LSVDSYK----KIIVSASADKTVKVWHV------------------ESRTCYTLRG 429
                S D YK    +  VSAS D+T+K+W +                    R   TL+G
Sbjct: 356 RFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKG 415

Query: 430 HTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF-RGHVGQV 476
           H  WV  + +  +    +S +DDK++R WD+ T  C+ V+ + H G V
Sbjct: 416 HLSWVRDISIRGQYL--FSCADDKSVRCWDLNTGQCLHVWEKLHTGFV 461

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/267 (20%), Positives = 112/267 (41%), Gaps = 67/267 (25%)

Query: 317 SLKFNHRLLFTGSYDSTVAI--WDTKSGNL--IRRLTGHTDGVKGIYF----DDQKMITA 368
           S K N+ ++ T S D  + +  W ++      IR L GH   V  +      +D  + + 
Sbjct: 214 SSKKNYLVIVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASC 273

Query: 369 SLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTL- 427
           S D+T+++W++  G  + T++ H   V S+D     I+S S D T+++ H  S    ++ 
Sbjct: 274 SRDQTVKIWDFHNGWSLKTFQPHSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVG 333

Query: 428 RGH------TEWVNCVKLHPK---------------SFTCYSSSDDKTLRMWDIRTNSCI 466
            GH       ++++ ++  P+                  C S+S D+T+++W+I     +
Sbjct: 334 TGHEFPIEKVKFIHFIEDSPEIRFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIP----L 389

Query: 467 KVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYP--- 523
                H                          +PNP  + +F   C      +L +    
Sbjct: 390 PTLMAHRA-----------------------PIPNPT-DSNFR--CVLTLKGHLSWVRDI 423

Query: 524 ----THLLSCSLDNTIKLWEVSSGRCI 546
                +L SC+ D +++ W++++G+C+
Sbjct: 424 SIRGQYLFSCADDKSVRCWDLNTGQCL 450

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 526 LLSCSLDNTIKLWEVSSGRC----IRTQFGHVEGVWDIAA----DNFRIVSGSHDKSIKV 577
           +++ S D  I +++  S  C    IR+  GH   V  +      ++  I S S D+++K+
Sbjct: 222 IVTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKI 281

Query: 578 WDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSG 609
           WD  NG  ++TF  H   +  + +     +SG
Sbjct: 282 WDFHNGWSLKTFQPHSQWVRSIDVLGDYIISG 313

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 46/112 (41%), Gaps = 12/112 (10%)

Query: 271 AARARNSRYYTRPWKVIYRERFQVESNW-RNGRCRIQLFKGHMDGVLSLKFNHRLLFTGS 329
           A+R R  + +  P   +   R  + +    N RC + L KGH+  V  +    + LF+ +
Sbjct: 376 ASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTL-KGHLSWVRDISIRGQYLFSCA 434

Query: 330 YDSTVAIWDTKSGNLIRRLTG-HTDGVKGIYFD---------DQKMITASLD 371
            D +V  WD  +G  +      HT  V  +  D          Q M+T  LD
Sbjct: 435 DDKSVRCWDLNTGQCLHVWEKLHTGFVNCLDLDVDFDSNVTPRQMMVTGGLD 486

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 117/280 (41%), Gaps = 62/280 (22%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLT-GHTDGVKGIYF--DDQKMITASLDKTIRVWNY- 379
           L+  G+    + ++D  S  ++  +   HT  +  +    D ++++TAS DKT++ W++ 
Sbjct: 438 LVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497

Query: 380 -----ITGSC---ISTYRGHQDSVL---------SVDSYKKIIVSASADKTVKVWHVESR 422
                + G+    +   +   D+ L          +    + +  +  D TVKV+ ++S 
Sbjct: 498 VEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSM 557

Query: 423 TCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP 481
             + +L GH   V  + +   S    +SS DK +++W +    C K    H   +  V  
Sbjct: 558 KFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF 617

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVS 541
           L                   PE    F                   SCS D T+K W+ +
Sbjct: 618 L-------------------PESHNFF-------------------SCSKDGTVKYWDGN 639

Query: 542 SGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWD 579
           S  CI+  +GH   VW +A  +D   +VS SHD+SI+VW+
Sbjct: 640 SFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 90/182 (49%), Gaps = 21/182 (11%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWDTK------SGNLIR-----RLTGHTDGVKG------- 357
           L L  + + L T S D TV  WD K      +G L +     +L   T    G       
Sbjct: 473 LDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVK 532

Query: 358 IYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVK 415
           I  +D+ +  + LD T++V+   +     +  GH+  VLS+D     K+I+++SADK +K
Sbjct: 533 ISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIK 592

Query: 416 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG 474
           +W ++   C+ +L  H + +  VK  P+S   +S S D T++ WD  +  CI+   GH G
Sbjct: 593 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQG 652

Query: 475 QV 476
           +V
Sbjct: 653 EV 654

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 95/203 (46%), Gaps = 24/203 (11%)

Query: 288 YRERFQVESNWRNGRCRIQ---------LFKGHMDGVLSLKFNHR--LLFTGSYDSTVAI 336
           + E F +   + +G  +I          +F  H   +  L+F+     L +GS D+T+ +
Sbjct: 84  HEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIIL 143

Query: 337 WDTKSGNLIRRLTGHTDGVKGIYFD-DQKMITASLDKTIRVWNYITGSCISTYRGHQDSV 395
           WD  +   + +L  H D + GI+ + D  +I+ S D  I++W+     C+ T+  H    
Sbjct: 144 WDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGEC 203

Query: 396 LSVDSYKKIIVSASADKTVKVWHVE----SRTCYTLRGHTEWVNCVKLHPKSFTC----- 446
            S+     ++++A+A+  +K+W ++    + +    +G  E  +  +    SFT      
Sbjct: 204 WSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKGSYEKQSKQRCTELSFTTVADGT 263

Query: 447 ---YSSSDDKTLRMWDIRTNSCI 466
              YS + DKT+ ++ IR+ + I
Sbjct: 264 TFFYSLNSDKTMEIFRIRSETEI 286

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 6/114 (5%)

Query: 310 GHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKM 365
           GH   VLS+  +H  +L+ T S D  + IW    G+  + L  H D +  + F  +    
Sbjct: 565 GHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNF 624

Query: 366 ITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVW 417
            + S D T++ W+  +  CI    GHQ  V  L+V S  + +VS S D++++VW
Sbjct: 625 FSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVW 678

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 89/232 (38%), Gaps = 55/232 (23%)

Query: 364 KMITASLDKTIRVWNYITGSCISTYRG--------------HQDSVLSVDSYKKIIVSAS 409
           ++IT +L++ ++ W   TG  + T R                + + L       I+    
Sbjct: 36  QVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGY 94

Query: 410 ADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKV 468
           AD T+K+W ++++T       H+  +  ++         S S D T+ +WD+   + +  
Sbjct: 95  ADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCK 154

Query: 469 FRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLS 528
            R H                                     D  TGI+  N  +   L+S
Sbjct: 155 LRSH------------------------------------KDAITGIWCENDDW---LIS 175

Query: 529 CSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDL 580
            S D  IKLW++   +C+ T   H    W +A  +  +++ + +  IK+W+L
Sbjct: 176 VSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWEL 227

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 64/142 (45%), Gaps = 5/142 (3%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG--IYFDDQKMITASLDKTIRVWNYI 380
           R L     D+TV ++   S      L GH   V    I  D + +IT+S DK I++W   
Sbjct: 538 RFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLD 597

Query: 381 TGSCISTYRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVESRTCY-TLRGHTEWVNCV 437
            G C  +   HQDS+++V    +     S S D TVK W   S  C   L GH   V  +
Sbjct: 598 FGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWAL 657

Query: 438 KLHPKSFTCYSSSDDKTLRMWD 459
            +        S S D+++R+W+
Sbjct: 658 AVSSDGQAVVSVSHDRSIRVWE 679

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 116/259 (44%), Gaps = 35/259 (13%)

Query: 350 GHTDGVKG--IYFDDQKMITASLDKTIRVWNYITGSCISTYR-GHQDSVLSVDSYKKIIV 406
           GH   ++   I  DD+ + TAS +  ++VWN  T +CI     G+      +     +I+
Sbjct: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVIL 441

Query: 407 SASADKTVKVWHVESRTCY--TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS 464
              A + ++++ + S T        HT  +  + L        ++S DKT++ WD +   
Sbjct: 442 GTRAGQ-LQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQ 500

Query: 465 CIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADD--CTGIFDPNLKY 522
            +       G + K +P             K++ + +  L  D  +D  C  I  P  ++
Sbjct: 501 ELVA-----GTLDKFVP-------------KMKLIHDTTL--DLGEDLWCVKI-SPEDRF 539

Query: 523 PTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDL 580
              L    LDNT+K++ + S +   + +GH   V   DI+ D+  I++ S DK+IK+W L
Sbjct: 540 ---LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGL 596

Query: 581 QNGKCIQTFTGHKAPIVCV 599
             G C ++   H+  I+ V
Sbjct: 597 DFGDCHKSLFAHQDSIMNV 615

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 84/190 (44%), Gaps = 24/190 (12%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRL----------TGHTDGVKGIY--FDDQKMITAS--L 370
           + TG+ +  V  W+ K+G L++ +          T      +  Y  + ++  I A    
Sbjct: 37  VITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYA 95

Query: 371 DKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY-TL 427
           D TI++W+  T + +  +  H  ++  L  D     ++S S D T+ +W + + T    L
Sbjct: 96  DGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKL 155

Query: 428 RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDT 487
           R H + +  +      +   S S D  +++WD++ + C++    H G+      L +KD 
Sbjct: 156 RSHKDAITGIWCENDDW-LISVSKDGLIKLWDMKVHQCVETHMAHTGECWS---LAVKD- 210

Query: 488 ENLVVDEKIE 497
            N+V+    E
Sbjct: 211 -NMVITANAE 219

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 76/177 (42%), Gaps = 43/177 (24%)

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKI 496
           ++ H ++F       D T+++WD++T + + VF  H   +      TI            
Sbjct: 81  LQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI------TI------------ 122

Query: 497 EKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV--SSGRC-IRTQFGHV 553
                         D TG         T L+S S D TI LW++   +G C +R+    +
Sbjct: 123 -----------LRFDQTG---------TRLISGSRDATIILWDLVAETGLCKLRSHKDAI 162

Query: 554 EGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGD 610
            G+W    ++  ++S S D  IK+WD++  +C++T   H      + + D+  ++ +
Sbjct: 163 TGIW--CENDDWLISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITAN 217

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 15/91 (16%)

Query: 523 PTHLLSCSLDNTIKLWEVSSGRCIRT-QFGHVEGVWDIAAD-------------NFRIVS 568
           P  +++ +L+  +K WE+ +G  ++T + G   G  D  A+              F +  
Sbjct: 34  PGQVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92

Query: 569 GSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           G  D +IK+WD+Q    +  F  H + I  +
Sbjct: 93  GYADGTIKIWDMQTQTVLIVFHSHSSAITIL 123

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 31/222 (13%)

Query: 390 GHQDSVLSVD--SYKKIIVSASADKTVKVWHVESRTCYTLRG-HTEWVNCVKLHPKSFTC 446
           GH+  + + D  S  K++ +AS +  +KVW+++++TC  +R     +  C K  P     
Sbjct: 383 GHRTDLRAADISSDDKLLATAS-NGNLKVWNIKTKTC--IRNLDCGYALCCKFLPGGALV 439

Query: 447 YSSSDDKTLRMWDIRTNSCIK-VFRGHVGQVQKVIPLTIKDTENLVVD--EKIEKVPNPE 503
              +    L+++D+ +++ ++ +   H   +   + LT  D + LV    +K  K  + +
Sbjct: 440 ILGTRAGQLQLFDLASSTMLENIEEAHTAAIWS-LDLT-SDGKRLVTASADKTVKFWDFK 497

Query: 504 LEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADN 563
           +E++        F P +K    +   +LD    LW      C++              D 
Sbjct: 498 VEQELVAGTLDKFVPKMKL---IHDTTLDLGEDLW------CVKIS----------PEDR 538

Query: 564 FRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSS 605
           F  VS   D ++KV+ L + K   +  GHK P++ + I   S
Sbjct: 539 FLAVS-LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDS 579

>Kwal_23.5351
          Length = 474

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 114/276 (41%), Gaps = 23/276 (8%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTG-HTDGVKGIYF--DDQKMITASLDKTIRVWNYIT 381
           L  GS++  V I   +S  ++R L G H D + G+ +  D Q + T   D  +++WN   
Sbjct: 197 LAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQA 256

Query: 382 GSCIST----YRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLR-GHTEWV 434
            S         RGH+  V  V  +   + + SAS D T ++W VE  T   L+ GH + V
Sbjct: 257 QSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEV 316

Query: 435 NCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV--------IPLTIKD 486
            C+          S+  D    +WD+RT   + V  GH   +  V        +     D
Sbjct: 317 YCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGD 376

Query: 487 TENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCI 546
               V D +    P+  L  +           N  +   L+S S D TI ++   S   +
Sbjct: 377 GTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNF---LVSSSYDRTIGVFATGSWIKL 433

Query: 547 RTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWDL 580
            +  GH + +   DI+     + S   D+S+K+W L
Sbjct: 434 ASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 92/219 (42%), Gaps = 47/219 (21%)

Query: 390 GHQDSVLSV--DSYKKIIVSASADKTVKVWHVESRTC-----YTLRGHTEWVNCVKLHPK 442
            H D +  V   S  +++ +  AD  VK+W+ ++++        LRGH   V+ VK HP 
Sbjct: 223 AHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPS 282

Query: 443 SFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
                S+S D T R+WD+   + +++  GH  +V  +                       
Sbjct: 283 DRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCL----------------------- 319

Query: 503 ELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--A 560
               DF   C G           L S  LD+   +W++ +GR +    GH + ++ +  +
Sbjct: 320 ----DF--QCDGSL---------LCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWS 364

Query: 561 ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
            +   + +GS D +++VWD++      +   H + +  V
Sbjct: 365 PNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEV 403

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 83/170 (48%), Gaps = 8/170 (4%)

Query: 303 CRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360
             +QL +GH   V  L F  +  LL +   DS   +WD ++G  +  L GH   + G+ +
Sbjct: 304 TELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSW 363

Query: 361 --DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVK 415
             +   + T S D T++VW+    +  S+   H   V  V+  K+    +VS+S D+T+ 
Sbjct: 364 SPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIG 423

Query: 416 VWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS 464
           V+   S     +L+GHT+ +  V +       +SS  D+++++W +   S
Sbjct: 424 VFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVRS 473

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 71/134 (52%), Gaps = 12/134 (8%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           R GR  + + +GH   +  + +  N   + TGS D TV +WD +  N    +  H   V 
Sbjct: 343 RTGRS-LMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVS 401

Query: 357 GIYFDDQK---MITASLDKTIRVWNYITGSCI--STYRGHQDSVLSVDSYK--KIIVSAS 409
            + F+ +    ++++S D+TI V  + TGS I  ++ +GH D +LSVD  +    + S+ 
Sbjct: 402 EVNFEKENGNFLVSSSYDRTIGV--FATGSWIKLASLQGHTDKILSVDISRGGANLWSSG 459

Query: 410 ADKTVKVWHVESRT 423
            D++VK+W +  R+
Sbjct: 460 WDRSVKIWALGVRS 473

>Scas_720.83d
          Length = 915

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 79/160 (49%), Gaps = 7/160 (4%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYIT 381
           L F  S    + +++ +S + I +  GH D    + +  D  +++TA+ D  I+VW+ ++
Sbjct: 315 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVS 374

Query: 382 GSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVESRTCYTLRGHTEWV--NCV 437
           G C++T++ H  SV  V   K+  ++ S+S D TV+ W +     +      E +  NC+
Sbjct: 375 GFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCL 434

Query: 438 KLHPKS-FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
            + P     C  S D+  + +W ++T   +    GH G V
Sbjct: 435 AVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPV 474

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 9/161 (5%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QK 364
           +GH D   SL +  +   + T + D  + +WD  SG  +     HT  V  + F    Q 
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQV 399

Query: 365 MITASLDKTIRVWNYITGSCISTYRGH---QDSVLSVDSYKKIIVSASADK-TVKVWHVE 420
           + ++SLD T+R W+ I      T+      Q + L+VD   +++ + S D   + VW V+
Sbjct: 400 LFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 459

Query: 421 S-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           + +   TL GH   V+C+    ++    S+S DKT+R+W I
Sbjct: 460 TGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSI 500

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 76/195 (38%), Gaps = 49/195 (25%)

Query: 414 VKVWHVESRTCYTLR--GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
           V  W  ES   Y L+  GH +  N +   P      ++++D  +++WD+ +  C+  F+ 
Sbjct: 327 VYEWQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQE 383

Query: 472 HVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSL 531
           H   V +V                            FA           K    L S SL
Sbjct: 384 HTSSVTQV---------------------------QFA-----------KRGQVLFSSSL 405

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGV----WDIAADNFRIVSGSHDK-SIKVWDLQNGKCI 586
           D T++ W++   R  RT F   E +      +      + +GS D   I VW +Q G+ +
Sbjct: 406 DGTVRAWDLIRYRNFRT-FTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLL 464

Query: 587 QTFTGHKAPIVCVGI 601
            T +GH+ P+ C+  
Sbjct: 465 DTLSGHEGPVSCLAF 479

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 89/213 (41%), Gaps = 43/213 (20%)

Query: 374 IRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCY-TLRGH 430
           + V+ + + S I   +GH D+   L+       +V+A+ D  +KVW V S  C  T + H
Sbjct: 325 LLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEH 384

Query: 431 TEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENL 490
           T  V  V+   +    +SSS D T+R WD+      + F     ++Q            L
Sbjct: 385 TSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTA-AERIQ---------FNCL 434

Query: 491 VVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDN-TIKLWEVSSGRCIRTQ 549
            VD   E V            C G               SLDN  I +W V +G+ + T 
Sbjct: 435 AVDPSGEVV------------CAG---------------SLDNFDIHVWSVQTGQLLDTL 467

Query: 550 FGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDL 580
            GH   V  +A   +N  + S S DK+++VW +
Sbjct: 468 SGHEGPVSCLAFSQENSVLASASWDKTVRVWSI 500

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 62/136 (45%), Gaps = 17/136 (12%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG 357
           +G C +  F+ H   V  ++F  R  +LF+ S D TV  WD       R  T      + 
Sbjct: 374 SGFC-LATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTA----AER 428

Query: 358 IYFD-------DQKMITASLDK-TIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVS 407
           I F+        + +   SLD   I VW+  TG  + T  GH+  V  L+      ++ S
Sbjct: 429 IQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLAS 488

Query: 408 ASADKTVKVWHVESRT 423
           AS DKTV+VW +  R+
Sbjct: 489 ASWDKTVRVWSIFGRS 504

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 99/252 (39%), Gaps = 42/252 (16%)

Query: 388 YRGHQDSVLSV----DSYKKIIVSASADKTVKVWHVESR----TCYTLRGHTEWVNCVKL 439
           + GH   +LS+    DS  + I+S S D T ++W ++S        T  GH ++V     
Sbjct: 142 HAGHFQDILSLTWSLDS--RFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFF 199

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTNSCI--------------------KVFRGHVGQVQ-- 477
                  Y+ S D  L +W+    S                      ++ + H       
Sbjct: 200 SADQEKIYTVSKDGALFVWEFTKKSTDDEDDDDEEEEEDIDISKYSWRITQKHFFYANQC 259

Query: 478 KVIPLTIKDTENLVV------DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLS--C 529
           KV  +T     N++V      + ++ ++P+  L +  +     I    +      L+   
Sbjct: 260 KVKCVTFHAPSNMLVVGFTNGEFRLYELPHFTLLQQLSMGQNPINTVAVNSSGEWLAFGS 319

Query: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQ 587
           S    + ++E  S   I  Q GH +    +  + D  R+V+ + D  IKVWD+ +G C+ 
Sbjct: 320 SKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLA 379

Query: 588 TFTGHKAPIVCV 599
           TF  H + +  V
Sbjct: 380 TFQEHTSSVTQV 391

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 88/182 (48%), Gaps = 21/182 (11%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIW------------DTKSGNLIRRLTGHT-----DGVKGI 358
           L L  + R L TGS D TV  W              K+  +++     T     D +  +
Sbjct: 476 LDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVV 535

Query: 359 YFDDQKMITASL-DKTIRVWNYITGSCISTYRGHQDSVLSVD-SY-KKIIVSASADKTVK 415
              D K I  SL D T++V+   +     +  GH+  VLS+D SY  K+IV+ SADK +K
Sbjct: 536 ISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIK 595

Query: 416 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG 474
           +W ++   C+ +L  H + +  VK  P+S+  +S S D T++ WD +   CI+    H  
Sbjct: 596 IWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQS 655

Query: 475 QV 476
           +V
Sbjct: 656 EV 657

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 105/280 (37%), Gaps = 62/280 (22%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV---KGIYFDDQKMITASLDKTIRVWNYI 380
           L+  G+ +  + ++D  S  ++    G  D       +  D +K++T S DKT+R W + 
Sbjct: 441 LVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFE 500

Query: 381 TGSCISTYRGHQ----------------DSVLSV--DSYKKIIVSASADKTVKVWHVESR 422
                 +   ++                D +LSV      K I  +  D TVKV+ ++S 
Sbjct: 501 VSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSM 560

Query: 423 TCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP 481
             + +L GH   V  + +   S    + S DK +++W +    C K    H   +  V  
Sbjct: 561 KFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKF 620

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVS 541
           L                   PE                     +  SCS D T+K W+  
Sbjct: 621 L-------------------PE-------------------SYNFFSCSKDATVKYWDGQ 642

Query: 542 SGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIKVWD 579
              CI+    H   VW I+   D   ++S  HD SI+VW+
Sbjct: 643 KFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 54/277 (19%), Positives = 115/277 (41%), Gaps = 35/277 (12%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           DD K++  + + ++++WN  T  CI ++               ++V  + +  ++++ + 
Sbjct: 398 DDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIA 457

Query: 421 SRTCYTLR--GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
           S T    +   H   +  + L        + S DKT+R W    +           +  K
Sbjct: 458 SSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEV-----PVSDESNK 512

Query: 479 VIPLT--IKDTENLVVDEKIEKVPNPE---LEEDFADDCTGIF----------------- 516
            +P+     DT   + D+ +  V +P+   +     D+   +F                 
Sbjct: 513 TMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 572

Query: 517 --DPNLKYPTHLL-SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSH 571
               ++ Y + L+ +CS D  IK+W +  G C ++ F H + + ++    +++   S S 
Sbjct: 573 VLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSK 632

Query: 572 DKSIKVWDLQNGKCIQTFTGHKAPIVCVGIG-DSSFV 607
           D ++K WD Q  +CIQ    H++ +  + +  D +FV
Sbjct: 633 DATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFV 669

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 60/116 (51%), Gaps = 3/116 (2%)

Query: 308 FKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK- 364
           F GH   +  L F+     L + S DS + +WD    + + +L  H D + G++ +D+  
Sbjct: 117 FNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENW 176

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           +I+ S D  +++W+  +  C+ T+  H     S+   + + V+ SAD  VK+W ++
Sbjct: 177 LISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLD 232

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 79/159 (49%), Gaps = 18/159 (11%)

Query: 334 VAIWDTKSGNLIRRLT-----GHTDGVKG--------IYFDDQKMITASL-DKTIRVWNY 379
           + +WD K+G  I +LT     G +D             Y  +  ++ A   D  I++W+ 
Sbjct: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108

Query: 380 ITGSCISTYRGHQDS--VLSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNC 436
           I+ + + ++ GH+ +  VL+ D+    ++SAS D  + VW +   +  Y LR H + +  
Sbjct: 109 ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITG 168

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQ 475
           +    +++   S+S D  +++WD+++  C++    H G+
Sbjct: 169 LWCEDENW-LISTSKDGLVKIWDLKSQQCVETHLAHTGE 206

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 6/141 (4%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QKMITASLDKTIRVWNYIT 381
           LL  G  D  + IWD  S  ++    GH   +  + FD    ++I+AS D  I VW+ + 
Sbjct: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152

Query: 382 GSCISTYRGHQDSVLSV-DSYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKL 439
            S +   R H+D++  +    +  ++S S D  VK+W ++S+ C  T   HT    C  L
Sbjct: 153 ESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTG--ECWSL 210

Query: 440 HPKSFTCYSSSDDKTLRMWDI 460
                   + S D  +++W +
Sbjct: 211 GIIEDMAVTCSADSQVKLWKL 231

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 70/156 (44%), Gaps = 11/156 (7%)

Query: 313 DGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG--IYFDDQKMITA 368
           D +LS+    + + +     D+TV ++   S      L GH   V    I +D + ++T 
Sbjct: 529 DDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTC 588

Query: 369 SLDKTIRVWNYITGSCISTYRGHQDSVLSV----DSYKKIIVSASADKTVKVWHVESRTC 424
           S DK I++W    G C  +   HQDS+++V    +SY     S S D TVK W  +   C
Sbjct: 589 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYN--FFSCSKDATVKYWDGQKFEC 646

Query: 425 Y-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
              L  H   V  + +        S+  D ++R+W+
Sbjct: 647 IQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE 682

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 80/222 (36%), Gaps = 54/222 (24%)

Query: 374 IRVWNYITGSCISTYR-----GHQDSVLSVDSYK---------KIIVSASADKTVKVWHV 419
           I VW+  TG  I+        G  D+ LS  +            ++ +  AD  +K+W +
Sbjct: 49  ILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDL 108

Query: 420 ESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
            S+T   +  GH   +  +          S+S D  + +WD+   S +   R H      
Sbjct: 109 ISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSH------ 162

Query: 479 VIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLW 538
                                          D  TG++  +  +   L+S S D  +K+W
Sbjct: 163 ------------------------------KDAITGLWCEDENW---LISTSKDGLVKIW 189

Query: 539 EVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDL 580
           ++ S +C+ T   H    W +       V+ S D  +K+W L
Sbjct: 190 DLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKL 231

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 69/168 (41%), Gaps = 43/168 (25%)

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKI 496
           +K HP++    +   D  +++WD+ + + +  F GH   +  +                 
Sbjct: 85  LKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAITVL----------------- 127

Query: 497 EKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV---SSGRCIRTQFGHV 553
                       A D TG         T L+S S D+ I +W++   S    +R+    +
Sbjct: 128 ------------AFDTTG---------TRLISASKDSDIIVWDLVGESGLYKLRSHKDAI 166

Query: 554 EGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
            G+W    D   ++S S D  +K+WDL++ +C++T   H      +GI
Sbjct: 167 TGLW--CEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGI 212

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 133/313 (42%), Gaps = 53/313 (16%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYIT 381
           L F  S    + +++ +S + I +  GH D + G+ +  D  K++TAS +  I++W+  +
Sbjct: 313 LAFGSSKLGQLIVYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVAS 372

Query: 382 GSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVESRTCYTLRGHTEWV--NCV 437
           G C++T+  H   V +V+  KK  ++ SAS D TVK W +     +     TE +  N +
Sbjct: 373 GFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSL 432

Query: 438 KLHPKS-FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKI 496
            + P     C  S D   + +W ++T   +    GH G +     L+  +   ++     
Sbjct: 433 AVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPIS---CLSFSNENGVLASASW 489

Query: 497 EKV----------PNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCI 546
           +K              E  E F+D  +    P+ +    + + +L   I  ++V+ G+  
Sbjct: 490 DKTIRVWSLFGRSQQVEPFEVFSDVLSISMKPDGQ---QIAASTLAGQILFFDVAEGK-- 544

Query: 547 RTQFGHVEGVWDIAA--------------------------DNFRIVSGSHDKSIKVWDL 580
             Q G+++G  DI +                          D   +V+  ++ SI ++D+
Sbjct: 545 --QVGNIDGKRDIISGRHLEDRFTSESSARSKYFTTIHYSFDGLSLVAAGNNNSICLYDI 602

Query: 581 QNGKCIQTFTGHK 593
            N   ++ FT  K
Sbjct: 603 PNEVLLRRFTVSK 615

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 81/201 (40%), Gaps = 49/201 (24%)

Query: 414 VKVWHVESRTCYTLR--GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
           V  W  ES   Y L+  GH + +N +   P      ++S +  +++WD+ +  C+  F  
Sbjct: 325 VYEWQSES---YILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDE 381

Query: 472 HVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSL 531
           H G V  V                           +FA           K    L S SL
Sbjct: 382 HAGGVSAV---------------------------EFA-----------KKGQVLFSASL 403

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVW--DIAAD--NFRIVSGSHDK-SIKVWDLQNGKCI 586
           D T+K W++   R  RT F   E +    +A D     + +GS D   I VW +Q G+ +
Sbjct: 404 DGTVKAWDLIRYRNFRT-FTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLV 462

Query: 587 QTFTGHKAPIVCVGIGDSSFV 607
            T +GH+ PI C+   + + V
Sbjct: 463 DTLSGHEGPISCLSFSNENGV 483

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 64/165 (38%), Gaps = 50/165 (30%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQK 364
           +GH D +  L +  +   + T S++  + IWD  SG  +     H  GV  + F    Q 
Sbjct: 338 QGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQV 397

Query: 365 MITASLDKTIRVWNYI-------------------------------------------- 380
           + +ASLD T++ W+ I                                            
Sbjct: 398 LFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQ 457

Query: 381 TGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRT 423
           TG  + T  GH+  +  LS  +   ++ SAS DKT++VW +  R+
Sbjct: 458 TGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWSLFGRS 502

>Kwal_55.22067
          Length = 451

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 80/167 (47%), Gaps = 10/167 (5%)

Query: 306 QLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDGVKGIYFD- 361
            + + H   V  +K++H    L +G  D T+ IW   + N+++ L   HT  ++GI F  
Sbjct: 119 SIMQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQ-PNFNMVKVLDEAHTQCIRGISFSG 177

Query: 362 -DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWH 418
            D K +T S D  +++WN+  G   ST  GH   V S D +    +I S S D  VK+W 
Sbjct: 178 TDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWD 237

Query: 419 VESRTCY-TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTN 463
             +  C  T+ G    +   K  P K       S DK+ R++DIR N
Sbjct: 238 PRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQN 284

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-----IVSGSHDKSIKVWDL 580
            ++CS DN +K+W  S+G+   T  GH    WD+ + ++      I SGS D  +K+WD 
Sbjct: 182 FVTCSDDNILKIWNFSNGQQESTLSGHH---WDVRSCDWHPTMGLIASGSKDNLVKLWDP 238

Query: 581 QNGKCIQTFTGHKAPIV 597
           + G+CI T  G K  I+
Sbjct: 239 RAGQCISTILGCKHTII 255

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 91/242 (37%), Gaps = 57/242 (23%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI---IVSASADKTVKVW 417
           + ++++ A+      +WN  T +  S  + H DS ++V  Y      ++S  +D T+K+W
Sbjct: 94  EGRRLVVATYSGEFSLWNGSTFNFESIMQAH-DSAVAVMKYSHAGDWLISGDSDGTIKIW 152

Query: 418 HVESRTCYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
                    L   HT+ +  +          + SDD  L++W+           GH   V
Sbjct: 153 QPNFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDV 212

Query: 477 QKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIK 536
           +                                  C   + P +     + S S DN +K
Sbjct: 213 RS---------------------------------CD--WHPTMGL---IASGSKDNLVK 234

Query: 537 LWEVSSGRCIRTQFG--HVEGVWDIAADNFRIVSG------SHDKSIKVWDL-QNGKCIQ 587
           LW+  +G+CI T  G  H      I +  F+   G      S DKS +++D+ QN K + 
Sbjct: 235 LWDPRAGQCISTILGCKHT-----IISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKELA 289

Query: 588 TF 589
            +
Sbjct: 290 VY 291

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNG 583
           L+S   D TIK+W+ +          H + +  I+    + + V+ S D  +K+W+  NG
Sbjct: 140 LISGDSDGTIKIWQPNFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNG 199

Query: 584 KCIQTFTGH 592
           +   T +GH
Sbjct: 200 QQESTLSGH 208

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 62/149 (41%), Gaps = 14/149 (9%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK---MITASLDKTIRVWNYI 380
           L+ +GS D+ V +WD ++G  I  + G    +    F   K   +   S DK+ R+++  
Sbjct: 223 LIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIR 282

Query: 381 TG-SCISTYRGHQD--SVLSVDSYKKIIVSASADKTVKVWHV------ESRTCY--TLRG 429
                ++ YR   D  S+      + +      D ++K + +       S  C+      
Sbjct: 283 QNMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYA 342

Query: 430 HTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
           H + +  +  +P      S+S D+T+R W
Sbjct: 343 HDKCITSLAYNPVGHILASASKDRTIRFW 371

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 79/169 (46%), Gaps = 19/169 (11%)

Query: 297 NWRNGRCRIQLFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLIRRLTGH-T 352
           NW       Q F+GH   V+ + FN +      +   D TV IW     +    +T H T
Sbjct: 7   NWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHET 66

Query: 353 DGVKGIYF----DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK------ 402
            GV  + +    D   +IT+S D+++++W+Y T SC++T  GH  +V    SY       
Sbjct: 67  RGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANV----SYAIFHPSL 122

Query: 403 KIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSS 450
            II+S S D TVK+W+  + +   TL    E   CV  HP     Y +S
Sbjct: 123 PIIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVAS 171

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 75/152 (49%), Gaps = 19/152 (12%)

Query: 373 TIRVWNYITGSCIS-TYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHVESRTC-YTL 427
           TI++WN+     +  T+ GH+  V+ V    K      SA  D TVK+W +  ++  +T+
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 428 RGH-TEWVNCVKLHPKSFTCY--SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI---- 480
             H T  VN V  +P     Y  +SSDD+++++WD +T SC+    GH+  V   I    
Sbjct: 62  TAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPS 121

Query: 481 -PLTIKDTENLVVD------EKIEKVPNPELE 505
            P+ I  +E+  V        K+EK  N  LE
Sbjct: 122 LPIIISGSEDGTVKIWNANTYKLEKTLNLGLE 153

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 80/182 (43%), Gaps = 40/182 (21%)

Query: 413 TVKVWHVESRTCY--TLRGHTEWVNCVKLHPKSFTCYSSS-DDKTLRMWDIRTNSCIKVF 469
           T+K+W+ E       T  GH  +V CV  +PK    ++S+  D T+++W +         
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSL--------- 52

Query: 470 RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSC 529
               GQ      +T  +T  +                +F D     + P L+   +L++ 
Sbjct: 53  ----GQQSPNFTMTAHETRGV----------------NFVD-----YYP-LQDKPYLITS 86

Query: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGV-WDIAADNFRIV-SGSHDKSIKVWDLQNGKCIQ 587
           S D ++K+W+  +  C+ T  GH+  V + I   +  I+ SGS D ++K+W+    K  +
Sbjct: 87  SDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEK 146

Query: 588 TF 589
           T 
Sbjct: 147 TL 148

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 519 NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGH-VEGV----WDIAADNFRIVSGSHDK 573
           N K P    S  LD+T+K+W +       T   H   GV    +    D   +++ S D+
Sbjct: 31  NPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDR 90

Query: 574 SIKVWDLQNGKCIQTFTGHKAPI 596
           S+K+WD Q   C+ T  GH A +
Sbjct: 91  SVKIWDYQTKSCVATLEGHMANV 113

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 78/357 (21%), Positives = 131/357 (36%), Gaps = 107/357 (29%)

Query: 313 DGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKMITASLD 371
           D V SL      +++GSYD  V  ++  SG + ++ +GH+  ++ + Y    ++++A  D
Sbjct: 104 DWVSSLDVGSNYIYSGSYDGIVRTYNL-SGKVEKQYSGHSGPIRAVHYISSTRLVSAGND 162

Query: 372 KTIRVWNYIT-------------GSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWH 418
           +T+R+W                 G  ++   GH+  V+S+D  K  I+SAS D TV +W 
Sbjct: 163 RTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTVSLWS 222

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
              +    +    +    V       T        TL+   IR  + + +F  H   V+ 
Sbjct: 223 TNYKEMTVIDPMEDLGGNVS------TAAKKRRKLTLKDGSIRRRAPLALFESHSAPVEA 276

Query: 479 VIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLW 538
           VI                          D +DD  G             S S D+TIK W
Sbjct: 277 VI-------------------------FDKSDDTVG------------YSVSQDHTIKTW 299

Query: 539 EVSSGRCIRTQ---------------------------------------------FGHV 553
           ++ + +C+ T+                                              GH 
Sbjct: 300 DLITAKCVDTKTTSYSLLSVAQLPKLNLLACGSSARHITLHDPRVNSSSKITQQQLVGHK 359

Query: 554 EGV--WDIAADN-FRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFV 607
             V   D   +N + I S SHD ++KVWD+++   + T T     +V  G+ D  F 
Sbjct: 360 NFVVALDTCPENEYMICSASHDGTVKVWDVRSNTAMYTITREDKNVVK-GVNDKVFA 415

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 92/208 (44%), Gaps = 47/208 (22%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDT------------------------- 339
           + + +GH   V+S+  +   + + S D+TV++W T                         
Sbjct: 189 LAILEGHKAPVVSIDVSKDRILSASCDNTVSLWSTNYKEMTVIDPMEDLGGNVSTAAKKR 248

Query: 340 -----KSGNLIRR-----LTGHTDGVKGIYF---DDQKMITASLDKTIRVWNYITGSCIS 386
                K G++ RR        H+  V+ + F   DD    + S D TI+ W+ IT  C+ 
Sbjct: 249 RKLTLKDGSIRRRAPLALFESHSAPVEAVIFDKSDDTVGYSVSQDHTIKTWDLITAKCVD 308

Query: 387 TYRGHQDSVLSVDSYKKIIV----SASADKTVKVWHVESRTCYT---LRGHTEWVNCVKL 439
           T +    S+LSV    K+ +    S++   T+    V S +  T   L GH  +V  +  
Sbjct: 309 T-KTTSYSLLSVAQLPKLNLLACGSSARHITLHDPRVNSSSKITQQQLVGHKNFVVALDT 367

Query: 440 HPKS-FTCYSSSDDKTLRMWDIRTNSCI 466
            P++ +   S+S D T+++WD+R+N+ +
Sbjct: 368 CPENEYMICSASHDGTVKVWDVRSNTAM 395

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 87/238 (36%), Gaps = 66/238 (27%)

Query: 391 HQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSS 450
           ++D V S+D     I S S D  V+ +++  +      GH+  +  V  +  S    S+ 
Sbjct: 102 NEDWVSSLDVGSNYIYSGSYDGIVRTYNLSGKVEKQYSGHSGPIRAVH-YISSTRLVSAG 160

Query: 451 DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFAD 510
           +D+TLR+W  + +            ++ +    I+D + L +   +E    P +  D + 
Sbjct: 161 NDRTLRLWKTKND-----------DLKSIDEEEIEDGKTLAI---LEGHKAPVVSIDVSK 206

Query: 511 DCTGIFDPNLKYPTHLLSCSLDNTIKLWE------------------VSSGRCIRTQF-- 550
           D              +LS S DNT+ LW                   VS+    R +   
Sbjct: 207 D-------------RILSASCDNTVSLWSTNYKEMTVIDPMEDLGGNVSTAAKKRRKLTL 253

Query: 551 ------------------GHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
                               VE V    +D+    S S D +IK WDL   KC+ T T
Sbjct: 254 KDGSIRRRAPLALFESHSAPVEAVIFDKSDDTVGYSVSQDHTIKTWDLITAKCVDTKT 311

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 50/101 (49%), Gaps = 19/101 (18%)

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGH---VEGVWDIAADNFRIVSGSHDKSIKVW--- 578
           ++ S S D  ++ + +S G+  +   GH   +  V  I++   R+VS  +D+++++W   
Sbjct: 115 YIYSGSYDGIVRTYNLS-GKVEKQYSGHSGPIRAVHYISST--RLVSAGNDRTLRLWKTK 171

Query: 579 ----------DLQNGKCIQTFTGHKAPIVCVGIGDSSFVSG 609
                     ++++GK +    GHKAP+V + +     +S 
Sbjct: 172 NDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSA 212

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (53%), Gaps = 4/121 (3%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           NG C   L       + +L+  +  L TG+ D  V +WD + G  +R L GHTDG+  + 
Sbjct: 496 NGAC---LLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLK 552

Query: 360 FDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHV 419
           FD +K++T S+D ++R+W+  T S +     +   V S+D   K+I   + +  V V+++
Sbjct: 553 FDSEKLVTGSMDNSVRIWDLRTSSILDVI-AYDLPVSSLDFDGKLITVGANEGGVNVFNM 611

Query: 420 E 420
           E
Sbjct: 612 E 612

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 106/241 (43%), Gaps = 44/241 (18%)

Query: 371 DKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHVE-SRTCY- 425
           D+ ++VW+   G  +    GH  +V  +   KK   ++++ S D T+K+W +  SR  Y 
Sbjct: 357 DRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSREIYL 416

Query: 426 ---TLRGHTEWV--NCV---KLHPKSFTCYS--------SSDDKTLRMWDIRTNSCIKVF 469
               L+  TE +   C+   +LH    T  S         S DK +  WD+ T  CI+  
Sbjct: 417 DHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQ-- 474

Query: 470 RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLK----YPTH 525
                Q+  +   T  D           K+P   L         G   P +     Y + 
Sbjct: 475 -----QLDLIFTPTHSDI----------KMPARSLNNGAC--LLGTEAPMIGALQCYNSA 517

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKC 585
           L + + D  ++LW++  G+ +R   GH +G+  +  D+ ++V+GS D S+++WDL+    
Sbjct: 518 LATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSI 577

Query: 586 I 586
           +
Sbjct: 578 L 578

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 75/166 (45%), Gaps = 18/166 (10%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK 364
           I  F+ H D + +L F+   L +GS D  +  WD  +G  I++L    D +      D K
Sbjct: 433 IHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQL----DLIFTPTHSDIK 488

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE-SRT 423
           M   SL+          G+C+         + ++  Y   + + + D  V++W +   + 
Sbjct: 489 MPARSLNN---------GACLLGTEAPM--IGALQCYNSALATGTKDGIVRLWDLRVGKP 537

Query: 424 CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF 469
              L GHT+ +  +K   +     + S D ++R+WD+RT+S + V 
Sbjct: 538 VRLLEGHTDGITSLKFDSEKLV--TGSMDNSVRIWDLRTSSILDVI 581

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 104/252 (41%), Gaps = 57/252 (22%)

Query: 391 HQDSVLSVD---SYKKIIVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTC 446
           H +S+ ++D    +  +  S+  D+ VKVW +        L GH   VNC+++  K++  
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 447 Y-SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELE 505
             + S D TL++WD+  N   +++  H        PL           EK E++  P + 
Sbjct: 394 LITGSKDATLKLWDL--NLSREIYLDHS-------PLK----------EKTEEIVTPCIH 434

Query: 506 --EDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQ---FGHVEGVWDI 559
             E   D+ T + FD        L+S S D  I  W++++G+CI+     F        +
Sbjct: 435 NFELHKDEITALSFDSEA-----LVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKM 489

Query: 560 AAD----------------------NFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIV 597
            A                       N  + +G+ D  +++WDL+ GK ++   GH   I 
Sbjct: 490 PARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGIT 549

Query: 598 CVGIGDSSFVSG 609
            +       V+G
Sbjct: 550 SLKFDSEKLVTG 561

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 102/259 (39%), Gaps = 53/259 (20%)

Query: 274 ARNSRYYTRPWKVIYRERFQV--ESNWRNGRC-RIQLFKG-HMDGVLSLKFNHR--LLFT 327
            R   +Y  P +  + +  Q+  E+  RN    R+ +  G H + + +L F+     L +
Sbjct: 293 TRLKDFYKMPHEKSHDKNRQIISETYSRNTTAFRMTIPHGEHGNSITALDFDTPWGTLCS 352

Query: 328 GSY-DSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK---MITASLDKTIRVWNY---- 379
            SY D  V +WD   G  +  L GH   V  +  D +    +IT S D T+++W+     
Sbjct: 353 SSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLKLWDLNLSR 412

Query: 380 ---------------ITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTC 424
                          I   CI  +  H+D + ++    + +VS S DK +  W + +  C
Sbjct: 413 EIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFHWDLTTGKC 472

Query: 425 YTLRG--HTEWVNCVKLHPKSFT-----------------CYSSS-----DDKTLRMWDI 460
                   T   + +K+  +S                   CY+S+      D  +R+WD+
Sbjct: 473 IQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKDGIVRLWDL 532

Query: 461 RTNSCIKVFRGHVGQVQKV 479
           R    +++  GH   +  +
Sbjct: 533 RVGKPVRLLEGHTDGITSL 551

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 84/180 (46%), Gaps = 22/180 (12%)

Query: 305 IQLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDT-KSGNLIRRLTGHTDGVKGIYF 360
           I  FKGH++G   LKF      L  +G  D+ + IWD      L+R   GH   V+ I F
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINF 230

Query: 361 --DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY-----KKIIVSASADKT 413
             D  + ++ S D+T++VW+  TG   S  + H  SV +  +Y      + IV  S    
Sbjct: 231 NSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWH--SVPNCATYHPTNNNEYIVGLS---N 285

Query: 414 VKVWHVESRTC------YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK 467
            ++ H +SR         T   H   +  +K  P      SSS+DKT+R+W+ + N  IK
Sbjct: 286 SEIRHYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIK 345

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 3/73 (4%)

Query: 526 LLSCSLDNTIKLWEVSSGRCI-RTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQN 582
            LS   DN I +W++   R + R   GH + V DI   +D    +S S D+++KVWD + 
Sbjct: 194 FLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTET 253

Query: 583 GKCIQTFTGHKAP 595
           GK       H  P
Sbjct: 254 GKVKSRLKWHSVP 266

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 69/175 (39%), Gaps = 16/175 (9%)

Query: 379 YITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHV--ESRTCYTLRGHTEW 433
           ++    I T++GH +    +    +   + +S   D  + +W +  E       RGH + 
Sbjct: 165 FLPKKIIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKA 224

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH-VGQVQKVIPLT----IKDTE 488
           V  +  +       S S D+TL++WD  T       + H V       P      I    
Sbjct: 225 VRDINFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSVPNCATYHPTNNNEYIVGLS 284

Query: 489 NLVVDEKIEKVPNPE-LEEDFADDCTGIFDPNLKY---PTHLLSCSLDNTIKLWE 539
           N  +     +V N E L + +    + I   +LKY    +  +S S D T+++WE
Sbjct: 285 NSEIRHYDSRVSNKEGLIQTYNHHLSSII--SLKYFPDGSKFISSSEDKTVRIWE 337

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 72/154 (46%), Gaps = 9/154 (5%)

Query: 310 GHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV-KGIYFDDQKMITA 368
           GH   V  L+F + LL + S+D T  IWD  +  L   L  H   V       D  ++TA
Sbjct: 100 GHTGNVCGLRFQNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEASVWDSTMVSDDIILTA 157

Query: 369 SLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVWHVESRTCYT 426
           S DK+I VW  + G  I       D V+    Y    I  S S D T+K+ ++E      
Sbjct: 158 SADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNV 215

Query: 427 LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
             GH  +V CVK H  + T +S  +D T+R+W I
Sbjct: 216 FEGHESFVYCVK-HMNN-TLFSCGEDSTVRIWSI 247

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 116/284 (40%), Gaps = 53/284 (18%)

Query: 344 LIRRLTGHTDGVKGI-YFDDQKMITASLDKTIRVWN-----------------YITGSCI 385
           L   L GH+  VK I   +D K+ + S D ++RVW                  ++   C 
Sbjct: 4   LSATLRGHSQDVKDITAVNDNKIASVSRDGSLRVWTRSSSGDWEDVLVYQSDKFLNAVCY 63

Query: 386 -----STYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLH 440
                + Y G QD++++  S+ + ++ +SAD             YTL GHT   N   L 
Sbjct: 64  DKTSQTVYYGGQDTLIN-GSHIEDVIGSSADP-----------MYTLVGHTG--NVCGLR 109

Query: 441 PKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVP 500
            ++    SSS DKT ++WD   N      R H   V     ++    +++++    +K  
Sbjct: 110 FQNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEASVWDSTMVS----DDIILTASADKSI 163

Query: 501 NPELEEDFADDCTGIFDPNLKYPTHL-----LSCSLDNTIKLWEVSSGRCIRTQFGHVEG 555
              +E       + I D  +++  ++      SCS D TIKL  +  G       GH   
Sbjct: 164 GVWMEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLE-GEIKNVFEGHESF 222

Query: 556 VWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           V+ +   N  + S   D ++++W + NG   Q     + P V V
Sbjct: 223 VYCVKHMNNTLFSCGEDSTVRIWSI-NGSTKQVI---RIPAVSV 262

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 7/134 (5%)

Query: 298 WRNGRCRIQLFKGHMDGVL-SLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTG-HTDGV 355
           W N + +  L + H   V  S   +  ++ T S D ++ +W    G LI++L+  H D +
Sbjct: 127 WDNNKLKYDL-RNHEASVWDSTMVSDDIILTASADKSIGVW--MEGKLIKKLSNIHDDVI 183

Query: 356 KGI-YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTV 414
           + + Y  +    + S D TI++ N + G   + + GH+  V  V      + S   D TV
Sbjct: 184 RHLEYISNDIFASCSNDGTIKLLN-LEGEIKNVFEGHESFVYCVKHMNNTLFSCGEDSTV 242

Query: 415 KVWHVESRTCYTLR 428
           ++W +   T   +R
Sbjct: 243 RIWSINGSTKQVIR 256

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 541 SSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG 600
           SS   + T  GH   V  +   N  ++S S DK+ K+WD  N K       H+A      
Sbjct: 90  SSADPMYTLVGHTGNVCGLRFQNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEA-----S 142

Query: 601 IGDSSFVSGD 610
           + DS+ VS D
Sbjct: 143 VWDSTMVSDD 152

>Kwal_26.8953
          Length = 458

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 145/352 (41%), Gaps = 56/352 (15%)

Query: 300 NGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNL-IRRLTGHTDGVKGI 358
           +GR    +  G     + L     L+F  +    +  +D  +  + +  +  H  G+  I
Sbjct: 118 SGRPAFSISAGASVTSVKLHPELPLVFAATDSGKLLCYDLMNYTMPVASVQAHMRGITSI 177

Query: 359 --YFDDQK---MITASLDKTIRVWNYITGSC--ISTYRGHQDSVLSVDSYKK----IIVS 407
             + DD     + TAS D   +V+  I      + T+ GH+  V  +  +K     ++ S
Sbjct: 178 DVHIDDDSQCFVATASKDLHCKVFRLINSELQLVRTFSGHEHIVSHIKIWKNATDTLVAS 237

Query: 408 ASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCI 466
            S D T K+  V +     + + H EWV  + +  +     + S+D T+R+    T   +
Sbjct: 238 CSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYII--TGSNDCTVRVSHWPTGRAL 295

Query: 467 KVFRGHVGQVQ--KVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPT 524
               GH   V+  K+IP+ + ++++          P       F  D    + P L + +
Sbjct: 296 SFGIGHDFPVEQVKIIPMELSESDD----------PQNNTYSAFNKD----YLP-LGF-S 339

Query: 525 HLLSCSLDNTIKLWEVSSGRCI----------RTQF-------GHVEGVWDIAADNFRIV 567
           H++SCS DNT+++W+V   R I          R  F       GH   V DI      I+
Sbjct: 340 HVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVRGNFII 399

Query: 568 SGSHDKSIKVWDLQNGKCIQTFTGHKAPIV------CVGIGDSSFVSGDELG 613
           S S D+S++VWDL+ G+ ++  T             C G+     VSG   G
Sbjct: 400 SCSDDRSVRVWDLETGETVREITDSHTGFANCIDTDCGGLNRQLLVSGGADG 451

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 73/153 (47%), Gaps = 7/153 (4%)

Query: 313 DGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITA 368
           D +L++K +   R L     D+TV ++   S      L GH   V  I F  D + +IT+
Sbjct: 523 DDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITS 582

Query: 369 SLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVESRTCY- 425
           S DK I++W    G C  +   HQDS++SV  ++      S   D  VK W  +   C  
Sbjct: 583 SADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQ 642

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
            L GH   V C+ + P   T  S+S D ++R+W
Sbjct: 643 KLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVW 675

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 138/323 (42%), Gaps = 52/323 (16%)

Query: 308 FKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK- 364
           F GH  GV  L+ +     L +GS DS + IWD      + +L  H D + GI+ D    
Sbjct: 111 FNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMD 170

Query: 365 -MITASLDKTIRVWNY-ITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWH---- 418
            +I+ + D  I+VW+    G C+ T+  H     S+   +++I++ S D   K+W     
Sbjct: 171 WLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLE 230

Query: 419 ------VESRTCYTLRGHTEWVNCVKLHPKSFT--CYSSSDDKTLRMWDIRTNSCIKVFR 470
                 +  R  +        V+   +   + T   Y  ++DKT+ ++ IR    I   R
Sbjct: 231 KSNGEKISERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEI---R 287

Query: 471 GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPE----LEEDFA--------DDCTGIFDP 518
             + + +K +       +    +E+I++  NP     L   F+             I   
Sbjct: 288 KALNRREKRL------RDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQAS 341

Query: 519 NLKYPTHLLSCSLDNTIKLWEVSSGR-----CIRTQFGHVEG------VWDIAADNFRIV 567
           N K    L +   +NTI+ +++   +      +R     ++G        DI +D+ +++
Sbjct: 342 NSKLEVVLTTS--NNTIESYQIPYSKRDAEPPVRRYNVELQGHRTDIRSMDI-SDDGKLL 398

Query: 568 SGSHDKSIKVWDLQNGKCIQTFT 590
           S + +  +KVW+L   KCI+TF+
Sbjct: 399 STASNGELKVWNLTTKKCIRTFS 421

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 113/284 (39%), Gaps = 34/284 (11%)

Query: 347 RLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKII 405
            L GH   ++ +   DD K+++ + +  ++VWN  T  CI T+         +     ++
Sbjct: 378 ELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLV 437

Query: 406 VSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS 464
           V  +    ++++ + S T   T   HT  +  + L        + S DK+ + WD     
Sbjct: 438 VVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEV-- 495

Query: 465 CIKVFRGHVGQVQKVIPL--TIKDTENLVVDEKIEKVPNPE---LEEDFADDCTGI-FDP 518
              V +   G   K IP    + DT   + D+ +    + E   L     D+   + F  
Sbjct: 496 ---VEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFD 552

Query: 519 NLKY-------------------PTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI 559
           +LK+                      L++ S D  IK+W V  G C ++ F H + +  +
Sbjct: 553 SLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSV 612

Query: 560 --AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
              AD     S   D ++K WD     CIQ   GH++ + C+ +
Sbjct: 613 RFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCIAV 656

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 104/278 (37%), Gaps = 61/278 (21%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNY-- 379
           L+  G+    + ++D  S  L+     HT  +  +    + ++++T S DK+ + W++  
Sbjct: 436 LVVVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEV 495

Query: 380 ----ITGS---CISTYRGHQDSVLS---------VDSYKKIIVSASADKTVKVWHVESRT 423
               + G+    I   +   D+ L          + S  + +  +  D TVKV+  +S  
Sbjct: 496 VEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLK 555

Query: 424 CY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL 482
            Y +L GH   V  +     S    +SS DK +++W +    C K    H   +  V   
Sbjct: 556 FYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSV--- 612

Query: 483 TIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSS 542
                                    F  D    F           SC  D  +K W+   
Sbjct: 613 ------------------------RFEADTHNFF-----------SCGKDGAVKRWDGDK 637

Query: 543 GRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIKVW 578
             CI+   GH   VW IA   D   +VS SHD SI+VW
Sbjct: 638 FDCIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVW 675

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 84/182 (46%), Gaps = 21/182 (11%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWD----------TKSGNLIRRLTGH------TDGVKGIY 359
           L L  N + L TGS D +   WD          TK   + +    H      TD +  + 
Sbjct: 470 LDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVK 529

Query: 360 F--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVK 415
              +D+ +  + LD T++V+ + +     +  GH+  VLS+D     K+++++SADK +K
Sbjct: 530 ISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIK 589

Query: 416 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG 474
           +W V+   C+ ++  H + +  V+    +   +S   D  ++ WD     CI+   GH  
Sbjct: 590 IWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQS 649

Query: 475 QV 476
           +V
Sbjct: 650 EV 651

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 88/233 (37%), Gaps = 56/233 (24%)

Query: 364 KMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSAS-------------A 410
           K+IT +L+  I++W   T        G     +  +  K  +V+A               
Sbjct: 35  KLITGALE-NIQIWTLKTNEVEVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYE 93

Query: 411 DKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF 469
           D  +KVW + S++      GH   V  ++L  +     S S D  L +WD+     +   
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKL 153

Query: 470 RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIF-DPNLKYPTHLLS 528
           R H                                     D  TGI+ D N+ +   L+S
Sbjct: 154 RSH------------------------------------KDAITGIWIDHNMDW---LIS 174

Query: 529 CSLDNTIKLWEV-SSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDL 580
            + D  IK+W++ + G+C+ T   H    W +A D   I++ S D   K+W+L
Sbjct: 175 VAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWEL 227

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 67/144 (46%), Gaps = 8/144 (5%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQ--KMITASLDKTIRVWNYI 380
            LL  G  D  + +WD  S +++ +  GH  GV  +  D +  ++++ S D  + +W+ +
Sbjct: 86  ELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLV 145

Query: 381 TGSCISTYRGHQDSVLS--VDSYKKIIVSASADKTVKVWHVES--RTCYTLRGHTEWVNC 436
               +   R H+D++    +D     ++S + D  +KVW +++  +   T   HT    C
Sbjct: 146 GEVGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTG--QC 203

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDI 460
             +        ++S D   ++W++
Sbjct: 204 WSMAIDEEVIITTSMDSQAKIWEL 227

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQNGKCIQTF 589
           D  IK+W++ S   +    GH  GV  +  D+   R+VSGS D  + +WDL     +   
Sbjct: 94  DGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKL 153

Query: 590 TGHKAPIVCVGI 601
             HK  I  + I
Sbjct: 154 RSHKDAITGIWI 165

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 5/89 (5%)

Query: 524 THLLSCSLDNTIKLWEVSSG---RCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDL 580
           T L+S S D+ + +W++        +R+    + G+W I  +   ++S + D  IKVWDL
Sbjct: 128 TRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIW-IDHNMDWLISVAKDGLIKVWDL 186

Query: 581 Q-NGKCIQTFTGHKAPIVCVGIGDSSFVS 608
           +  G+C++T   H      + I +   ++
Sbjct: 187 KAGGQCVETHMAHTGQCWSMAIDEEVIIT 215

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 569 GSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           G  D  IKVWDL +   +  F GHK+ +  +
Sbjct: 91  GYEDGVIKVWDLLSKSVLMQFNGHKSGVTVL 121

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 83/166 (50%), Gaps = 10/166 (6%)

Query: 307 LFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTG-HTDGVKGIYF--D 361
           + + H   V ++K++H    + +G  D T+ IW   + N+++ L   HT+G++ + F  +
Sbjct: 119 IMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQ-PNFNMVKELDRIHTEGIRDVAFSNN 177

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHV 419
           D K +T S D  +++WN+  G       GH   V S D + +  +IVS S D  VK+W  
Sbjct: 178 DSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGLIVSGSKDNLVKLWDP 237

Query: 420 ESRTCY-TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTN 463
            S  C  TL      V   +  P K     + S DK+ R++D+R +
Sbjct: 238 RSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRAS 283

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 524 THLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-----IVSGSHDKSIKVW 578
           +  ++CS DN +K+W  S+G+  R   GH    WD+ + ++      IVSGS D  +K+W
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHH---WDVRSCDWHPELGLIVSGSKDNLVKLW 235

Query: 579 DLQNGKCIQTFTGHKAPIV 597
           D ++G+C+ T    K  ++
Sbjct: 236 DPRSGQCVSTLLKFKHTVL 254

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 89/232 (38%), Gaps = 54/232 (23%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWH 418
           + +++I A+      +WN  + +  +  + H  SV ++        ++S  AD T+K+W 
Sbjct: 93  EGRRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQ 152

Query: 419 VESRTCYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQ 477
                   L R HTE +  V          + SDD  L++W+       +V  GH   V+
Sbjct: 153 PNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVR 212

Query: 478 KVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKL 537
                                             C   + P L     ++S S DN +KL
Sbjct: 213 S---------------------------------CD--WHPELGL---IVSGSKDNLVKL 234

Query: 538 WEVSSGRCIRT--QFGHVEGVWDIAADNFRIVSG------SHDKSIKVWDLQ 581
           W+  SG+C+ T  +F H      +    F+   G      S DKS +V+DL+
Sbjct: 235 WDPRSGQCVSTLLKFKHT-----VLKTRFQPTKGNLLAAISKDKSCRVFDLR 281

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQNG 583
           ++S   D TIK+W+ +          H EG+ D+A  N   + V+ S D  +K+W+  NG
Sbjct: 139 MISGDADGTIKIWQPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNG 198

Query: 584 KCIQTFTGH 592
           +  +  +GH
Sbjct: 199 QQERVLSGH 207

>Kwal_33.15591
          Length = 714

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 77/159 (48%), Gaps = 20/159 (12%)

Query: 310 GHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMI--- 366
           GH + V  L  +   + +GS+D+T  +W    G L   L GHT  V      D KM+   
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVW-----DVKMLPEV 155

Query: 367 ----TASLDKTIRVWNYITGSCISTYRG-HQDSV--LSVDSYKKIIVSASADKTVKVWHV 419
               TAS D TI++W       + T+ G H D +  + +D+  +   S S D TVK+  +
Sbjct: 156 GFYMTASADGTIKLWE--GEKVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDM 213

Query: 420 ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
           E +T  TL GH  +V  VK  P      S  +D+T+R+W
Sbjct: 214 EGKTLKTLVGHESFVYSVKFAPNG-DVISCGEDRTVRIW 251

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 88/190 (46%), Gaps = 42/190 (22%)

Query: 390 GHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSS 449
           GH+++V  ++S +  ++S S D T KVW  +    + L+GHT  V  VK+ P+     ++
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVWF-QGALKHELKGHTASVWDVKMLPEVGFYMTA 161

Query: 450 SDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFA 509
           S D T+++W+       KV +   G    VI        ++ +D   EK         FA
Sbjct: 162 SADGTIKLWEGE-----KVLKTFTGLHTDVI-------RHIDIDASGEK---------FA 200

Query: 510 DDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVS 568
                             SCS D T+K+ ++  G+ ++T  GH   V+ +  A N  ++S
Sbjct: 201 ------------------SCSNDGTVKINDM-EGKTLKTLVGHESFVYSVKFAPNGDVIS 241

Query: 569 GSHDKSIKVW 578
              D+++++W
Sbjct: 242 CGEDRTVRIW 251

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 68/137 (49%), Gaps = 10/137 (7%)

Query: 298 WRNGRCRIQLFKGHMDGVLSLKFNHRLLF--TGSYDSTVAIWDTKSGNLIRRLTG-HTDG 354
           W  G  + +L KGH   V  +K    + F  T S D T+ +W+ +   +++  TG HTD 
Sbjct: 130 WFQGALKHEL-KGHTASVWDVKMLPEVGFYMTASADGTIKLWEGE--KVLKTFTGLHTDV 186

Query: 355 VKGIYFD--DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-SYKKIIVSASAD 411
           ++ I  D   +K  + S D T+++ N + G  + T  GH+  V SV  +    ++S   D
Sbjct: 187 IRHIDIDASGEKFASCSNDGTVKI-NDMEGKTLKTLVGHESFVYSVKFAPNGDVISCGED 245

Query: 412 KTVKVWHVESRTCYTLR 428
           +TV++W  +      +R
Sbjct: 246 RTVRIWKADGTVKQVIR 262

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 63/135 (46%), Gaps = 7/135 (5%)

Query: 348 LTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI--I 405
           L GH + V  +      +++ S D T +VW    G+     +GH  SV  V    ++   
Sbjct: 101 LIGHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVWDVKMLPEVGFY 158

Query: 406 VSASADKTVKVWHVESRTCYTLRG-HTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS 464
           ++ASAD T+K+W  E +   T  G HT+ +  + +        S S+D T+++ D+   +
Sbjct: 159 MTASADGTIKLWEGE-KVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDMEGKT 217

Query: 465 CIKVFRGHVGQVQKV 479
            +K   GH   V  V
Sbjct: 218 -LKTLVGHESFVYSV 231

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 527 LSCSLDNTIKLWEVSSGRCIRTQFG-HVEGV--WDIAADNFRIVSGSHDKSIKVWDLQNG 583
           ++ S D TIKLWE    + ++T  G H + +   DI A   +  S S+D ++K+ D++ G
Sbjct: 159 MTASADGTIKLWE--GEKVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDME-G 215

Query: 584 KCIQTFTGHKAPIVCV 599
           K ++T  GH++ +  V
Sbjct: 216 KTLKTLVGHESFVYSV 231

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 109/280 (38%), Gaps = 62/280 (22%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV---KGIYFDDQKMITASLDKTIRVWNY- 379
           L+  G+ +  + ++D  S +L+  +    D       +  D ++++T S DKT++ W++ 
Sbjct: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 503

Query: 380 -----ITGS---CISTYRGHQDSVLS---------VDSYKKIIVSASADKTVKVWHVESR 422
                + G+    +   + H D+ L          V    + +  +  D TVKV+ ++S 
Sbjct: 504 VENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSM 563

Query: 423 TCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP 481
             Y +L GH   V  + +   S    +SS DK +++W +    C K    H   +  V  
Sbjct: 564 KFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV-- 621

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVS 541
                                                 L    +  SCS D  +K W+  
Sbjct: 622 ------------------------------------KFLPQSHNFFSCSKDAVVKYWDGE 645

Query: 542 SGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWD 579
              CI+  + H   VW   +A D   +VS SHD SI++W+
Sbjct: 646 KFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 75/159 (47%), Gaps = 18/159 (11%)

Query: 334 VAIWDTKSGNLIRRLT-----GHTDG-----VKGIYFDDQK----MITASLDKTIRVWNY 379
           V IWD K+G+L+ +L+     G +D       +  Y +  K    +     D  I+VW+ 
Sbjct: 49  VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDL 108

Query: 380 ITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNC 436
           ++ + +  + GH+ ++  L  D     ++S S D  + VW +      Y LR H + +  
Sbjct: 109 MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG 168

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQ 475
                + +   S+S D  +++WD++T+ CI+    H G+
Sbjct: 169 FWCQGEDW-LISTSKDGMIKLWDLKTHQCIETHIAHTGE 206

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 114/259 (44%), Gaps = 29/259 (11%)

Query: 347 RLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKII 405
            L G    V+ I   DD K++  + + ++++WN  T  CI T+               ++
Sbjct: 386 ELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLV 445

Query: 406 VSASADKTVKVWHVESRTCY-TLR-GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT- 462
           +  + +  ++++ + S +   T+   H   +  + L        + S DKT++ WD +  
Sbjct: 446 ILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVE 505

Query: 463 NSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKY 522
           NS +       G   K +P+            K+      EL +D    C  +  P+ +Y
Sbjct: 506 NSLVP------GTKNKFLPVL-----------KLHHDTTLELTDDIL--CVRV-SPDDRY 545

Query: 523 PTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWDL 580
              L    LDNT+K++ + S +   + +GH   V   DI+ D+  I++ S DK+IK+W L
Sbjct: 546 ---LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602

Query: 581 QNGKCIQTFTGHKAPIVCV 599
             G C ++   H+  I+ V
Sbjct: 603 DFGDCHKSLFAHQDSIMNV 621

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 63/142 (44%), Gaps = 5/142 (3%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI--YFDDQKMITASLDKTIRVWNYI 380
           R L     D+TV ++   S      L GH   V  I   FD + +IT+S DK I++W   
Sbjct: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603

Query: 381 TGSCISTYRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVESRTCY-TLRGHTEWVNCV 437
            G C  +   HQDS+++V    +     S S D  VK W  E   C   L  H   V  +
Sbjct: 604 FGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWAL 663

Query: 438 KLHPKSFTCYSSSDDKTLRMWD 459
            +        SSS D ++R+W+
Sbjct: 664 AVATDGGFVVSSSHDHSIRIWE 685

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/319 (20%), Positives = 134/319 (42%), Gaps = 44/319 (13%)

Query: 308 FKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK- 364
           F GH   +  L+F+     L +GS DS + +WD      + +L  H D + G +   +  
Sbjct: 117 FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDW 176

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTC 424
           +I+ S D  I++W+  T  CI T+  H      +     ++++   D  VK+W ++    
Sbjct: 177 LISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIEND 236

Query: 425 YTLRGHTE---WVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR----------- 470
                 TE   +    K         ++S DKT   +    +  I+ FR           
Sbjct: 237 KMGGKLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGL 296

Query: 471 -------GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYP 523
                     G  ++ I  +IK++ +  +    + + +  L +  +   T +    L+  
Sbjct: 297 KKREKRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRS--LYKIKSASWTTVSSSKLE-- 352

Query: 524 THLLSCSLDNTIKLWEV-------SSGRCIRTQFGHVEG------VWDIAADNFRIVSGS 570
             L+  +  NTI+ + +       +S   ++T    ++G        DI+ DN ++++ +
Sbjct: 353 --LVLTTSSNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDN-KLLATA 409

Query: 571 HDKSIKVWDLQNGKCIQTF 589
            + S+K+W+++  KCI+TF
Sbjct: 410 SNGSLKIWNIKTHKCIRTF 428

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 125/298 (41%), Gaps = 38/298 (12%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNLIRRLT-GHTDGVKGIYFDDQKMITASLDKTIRVWNY 379
           +++LL T S + ++ IW+ K+   IR    G+    K +      +I  + +  +++++ 
Sbjct: 402 DNKLLATAS-NGSLKIWNIKTHKCIRTFECGYALTCKFLP-GGLLVILGTRNGELQLFDL 459

Query: 380 ITGSCISTYRGHQDSV---LSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNC 436
            + S + T     D+    L + S  K +V+ SADKTVK W  +           +++  
Sbjct: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPV 519

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG----HVGQVQKVIPLTIKDTENLVV 492
           +KLH           D TL + D     C++V        +  +   + +   D+    +
Sbjct: 520 LKLH----------HDTTLELTD--DILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYL 567

Query: 493 DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGH 552
                K+P   ++  F        D  +     +++ S D  IK+W +  G C ++ F H
Sbjct: 568 SLYGHKLPVLSIDISF--------DSKM-----IITSSADKNIKIWGLDFGDCHKSLFAH 614

Query: 553 VEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIG-DSSFV 607
            + + ++     +    S S D  +K WD +  +CIQ    H++ +  + +  D  FV
Sbjct: 615 QDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFV 672

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 6/141 (4%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYIT 381
           LL  G  D  + +WD  S  ++    GH   +  + FD    ++I+ S D  I VW+ + 
Sbjct: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVG 152

Query: 382 GSCISTYRGHQDSVLSV-DSYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKL 439
              +   R H+DS+       +  ++S S D  +K+W +++  C  T   HT    C  L
Sbjct: 153 EVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTG--ECWGL 210

Query: 440 HPKSFTCYSSSDDKTLRMWDI 460
             K     ++  D  +++W +
Sbjct: 211 AVKDDLLITTGTDSQVKIWKL 231

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 524 THLLSCSLDNTIKLWEVSSGRCI---RTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDL 580
           T L+S S D+ I +W++     +   R+    + G W    D   ++S S D  IK+WDL
Sbjct: 134 TRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDL 191

Query: 581 QNGKCIQTFTGHKAPIVCVGIGDSSFVS 608
           +  +CI+T   H      + + D   ++
Sbjct: 192 KTHQCIETHIAHTGECWGLAVKDDLLIT 219

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 15/91 (16%)

Query: 523 PTHLLSCSLDNTIKLWEVSSGRCI-RTQFGHVEGVWDIAA-------------DNFRIVS 568
           P  L++ +L++ + +W++ +G  + +   G   G  D                D   +  
Sbjct: 38  PGQLITSALED-VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAV 96

Query: 569 GSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           G  D  IKVWDL +   +  F GHKA I  +
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLL 127

>Scas_713.50
          Length = 983

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 87/182 (47%), Gaps = 21/182 (11%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWDTK---------SGNLIRRLTGHTDGVKGIYFD----- 361
           L L  + + L TGS D +V  W+ +         S   + +L  H D    +  D     
Sbjct: 517 LDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVR 576

Query: 362 ----DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-SY-KKIIVSASADKTVK 415
               D+ +  + LD T++V+   +     +  GH+  VLS+D S+  K+I+++SADK +K
Sbjct: 577 VSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 636

Query: 416 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG 474
           +W ++   C+ +L  H + +  VK  P+S   +S S D  ++ WD     CI+    H  
Sbjct: 637 IWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQS 696

Query: 475 QV 476
           +V
Sbjct: 697 EV 698

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 106/280 (37%), Gaps = 62/280 (22%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV---KGIYFDDQKMITASLDKTIRVWNY- 379
           L+  G+    + ++D  S   I  +    D       +  D +++IT S DK+++ WN+ 
Sbjct: 482 LVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQ 541

Query: 380 -----ITGSC---ISTYRGHQDSVLS---------VDSYKKIIVSASADKTVKVWHVESR 422
                + G+    +     H D+ L          V    K +  +  D TVKV+ ++S 
Sbjct: 542 LEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSM 601

Query: 423 TCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP 481
             + +L GH   V  + +   S    +SS DK +++W +    C K    H   +  V  
Sbjct: 602 KFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV-- 659

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVS 541
                          + VP                        +  SCS D  IK W+  
Sbjct: 660 ---------------KFVPESH---------------------NFFSCSKDGIIKYWDGD 683

Query: 542 SGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWD 579
              CI+    H   VW   IA D   +VS SHD SI++W+
Sbjct: 684 KFECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWE 723

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 7/154 (4%)

Query: 313 DGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI--YFDDQKMITA 368
           D +LS++ +   + L     D+TV ++   S      L GH   V  I   FD + +IT+
Sbjct: 570 DDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITS 629

Query: 369 SLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI--IVSASADKTVKVWHVESRTCY- 425
           S DK I++W    G C  +   HQDS+++V    +     S S D  +K W  +   C  
Sbjct: 630 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQ 689

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
            L  H   V  + +   +    SSS D ++R+W+
Sbjct: 690 KLAAHQSEVWALAIANDASFVVSSSHDHSIRIWE 723

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 13/125 (10%)

Query: 308 FKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK- 364
             GH   + +LKF+     L +GS DS + +WD  S   + +L  H D + GI+ ++   
Sbjct: 144 LNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTN 203

Query: 365 ----------MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTV 414
                     +I+ S D  I++W+     C+ T+  H     S+     ++++ S+D  V
Sbjct: 204 NNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQV 263

Query: 415 KVWHV 419
           K W +
Sbjct: 264 KFWQL 268

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 69/151 (45%), Gaps = 16/151 (10%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQ--KMITASLDKTIRVWNYIT 381
           LL  G  D  V +WD  S  ++  L GH+  +  + FD    ++I+ S D  I VW+ ++
Sbjct: 120 LLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVS 179

Query: 382 GSCISTYRGHQDSVLSV-----------DSYKKIIVSASADKTVKVWHVESRTCY-TLRG 429
              +   R H+D++  +           ++    ++S S D  +K+W ++ + C  T   
Sbjct: 180 EVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIA 239

Query: 430 HTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           HT    C  L  ++    ++S D  ++ W +
Sbjct: 240 HTG--ECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 66/171 (38%), Gaps = 30/171 (17%)

Query: 411 DKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF 469
           D  VKVW + S+T    L GH+  +  +K         S S D  + +WD+ +   +   
Sbjct: 127 DGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKL 186

Query: 470 RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSC 529
           R H   +  +                  +V N   EE+  D               L+S 
Sbjct: 187 RSHKDAITGIW---------------CNEVTNNNQEENELD--------------WLIST 217

Query: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDL 580
           S D  IK+W++   +C+ T   H    W +A  N  +++ S D  +K W L
Sbjct: 218 SKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 110/249 (44%), Gaps = 38/249 (15%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYR-GHQDSVLSVDSYKKIIVSASADKTVKVWHV 419
           DD K++  + + ++++WN  T  CI T+  G+  +   +     +I+   A + ++++ +
Sbjct: 439 DDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGE-LQLFDL 497

Query: 420 ESRT--CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQ 477
            S T        H   +  + L        + S DK+++ W+ +               Q
Sbjct: 498 ASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLE-------------Q 544

Query: 478 KVIPLTIKDTENLVVDEKIEKVPNPELEED----FADDCTGI-FDPNLKYPTHLLSCSLD 532
           +++P T          +K   VP   L  D     +DD   +   P  K+   L    LD
Sbjct: 545 ELVPGT---------SDKF--VPKLGLHHDTTLELSDDILSVRVSPEDKF---LAVSLLD 590

Query: 533 NTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
           NT+K++ + S +   + +GH   V   DI+ D+  I++ S DK+IK+W L  G C ++  
Sbjct: 591 NTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLF 650

Query: 591 GHKAPIVCV 599
            H+  I+ V
Sbjct: 651 AHQDSIMNV 659

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 524 THLLSCSL-DNTIKLWEVSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDL 580
           T+LL+    D  +K+W++ S   +    GH   +  +  D    R++SGS D +I VWDL
Sbjct: 118 TNLLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDL 177

Query: 581 QNGKCIQTFTGHKAPIVCV 599
            +   +     HK  I  +
Sbjct: 178 VSEVGLYKLRSHKDAITGI 196

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 524 THLLSCSLDNTIKLWEVSSGRCI---RTQFGHVEGVW--DIAADNFR------IVSGSHD 572
           T L+S S D+ I +W++ S   +   R+    + G+W  ++  +N        ++S S D
Sbjct: 161 TRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKD 220

Query: 573 KSIKVWDLQNGKCIQTFTGH 592
             IK+WDL+  +C++T   H
Sbjct: 221 GLIKIWDLKIQQCVETHIAH 240

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 127/276 (46%), Gaps = 22/276 (7%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWN 378
           N   + +GS++  V+I D+ +  + + L  H   V GI +  +D  +IT   D  I V N
Sbjct: 223 NGNYVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSN 282

Query: 379 YITGSCISTYR--GHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTCYTLR-GHTEW 433
              G  I++    GH+  +  L V    K I ++S D T ++W +E +    L+ GH++ 
Sbjct: 283 RSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKE 342

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVD 493
           + C+          ++  DKT  +WD+R+   +   +GH   +   +  +I D   L   
Sbjct: 343 LYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIY-CMDWSI-DGHTLATG 400

Query: 494 EKIEKVPNPELEEDFADDCTGIFD-----PNLKYPT----HLLSCSLDNTIKLWEVSSGR 544
                +   +L +  +D  T I +      +LK+      +L+S   D +I ++   +  
Sbjct: 401 GGDGVITIWDLRK--SDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYL 458

Query: 545 CIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVW 578
            + +  GH + V  +DI  +N  ++SG  D+S+K W
Sbjct: 459 KVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKC 585
           + S D+T +LW++   + +  Q GH + ++ +A  AD   + +   DK+  +WDL++GK 
Sbjct: 315 TSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSGKA 374

Query: 586 IQTFTGHKAPIVCV 599
           +    GH   I C+
Sbjct: 375 VSQLQGHAKTIYCM 388

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 77/179 (43%), Gaps = 18/179 (10%)

Query: 295 ESNWR----NGRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRL 348
           +S WR      + ++ L +GH   +  L F  +  L+ T   D T  IWD +SG  + +L
Sbjct: 319 DSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQL 378

Query: 349 TGHTDGVKGIY-----FDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK 403
            GH    K IY      D   + T   D  I +W+      ++    H+  V S+   K 
Sbjct: 379 QGH---AKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKA 435

Query: 404 ---IIVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
               ++S+  D+++ V+  ++     +L GH + V    +   +    S   D++++ W
Sbjct: 436 NDHNLISSGYDRSIFVYSKDNYLKVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 79/164 (48%), Gaps = 10/164 (6%)

Query: 307 LFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDGVKGIYFD-- 361
           + + H   V  + ++H    + +GS D  + IW   + N+++ +   H + V+ I F   
Sbjct: 118 IMQAHDSAVTVMTYSHTGDWMVSGSADGELKIWQ-PNFNMVKVMDQAHMECVREISFSPT 176

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHV 419
           DQK ++ S D  +++WN+  G       GH   V S D + K  +IVS S D  +K W  
Sbjct: 177 DQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDP 236

Query: 420 ESRTCY-TLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIR 461
            S +C  T+ G    +   K  PK     S  S DKT +++DIR
Sbjct: 237 RSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIR 280

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-----IVSGSHDKSIKVWDL 580
            +SCS DN +K+W  S+G+  R   GH    WD+ + ++      IVSGS D  IK WD 
Sbjct: 180 FVSCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLIKFWDP 236

Query: 581 QNGKCIQTFTGHKAPIVCV 599
           ++G C+ T  G K  I+  
Sbjct: 237 RSGSCVSTMLGFKHTIIST 255

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 66/166 (39%), Gaps = 5/166 (3%)

Query: 311 HMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITA 368
           H+   L+     R L   +Y+   ++W   S N    +  H   V  + +      M++ 
Sbjct: 82  HVIPALTWTPEGRRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSG 141

Query: 369 SLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVES-RTCY 425
           S D  +++W           + H + V  +S     +  VS S D  +K+W+  + +   
Sbjct: 142 SADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQER 201

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
            L GH   V     HPK     S S D  ++ WD R+ SC+    G
Sbjct: 202 VLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTMLG 247

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 90/231 (38%), Gaps = 52/231 (22%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI---IVSASADKTVKVW 417
           + ++++ A+ +    +W+  + +  S  + H DS ++V +Y      +VS SAD  +K+W
Sbjct: 92  EGRRLVVATYNGEFSLWSGSSFNFESIMQAH-DSAVTVMTYSHTGDWMVSGSADGELKIW 150

Query: 418 HVESRTCYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
                    + + H E V  +   P      S SDD  L++W+       +V  GH   V
Sbjct: 151 QPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDV 210

Query: 477 QKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIK 536
           +                                  C   + P +     ++S S DN IK
Sbjct: 211 KS---------------------------------CD--WHPKMGL---IVSGSKDNLIK 232

Query: 537 LWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSG------SHDKSIKVWDLQ 581
            W+  SG C+ T  G       I +  F+   G      S DK+ KV+D++
Sbjct: 233 FWDPRSGSCVSTMLGFKH---TIISTKFQPKQGNLLSVISKDKTCKVYDIR 280

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNG 583
           ++S S D  +K+W+ +          H+E V +I+    + + VS S D  +K+W+  NG
Sbjct: 138 MVSGSADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNG 197

Query: 584 KCIQTFTGH 592
           +  +  +GH
Sbjct: 198 QQERVLSGH 206

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 82/171 (47%), Gaps = 11/171 (6%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK 364
           + +  GH   V SL   +  + + S+D T  +W   +G+ I  L GH+  V    F  +K
Sbjct: 92  VYMLIGHKGNVCSLSSKNNFVISSSWDKTAKVW--HNGSAIYDLVGHSASVWDAKFLPEK 149

Query: 365 --MITASLDKTIRVWNYITGSCISTYRG-HQDSV--LSVDSYKKIIVSASADKTVKVWHV 419
              +TAS D TI++W+      I T+ G H+D +  L +    +   S S D TVK+  +
Sbjct: 150 DFFLTASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDGTVKINDM 207

Query: 420 ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
           +     T  GH  +V  VK  P      S  +D+++R+W  +T +  +V R
Sbjct: 208 DGNILKTFTGHESFVYSVKFLPNG-DLVSCGEDRSVRVWS-KTGAVKQVLR 256

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 89/200 (44%), Gaps = 10/200 (5%)

Query: 390 GHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSS 449
           GH+ +V S+ S    ++S+S DKT KVWH      Y L GH+  V   K  P+     ++
Sbjct: 97  GHKGNVCSLSSKNNFVISSSWDKTAKVWH-NGSAIYDLVGHSASVWDAKFLPEKDFFLTA 155

Query: 450 SDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFA 509
           S D T+++W    N  IK F G    V + + ++  D E          V   +++ +  
Sbjct: 156 SADCTIKLW--HGNKLIKTFSGIHKDVIRHLDIS-PDGETFASCSNDGTVKINDMDGNIL 212

Query: 510 DDCTG----IFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI-AADNF 564
              TG    ++         L+SC  D ++++W   +G   +        +WD+    N 
Sbjct: 213 KTFTGHESFVYSVKFLPNGDLVSCGEDRSVRVWS-KTGAVKQVLRLPAVSIWDLDILPNG 271

Query: 565 RIVSGSHDKSIKVWDLQNGK 584
            I+ GS D  ++++ ++  +
Sbjct: 272 DILVGSSDNMVRIFTVEESR 291

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 104/265 (39%), Gaps = 60/265 (22%)

Query: 348 LTGHTDGVKGIY-FDDQKMITASLDKTIRVWNYITG---SCISTYRGHQDSVLSVDSYKK 403
           L GH   VK +   +D ++ + S D T+RVW+   G     I+       + L  D   +
Sbjct: 8   LKGHEQDVKSVVAINDSQVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCYDKSSQ 67

Query: 404 IIVSASADKTV----KVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
           ++     D  V     +   +    Y L GH    N   L  K+    SSS DKT ++W 
Sbjct: 68  LLFYGGQDTLVGGISPLATTDEDPVYMLIGHKG--NVCSLSSKNNFVISSSWDKTAKVW- 124

Query: 460 IRTNSCIKVFRGHVGQV--QKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
               S I    GH   V   K +P                       E+DF         
Sbjct: 125 -HNGSAIYDLVGHSASVWDAKFLP-----------------------EKDF--------- 151

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV---WDIAADNFRIVSGSHDKS 574
                    L+ S D TIKLW     + I+T  G  + V    DI+ D     S S+D +
Sbjct: 152 --------FLTASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDGT 201

Query: 575 IKVWDLQNGKCIQTFTGHKAPIVCV 599
           +K+ D+ +G  ++TFTGH++ +  V
Sbjct: 202 VKINDM-DGNILKTFTGHESFVYSV 225

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 82/178 (46%), Gaps = 18/178 (10%)

Query: 305 IQLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWD-TKSGNLIRRLTGHTDGVKGIYF 360
           I  +KGH +G  SL+       L+ +G  D+TV +WD       +R   GH+  +K + F
Sbjct: 141 IYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDF 200

Query: 361 --DDQKMITASLDKTIRVWNYITGSC---ISTYRGHQDSVLSVDSYKKIIVSASADKTVK 415
             D  + ++ S D+ +++W+  TG     ++TY     +     S  + +V  S+ K   
Sbjct: 201 TSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSK--- 257

Query: 416 VWHVESRT------CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK 467
           + H ++R             H   +  +K  P      SSS+DKTLR+W+ + N  IK
Sbjct: 258 IKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIK 315

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 526 LLSCSLDNTIKLWEVSSGR-CIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQN 582
           +LS   DNT+KLW+    R C+R   GH + +   D  +D+ + +SGS+D+ +K+WD + 
Sbjct: 164 ILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKIWDTET 223

Query: 583 GKCIQTFTGHKAP 595
           GK  +    +  P
Sbjct: 224 GKVTKRLNTYSTP 236

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 3/47 (6%)

Query: 566 IVSGSHDKSIKVWDL-QNGKCIQTFTGHKAPIVCVGI-GDSS-FVSG 609
           I+SG +D ++K+WD   + KC++ F GH  PI  +    DSS F+SG
Sbjct: 164 ILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSG 210

>Scas_692.25
          Length = 488

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 105/238 (44%), Gaps = 41/238 (17%)

Query: 390 GHQDSVLSVDSYKKI----IVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSF 444
            H+  V  V  ++K+    + S S D ++++W  E      +   H EWV C+ +     
Sbjct: 233 NHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGD-- 290

Query: 445 TCYSSSDDKTLRMWDIRTNSCIKVFRGH---VGQVQKVIPLTIKDTENLVVDEKIEKVPN 501
              S S D +LR+    + + + +  GH   +  V+ ++PL+  +  +  ++   + +  
Sbjct: 291 FVLSGSQDASLRLTHWPSGNGLSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPL-- 348

Query: 502 PELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR----------------- 544
            E++ D+          + KY     S S D  IK+WE+ + R                 
Sbjct: 349 -EIDSDYEK-------MSFKY---CASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFK 397

Query: 545 CIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTG-HKAPIVCVGI 601
           CI T  GH   V D+      + S S DK+I+ W+L+NG+C++ +T  H   + C+ +
Sbjct: 398 CIMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLDM 455

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 97/224 (43%), Gaps = 59/224 (26%)

Query: 292 FQVESNWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGH 351
           F+V  N  +    ++LF+         K N+  L + S D+++ IW  + G ++     H
Sbjct: 228 FRVLMNHEHIVSEVKLFR---------KLNNIYLASCSRDTSIRIWTAEDGMILNSFHPH 278

Query: 352 TDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV---------------- 395
            + V+ +      +++ S D ++R+ ++ +G+ +S   GH+  +                
Sbjct: 279 NEWVRCLDVSGDFVLSGSQDASLRLTHWPSGNGLSIGIGHEFPIESVKFILPLSTNEKAS 338

Query: 396 ---------LSVDS-YKKI----IVSASADKTVKVWHVES------------------RT 423
                    L +DS Y+K+      SAS D+ +K+W + +                  + 
Sbjct: 339 PTINYLRKPLEIDSDYEKMSFKYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKC 398

Query: 424 CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK 467
             TL+GH  WV  +++  +    +S SDDKT+R W++    C+K
Sbjct: 399 IMTLKGHASWVKDLRI--RGNYLFSCSDDKTIRCWNLENGECVK 440

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 72/187 (38%), Gaps = 37/187 (19%)

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC-IKVFRGHVGQVQKVIPLTIKDTENLVV 492
           ++ +KLHP+    +  +D+  L  +DI   S  +   + H+  +  +             
Sbjct: 139 ISAIKLHPQLPIIFIGTDNGKLYAYDIFNYSLPLDSTQAHIKGITSI------------- 185

Query: 493 DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR----CIRT 548
           D  +E   N + EE  A   T                S D +IKL+  S+        R 
Sbjct: 186 DAIMEFKNNNKTEEPSAIIATS---------------SKDLSIKLFRWSAKENKFLLFRV 230

Query: 549 QFGHVEGVWDIAA----DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDS 604
              H   V ++      +N  + S S D SI++W  ++G  + +F  H   + C+ +   
Sbjct: 231 LMNHEHIVSEVKLFRKLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGD 290

Query: 605 SFVSGDE 611
             +SG +
Sbjct: 291 FVLSGSQ 297

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%)

Query: 345 IRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTY 388
           I  L GH   VK +      + + S DKTIR WN   G C+  +
Sbjct: 399 IMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENGECVKQW 442

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 283 PWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSG 342
           P  V++R      SN  N +C I   KGH   V  L+     LF+ S D T+  W+ ++G
Sbjct: 379 PRFVMHRPPVPNSSN-SNFKC-IMTLKGHASWVKDLRIRGNYLFSCSDDKTIRCWNLENG 436

Query: 343 NLIRRLTGHTDG 354
             +++ T    G
Sbjct: 437 ECVKQWTDLHSG 448

>Scas_658.1
          Length = 442

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 128/311 (41%), Gaps = 57/311 (18%)

Query: 310 GHMDGVLSLKF---NHRLLFTGSYDSTVAIWD-TKSGNLIRRLTGHTDGVKGIYFDDQ-- 363
           GH +G  SL F   +  LL +G  D+ V +WD     NL+R   GH+  +  + F+D   
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGT 206

Query: 364 KMITASLDKTIRVWNYITGSCIST--YRGHQDSV--LSVDSYKKIIVSASADKTVKVWHV 419
             I++S D TI++W+   G   +   ++   + V     +S + I+  A++    K++H 
Sbjct: 207 NFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANS----KIYHY 262

Query: 420 ESRTC------YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHV 473
           ++R             H   +  +K  P      SSS+DKT+R+WD + N  IK      
Sbjct: 263 DTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIK------ 316

Query: 474 GQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDN 533
                     I DT           +P+ ++  D  + C    D N  Y   +      N
Sbjct: 317 ---------QISDTTQY-------SMPSIDIHPDKKNFCAQSMD-NTIYTYSMKPKYRRN 359

Query: 534 TIKLW--EVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT- 590
             K++  + S+G  I   F         +AD   + SG     + +WD    + + T + 
Sbjct: 360 PNKMFKGQTSAGYGIGLTF---------SADGRYVCSGDSKSKVHIWDWTTTRLLNTISI 410

Query: 591 -GHKAPIVCVG 600
            G+K PI  V 
Sbjct: 411 PGNK-PITQVA 420

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 304 RIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRL---TGHTDGVKGI 358
           R+Q++  HM  +L+LKF  +     + S D TV IWD +    I+++   T ++     I
Sbjct: 272 RVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIKQISDTTQYSMPSIDI 331

Query: 359 YFDDQKMITASLDKTIRVWN 378
           + D +     S+D TI  ++
Sbjct: 332 HPDKKNFCAQSMDNTIYTYS 351

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 81/164 (49%), Gaps = 10/164 (6%)

Query: 307 LFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDGVKGIYFD-- 361
           + + H   V  ++++H    L +G  D T+ IW   + N+++ L   HT+ ++ I F   
Sbjct: 116 IMQAHDSAVTVMQYSHAGDWLISGDADGTIKIWQ-PNFNMVKVLDRAHTECMRDISFSYS 174

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHV 419
           DQK +T S D  +++WN+  G       GH   V S D + K  +IVS S D  +K+W  
Sbjct: 175 DQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 420 ES-RTCYTLRGHTEWVNCVKLHPKSFTCYS-SSDDKTLRMWDIR 461
            + R   T+ G    V   K  P      +  S DK+++++D+R
Sbjct: 235 RTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMR 278

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 8/77 (10%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-----IVSGSHDKSIKVWDL 580
            ++CS DN +K+W  S+G+  R   GH    WD+ + ++      IVSGS D  IK+WD 
Sbjct: 178 FVTCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 581 QNGKCIQTFTGHKAPIV 597
           + G+ + T  G K  ++
Sbjct: 235 RTGRNVSTILGLKHTVI 251

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 94/240 (39%), Gaps = 53/240 (22%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI---IVSASADKTVKVW 417
           + ++++ A+      +WN  + +  S  + H DS ++V  Y      ++S  AD T+K+W
Sbjct: 90  EGRRLVVATYSGEFSLWNGSSFNFESIMQAH-DSAVTVMQYSHAGDWLISGDADGTIKIW 148

Query: 418 HVESRTCYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
                    L R HTE +  +          + SDD  L++W+       +V  GH   V
Sbjct: 149 QPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDV 208

Query: 477 QKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIK 536
           +                                  C   + P +     ++S S DN IK
Sbjct: 209 KS---------------------------------CD--WHPKMGL---IVSGSKDNLIK 230

Query: 537 LWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSG------SHDKSIKVWDL-QNGKCIQTF 589
           LW+  +GR + T  G    V       F+   G      S DKSIK++D+ Q+ + +QT 
Sbjct: 231 LWDPRTGRNVSTILGLKHTV---IKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTI 287

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 76/198 (38%), Gaps = 55/198 (27%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKT 373
           +S  ++ +   T S D+ + IW+  +G   R L+GH   VK   +  +   +++ S D  
Sbjct: 169 ISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSKDNL 228

Query: 374 IRVWNYITGSCISTYRGHQDSVLSV---DSYKKIIVSASADKTVKV-------------- 416
           I++W+  TG  +ST  G + +V+      +   ++   S DK++K+              
Sbjct: 229 IKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQHMRELQTIR 288

Query: 417 ---------WHVESRT--------------------------CYTLR-GHTEWVNCVKLH 440
                    WH  + T                          C+T+   H + V  +   
Sbjct: 289 DDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPYAHEKSVTSLAYS 348

Query: 441 PKSFTCYSSSDDKTLRMW 458
           P      S++ D+T+R W
Sbjct: 349 PVGHILASAAKDRTIRFW 366

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNG 583
           L+S   D TIK+W+ +          H E + DI+    + + V+ S D  +K+W+  NG
Sbjct: 136 LISGDADGTIKIWQPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNG 195

Query: 584 KCIQTFTGH 592
           +  +  +GH
Sbjct: 196 QQERVLSGH 204

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/277 (23%), Positives = 119/277 (42%), Gaps = 48/277 (17%)

Query: 367 TASLDKTIRVWNYITGSCISTYR--GHQDSVLSVDSYKK-----IIVSASADKTVKVWHV 419
           T S D   ++W++   +     R     + ++S   + +     ++ + S D TVKVW  
Sbjct: 183 TTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDT 242

Query: 420 ESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
           +S  C  + + H +WV  ++LH       + S+D T+R+    + + + +   H   +++
Sbjct: 243 KSGWCIKSFQPHNQWVRTLELHGDYVI--TGSNDATIRLSHWPSGNGLSMAVMHEFPIER 300

Query: 479 VIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPN-----LKYPTHLLSCSLDN 533
           V          L++  +       E ++D  +     +DP+      KY    +SCS DN
Sbjct: 301 V----------LIIPMRANTAQKTEADDDQVELEYRKYDPDYSPLGFKY---CISCSRDN 347

Query: 534 TIKLWEVSSGRCI----------RTQF-------GHVEGVWDIAADNFRIVSGSHDKSIK 576
            I LW++   + I          +T F       GH   V DI      + S S D+SI+
Sbjct: 348 LIVLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHLFSCSDDRSIR 407

Query: 577 VWDLQNGKCIQTFT-GHKAPIVCVGIGDSSFVSGDEL 612
            WDL  G+C++ +       I C+ +   S VS D+L
Sbjct: 408 CWDLVTGQCLKVWPEASHGFINCLSV--DSDVSNDKL 442

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 81/196 (41%), Gaps = 52/196 (26%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGS 383
           LL T S D TV +WDTKSG  I+    H   V+ +      +IT S D TIR+ ++ +G+
Sbjct: 227 LLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGN 286

Query: 384 CISTYRGHQ----------------------DSVLSVDSYK----------KIIVSASAD 411
            +S    H+                      D  + ++  K          K  +S S D
Sbjct: 287 GLSMAVMHEFPIERVLIIPMRANTAQKTEADDDQVELEYRKYDPDYSPLGFKYCISCSRD 346

Query: 412 KTVKVWHVES------------------RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
             + +W +                       +  +GHT WV  +K+  +    +S SDD+
Sbjct: 347 NLIVLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHL--FSCSDDR 404

Query: 454 TLRMWDIRTNSCIKVF 469
           ++R WD+ T  C+KV+
Sbjct: 405 SIRCWDLVTGQCLKVW 420

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 10/78 (12%)

Query: 350 GHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV---LSVDS------ 400
           GHT  V+ I    + + + S D++IR W+ +TG C+  +          LSVDS      
Sbjct: 382 GHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLKVWPEASHGFINCLSVDSDVSNDK 441

Query: 401 -YKKIIVSASADKTVKVW 417
             +++ +S S D    V+
Sbjct: 442 LLRELFLSGSIDGKCNVF 459

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%)

Query: 304 RIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQ 363
           ++ +FKGH   V  +K   R LF+ S D ++  WD  +G  ++     + G       D 
Sbjct: 376 KVHVFKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLKVWPEASHGFINCLSVDS 435

Query: 364 KMITASLDKTIRVWNYITGSC 384
            +    L + + +   I G C
Sbjct: 436 DVSNDKLLRELFLSGSIDGKC 456

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 84/163 (51%), Gaps = 15/163 (9%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMI--TASLDKTIRVWN 378
           + + + +GS D TV I     G  IRRL GHT  V  I ++++  I  ++S+D++I+ W+
Sbjct: 80  DSKCIASGSEDFTVEITHIIYGR-IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWH 138

Query: 379 YITGSCISTYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVESRTCY-TLRGHTEWV 434
            ++G+ + T   H D+V+S+D  K    I+ S S D  ++++  ES  C  TL    +W+
Sbjct: 139 VLSGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWI 198

Query: 435 NCVKLHPKSFTCYS--------SSDDKTLRMWDIRTNSCIKVF 469
               + P S   +S         S D  +++W+    + ++ F
Sbjct: 199 AEDGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTF 241

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 71/143 (49%), Gaps = 25/143 (17%)

Query: 305 IQLFKGHMDGVLSL---KFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTG-----HTDGVK 356
           ++    H D V+S+   KF+  +L +GSYD  + I+DT+SG+ ++ LT        DGV 
Sbjct: 145 LKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGVV 204

Query: 357 GIYF-----DDQKMITASLDKTIRVWNYITGSCISTYR-GHQDS-----------VLSVD 399
            I       + + ++  SLD  +++W Y  G+ + T+   HQ++           ++   
Sbjct: 205 PISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKLKYNCGLELIYPQ 264

Query: 400 SYKKIIVSASADKTVKVWHVESR 422
               +++S +   ++ VW+V S+
Sbjct: 265 GKDPLVISGNDSGSMCVWNVYSK 287

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR---IVSGSHDKSIKVWDLQN 582
           L S S+D +IK W V SG  ++T   H + V  I    F    + SGS+D  I+++D ++
Sbjct: 125 LCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTES 184

Query: 583 GKCIQTFTGHK 593
           G C++T T  K
Sbjct: 185 GHCLKTLTYDK 195

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 89/214 (41%), Gaps = 33/214 (15%)

Query: 403 KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           K I S S D TV++ H+       L GHT  V  +  + K     SSS D++++ W + +
Sbjct: 82  KCIASGSEDFTVEITHIIYGRIRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLS 141

Query: 463 NSCIKVFRGHVGQVQKV-IP---------------LTIKDTENLVVDEKIEKVPNPELEE 506
            + +K    H   V  + IP               + I DTE+    + +    +   E+
Sbjct: 142 GTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAED 201

Query: 507 DFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF-------------GHV 553
                 T  F  N K+   LL  SLDN +KLWE + G  +RT                 +
Sbjct: 202 GVVPISTVKFSRNGKF---LLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKLKYNCGL 258

Query: 554 EGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQ 587
           E ++    D   ++SG+   S+ VW++ +   +Q
Sbjct: 259 ELIYPQGKDPL-VISGNDSGSMCVWNVYSKNLVQ 291

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQNG 583
           + S S D T+++  +  GR IR   GH   V  I  +N    + S S D+SIK W + +G
Sbjct: 84  IASGSEDFTVEITHIIYGR-IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSG 142

Query: 584 KCIQTFTGHKAPIVCVGIG--DSSFVS 608
             ++T + H   +V + I   DSS +S
Sbjct: 143 TALKTMSAHSDAVVSIDIPKFDSSILS 169

>Kwal_56.23920
          Length = 937

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 111/279 (39%), Gaps = 62/279 (22%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV---KGIYFDDQKMITASLDKTIRVWNY- 379
           L+  G+    + ++D  S  L+  + G   G      +  D ++++T S DKT+  W++ 
Sbjct: 438 LVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQ 497

Query: 380 -----ITGSCIS----------TYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVESR 422
                + G+             T     D VL+V      +++  +  D TVKV+ ++S 
Sbjct: 498 VEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSM 557

Query: 423 TCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP 481
             + +L GH   V  + +   S    +SS DK +++W +    C +    H   + KV+ 
Sbjct: 558 KFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVV- 616

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVS 541
                                     F  +    F           SCS D  +K W+  
Sbjct: 617 --------------------------FVPESHNFF-----------SCSKDALVKYWDGD 639

Query: 542 SGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVW 578
              CI+    H + VW +A  +D   +VS SHD+SI+VW
Sbjct: 640 KFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/321 (20%), Positives = 138/321 (42%), Gaps = 50/321 (15%)

Query: 308 FKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK- 364
           F GH   +  L F+     L +GS DS + +WD      + +L  H D + G++ + ++ 
Sbjct: 113 FNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEW 172

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHV----E 420
           +I+ S D  I+VW+     C+ T+  H     S+  ++ ++++A AD  +K+W++     
Sbjct: 173 LISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEES 232

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480
           + +    +G  E  +  +     FT  S   D+T   +    +  ++ FR    + Q  I
Sbjct: 233 AGSMLIEKGTHEKQSRQRGVAIQFTTVS---DETTFFFIQNADRSVETFR---LRKQDEI 286

Query: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTG-IFDP-----------------NLKY 522
              +K  E  + ++ + +    E++++  D  T  I  P                     
Sbjct: 287 AKALKKREKRLTEKGLSE---DEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTS 343

Query: 523 PTHLLSCSLDNTIKLWEVSSGRC--------------IRTQFGHVEGVWDIAADNFRIVS 568
              L+  + +NT+  + +   +               IR     V  + DI+ DN ++++
Sbjct: 344 KLDLVVTTANNTVDYYSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAI-DISGDN-KLLA 401

Query: 569 GSHDKSIKVWDLQNGKCIQTF 589
            + + ++K+W+++   CI+TF
Sbjct: 402 TASNGTLKIWNIKTNSCIRTF 422

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 111/256 (43%), Gaps = 29/256 (11%)

Query: 350 GHTDGVKGIYFD-DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSA 408
           GH   V+ I    D K++  + + T+++WN  T SCI T+               ++V  
Sbjct: 383 GHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGALVVLG 442

Query: 409 SADKTVKVWHVESRTCY-TLRG-HTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCI 466
           +    + ++ + S T   T+ G H+  +  + +        + S DKT+  WD +     
Sbjct: 443 TKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQVE--- 499

Query: 467 KVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHL 526
                     Q+ +P T         + K++   +  LE    DD   +    +     L
Sbjct: 500 ----------QEPVPGTTDK-----FNPKLKMFHDTTLE--LNDDVLAV---KISPDNRL 539

Query: 527 LSCS-LDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWDLQNG 583
           L+ S LDNT+K++ + S +   + +GH   V   DI+ D+  +++ S DK+IK+W L  G
Sbjct: 540 LAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG 599

Query: 584 KCIQTFTGHKAPIVCV 599
            C ++   H   I+ V
Sbjct: 600 DCHRSLFAHNDSIMKV 615

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 11/155 (7%)

Query: 313 DGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI--YFDDQKMITA 368
           D VL++K   ++RLL     D+TV ++   S      L GH   V  I   FD + +IT+
Sbjct: 526 DDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585

Query: 369 SLDKTIRVWNYITGSCISTYRGHQDSVLSV----DSYKKIIVSASADKTVKVWHVESRTC 424
           S DK I++W    G C  +   H DS++ V    +S+     S S D  VK W  +   C
Sbjct: 586 SADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHN--FFSCSKDALVKYWDGDKFEC 643

Query: 425 Y-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
              L  H + V  + +        S+S D+++R+W
Sbjct: 644 IQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QKMITASLDKTIRVWNYI 380
           RLL  G  D  + IWD  S +++    GH   +  + FD    ++I+ S D  I VW+ +
Sbjct: 88  RLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLV 147

Query: 381 TGSCISTYRGHQDSVLSV-DSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWV-NCVK 438
               +   R H+DS+  +    ++ ++S S D  +KVW ++ + C  +  H   V  C  
Sbjct: 148 GEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQC--VETHVAHVGECWS 205

Query: 439 LHPKSFTCYSSSDDKTLRMWDI 460
           +        ++  D  +++W++
Sbjct: 206 MGVHEDLVITAGADNQIKLWNL 227

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDT--------- 487
           ++ HP++       +D  +++WD+ + S +  F GH   +     LT   T         
Sbjct: 81  LQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAIT---ILTFDQTGTRLISGSR 137

Query: 488 -ENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCI 546
             +++V + + +V   +L     D  TG++    ++   L+S S D  IK+W++   +C+
Sbjct: 138 DSDIIVWDLVGEVGLYKLRS-HKDSITGLWCEGEEW---LISTSKDGLIKVWDLKVQQCV 193

Query: 547 RTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDL 580
            T   HV   W +      +++   D  IK+W+L
Sbjct: 194 ETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           +  G +D +IK+WDL +   + +F GHK+ I  +
Sbjct: 90  LAVGYNDGAIKIWDLLSKSVLISFNGHKSAITIL 123

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 61/116 (52%), Gaps = 3/116 (2%)

Query: 308 FKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK- 364
           F GH   +  L+F+     L +GS DS + IWD      + +L  H D + GI+ +++  
Sbjct: 113 FNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDW 172

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           +I+ S D  I++W+  T  C+ T+  H      +  +  ++++ S +  +K+W+++
Sbjct: 173 LISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLD 228

 Score = 57.4 bits (137), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 97/258 (37%), Gaps = 69/258 (26%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSC 384
           + TG+ ++ V  WD K+G L + LT   DG+     D +    A                
Sbjct: 37  ILTGALEN-VNCWDIKTGELSKILT---DGLPPGAVDAKSTKLAE--------------- 77

Query: 385 ISTY-RGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPK 442
            STY + H ++ L    Y        AD  +K+W + S+T      GH   +  ++  P 
Sbjct: 78  -STYLQYHPETNLLAVGY--------ADGVIKIWDLISKTVLINFNGHKSAITVLRFDPT 128

Query: 443 SFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
                S S D  + +WD+     +   R H                              
Sbjct: 129 GTRLISGSKDSDIIIWDLVGEVGLYKLRSH------------------------------ 158

Query: 503 ELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD 562
                  D  TGI+  N  +   L+S S D  IK+W++ + +C+ T   H    W +A  
Sbjct: 159 ------KDSITGIWCENEDW---LISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIH 209

Query: 563 NFRIVSGSHDKSIKVWDL 580
           N  +++ S +  IK+W+L
Sbjct: 210 NDLVITTSTESQIKIWNL 227

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 67/141 (47%), Gaps = 6/141 (4%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYIT 381
           LL  G  D  + IWD  S  ++    GH   +  + FD    ++I+ S D  I +W+ + 
Sbjct: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVG 148

Query: 382 GSCISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKL 439
              +   R H+DS+  +    +  ++S S D  +K+W ++++ C  T   HT    C  L
Sbjct: 149 EVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS--ECWGL 206

Query: 440 HPKSFTCYSSSDDKTLRMWDI 460
              +    ++S +  +++W++
Sbjct: 207 AIHNDLVITTSTESQIKIWNL 227

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 10/90 (11%)

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCI---RTQFGHVEGVWDIAADNFRIVSGSHD 572
           FDP     T L+S S D+ I +W++     +   R+    + G+W    +   ++S S D
Sbjct: 125 FDPT---GTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIW--CENEDWLISTSKD 179

Query: 573 KSIKVWDLQNGKCIQTFTGHKAPIVCVGIG 602
             IK+WDL+  +C++T   H +   C G+ 
Sbjct: 180 GLIKIWDLKTQQCVETHMAHTSE--CWGLA 207

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 3/79 (3%)

Query: 524 THLLSCSL-DNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD--NFRIVSGSHDKSIKVWDL 580
           T+LL+    D  IK+W++ S   +    GH   +  +  D    R++SGS D  I +WDL
Sbjct: 87  TNLLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDL 146

Query: 581 QNGKCIQTFTGHKAPIVCV 599
                +     HK  I  +
Sbjct: 147 VGEVGLYKLRSHKDSITGI 165

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 15/128 (11%)

Query: 305 IQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           +  F GH   V+SL FN +  LLFT S D ++ IWDT +G+L++ ++ H++ V  +    
Sbjct: 89  LHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPM 148

Query: 361 -DDQKMITASLDKTIRVWNYITGSCISTYRGHQD-----SVLSVDSYK-----KIIVSAS 409
            D   + + S D  IR+++  TG C+ T    +D      V+ +   K     + ++  S
Sbjct: 149 NDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKS 208

Query: 410 ADKTVKVW 417
            D  VK+W
Sbjct: 209 LDGVVKIW 216

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA---DNFRIVSGSHDKSIKVWDLQN 582
           L + S+D +IK+W+  +G  ++T   H E V  +     D+  + SGS+D  I+++D + 
Sbjct: 111 LFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAET 170

Query: 583 GKCIQTFTGHK 593
           G C++T T  K
Sbjct: 171 GHCLKTLTYDK 181

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 67/160 (41%), Gaps = 19/160 (11%)

Query: 405 IVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS 464
           I +AS D +V++ H+     +T  GHT  V  +  + K    ++SS D+++++WD    S
Sbjct: 70  IATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGS 129

Query: 465 CIKVFRGHVGQVQKV-IPLT---------------IKDTENLVVDEKIEKVPNPELEEDF 508
            +K    H   V  V +P+                I D E     + +    + + E   
Sbjct: 130 LMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGV 189

Query: 509 ADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT 548
                  F  N +Y   LL  SLD  +K+W+   G  +RT
Sbjct: 190 VPISQVKFSENARY---LLVKSLDGVVKIWDCIGGCVVRT 226

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD--NFRIVSGSHDKSIKVWDLQNG 583
           + + S D ++++  +S G  + T  GH   V  +  +     + + S D+SIK+WD  NG
Sbjct: 70  IATASDDFSVEIIHLSYGL-LHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNG 128

Query: 584 KCIQTFTGHKAPIVCVGI--GDSSFVS 608
             ++T + H   +V V +   DSS +S
Sbjct: 129 SLMKTISAHSEAVVSVDVPMNDSSILS 155

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 81/190 (42%), Gaps = 28/190 (14%)

Query: 302 RCRIQLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWD-TKSGNLIRRLTGHTDGVKG 357
           + +I  + GH +G  SL+F      LL +G  D+ + +WD      L+R   GH+  +K 
Sbjct: 125 KTKIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKD 184

Query: 358 IYFDD--QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVK 415
           + F D      +AS DK +++WN        T +G  D  L  +S    I     DK   
Sbjct: 185 LNFTDNGHSFASASFDKWVKIWN--------TEKGIIDKRLRFNSVPNCITFHPKDKNQL 236

Query: 416 VWHVESRTC--YTLR------------GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR 461
           V  + +     Y LR             H   +  +K  P      SSS+DKT+R+W+ R
Sbjct: 237 VVGLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENR 296

Query: 462 TNSCIKVFRG 471
            N  IK   G
Sbjct: 297 INIPIKQISG 306

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 72/175 (41%), Gaps = 16/175 (9%)

Query: 379 YITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVW--HVESRTCYTLRGHTEW 433
           ++  + I+ Y GH++   S+    K   +++S   D  +K+W  + E     T  GH+  
Sbjct: 122 FLPKTKIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMT 181

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVD 493
           +  +       +  S+S DK +++W+       K  R     V   I    KD   LVV 
Sbjct: 182 IKDLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLR--FNSVPNCITFHPKDKNQLVVG 239

Query: 494 EKIEKVPNPELEEDFADDCTGIFDPN------LKY---PTHLLSCSLDNTIKLWE 539
               ++ + +L           +D +      LKY      L+S S D T+++WE
Sbjct: 240 LSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWE 294

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 526 LLSCSLDNTIKLWEVSSGR-CIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQN 582
           LLS   DN IKLW+    R  +RT  GH   + D+    +     S S DK +K+W+ + 
Sbjct: 151 LLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEK 210

Query: 583 G 583
           G
Sbjct: 211 G 211

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 81/359 (22%), Positives = 137/359 (38%), Gaps = 110/359 (30%)

Query: 313 DGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLD 371
           D V +L      + +GSYD  V  W+  SG + ++ +GHT  V+ + F    ++++   D
Sbjct: 104 DWVSALDVGAERIVSGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFISSTRLVSGGND 162

Query: 372 KTIRVW----------NYITGS----CISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW 417
           +T+R+W          + + G+     ++   GHQ  V+SVD     I+SAS D ++  W
Sbjct: 163 RTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSASYDNSIGFW 222

Query: 418 HVESRTCYTLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
               +            +   + P  S    +SS  K  R   ++            G V
Sbjct: 223 STNHK------------DMTAVDPMDSLGDKASSAAKKRRKLTMKD-----------GSV 259

Query: 477 QKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIK 536
           ++  PL++ ++    V++ I           FA +     D  + Y     S S D+TIK
Sbjct: 260 RRRAPLSLLESHKAPVEQVI-----------FASN-----DSTVAY-----SVSQDHTIK 298

Query: 537 LWEVSSGRCIRTQ---------------------------------------------FG 551
            W++ + RC+ T+                                              G
Sbjct: 299 TWDLVTSRCVDTKSTSYSLLSMVELPKLRLLACGSSARHITLHDPRADSSAKITQQQLLG 358

Query: 552 HVEGV--WDIAADN-FRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFV 607
           H   V   D   +N + + S SHD ++KVWD+++   I T T      V  GI D  F 
Sbjct: 359 HKNFVVALDTCPENEYMLCSASHDGTVKVWDIRSSSSIYTITREDQS-VEKGINDKVFA 416

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 91/228 (39%), Gaps = 59/228 (25%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDT------------------------- 339
           + + +GH   V+S+      + + SYD+++  W T                         
Sbjct: 190 LAILEGHQAPVVSVDVQGDRILSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKR 249

Query: 340 -----KSGNLIRR-----LTGHTDGVKGIYF---DDQKMITASLDKTIRVWNYITGSCIS 386
                K G++ RR     L  H   V+ + F   D     + S D TI+ W+ +T  C+ 
Sbjct: 250 RKLTMKDGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVD 309

Query: 387 TYRGHQDSVLSVDSYKKIIVSA-------------SADKTVKVWHVESRTCYTLRGHTEW 433
           T +    S+LS+    K+ + A              AD + K+      T   L GH  +
Sbjct: 310 T-KSTSYSLLSMVELPKLRLLACGSSARHITLHDPRADSSAKI------TQQQLLGHKNF 362

Query: 434 VNCVKLHPKS-FTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480
           V  +   P++ +   S+S D T+++WDIR++S I         V+K I
Sbjct: 363 VVALDTCPENEYMLCSASHDGTVKVWDIRSSSSIYTITREDQSVEKGI 410

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 87/236 (36%), Gaps = 65/236 (27%)

Query: 391 HQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSS 450
           ++D V ++D   + IVS S D  V+ W++  +      GHT  V  VK    S    S  
Sbjct: 102 NEDWVSALDVGAERIVSGSYDGVVRTWNLSGKIEKQYSGHTGAVRAVKF-ISSTRLVSGG 160

Query: 451 DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFAD 510
           +D+TLR+W  + N  +K    HV +++       ++   L +   +E    P +  D   
Sbjct: 161 NDRTLRLWKTK-NDDVK----HVDELEGT-----EEAHTLAI---LEGHQAPVVSVDVQG 207

Query: 511 DCTGIFDPNLKYPTHLLSCSLDNTIKLW------------------EVSSGRCIRTQF-- 550
           D              +LS S DN+I  W                  + SS    R +   
Sbjct: 208 D-------------RILSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKLTM 254

Query: 551 ------------------GHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQT 588
                               VE V   + D+    S S D +IK WDL   +C+ T
Sbjct: 255 KDGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDT 310

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 558 DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG-IGDSSFVSG 609
           D+ A+  RIVSGS+D  ++ W+L +GK  + ++GH   +  V  I  +  VSG
Sbjct: 110 DVGAE--RIVSGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFISSTRLVSG 159

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 85/180 (47%), Gaps = 22/180 (12%)

Query: 305 IQLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWD-TKSGNLIRRLTGHTDGVKGIYF 360
           I+ + GH +G  +LKF      L+ +G  D T+ IWD       +R   GH   +K + F
Sbjct: 155 IRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRF 214

Query: 361 --DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLS-VDSYK----KIIVSASADKT 413
             D Q  +++S D+++++W+  TG   +  R H +S  + V+S      + IV  S    
Sbjct: 215 TEDCQSFLSSSFDRSVKIWDTETGKVKT--RLHLNSTPADVESRPTNPHEFIVGLS---N 269

Query: 414 VKVWHVESRTC------YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK 467
            K+ H + R         T   H   +  +K  P      SSS+DKT+R+W+ + N  IK
Sbjct: 270 SKILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIK 329

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 544 RCIRTQFGHVEGVWDI---AADNFRIVSGSHDKSIKVWDL-QNGKCIQTFTGHKAPIVCV 599
           + IR   GH EG   +         I+SG +D +IK+WD   + +C++ F GH  PI  +
Sbjct: 153 KVIRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKAL 212

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 526 LLSCSLDNTIKLWEVSSG-RCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQN 582
           +LS   D+TIK+W+      C+R   GH + +  +    D    +S S D+S+K+WD + 
Sbjct: 178 ILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTET 237

Query: 583 GKC 585
           GK 
Sbjct: 238 GKV 240

>Scas_631.17
          Length = 474

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 125/280 (44%), Gaps = 21/280 (7%)

Query: 318 LKFNHRLLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDGVKGIYFD--DQKMITASLDKTI 374
           L  ++ L  TGS+   + I DTK+ ++I  +  GH   + G+ ++  +  +++ + D  +
Sbjct: 194 LMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 375 RVWNYITGSCI----STYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRTCYTLR 428
           ++ ++     I    +  +GH   V++VD +   + + SAS D T ++W +ES T    +
Sbjct: 254 KIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ 313

Query: 429 -GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV------IP 481
            GH + V  +          S   D    +WD+RT   I   +GH   +  V        
Sbjct: 314 EGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYH 373

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGI-FDPNLKYPTHLLSCSLDNTIKLWEV 540
           +     + ++    I K           +  TG+ F  +  +   L+SC  D  I+++  
Sbjct: 374 IATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHC--LVSCGYDKQIRIYSS 431

Query: 541 SSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVW 578
            +   ++T  GH + +   DI+ D   IVS   D+S+K+W
Sbjct: 432 DNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 74/164 (45%), Gaps = 8/164 (4%)

Query: 303 CRIQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360
             +Q  +GH   V SL F +   LL +G  D+   +WD ++G  I  L GH   +  + +
Sbjct: 308 TELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDW 367

Query: 361 --DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI---IVSASADKTVK 415
             D   + T   D  I +W+    +  +    H + V  V   K     +VS   DK ++
Sbjct: 368 SPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIR 427

Query: 416 VWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
           ++  ++     TL GHT+ +  V +   +    SS  D++L++W
Sbjct: 428 IYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 64/129 (49%), Gaps = 8/129 (6%)

Query: 299 RNGRCRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK 356
           R G+  + L +GH   + S+ +  +   + TG  D  + IWD +      RL  H + V 
Sbjct: 347 RTGKSIMNL-QGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVT 405

Query: 357 GIYFDDQK---MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK--KIIVSASAD 411
           G+ F       +++   DK IR+++      + T  GH D +L VD  +  ++IVS+  D
Sbjct: 406 GVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWD 465

Query: 412 KTVKVWHVE 420
           +++K+W  E
Sbjct: 466 RSLKLWKQE 474

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDK 573
           F P+ ++   + S S D T +LW++ S   ++ Q GH + V+ ++   D   + SG  D 
Sbjct: 283 FHPSGRF---VASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDN 339

Query: 574 SIKVWDLQNGKCIQTFTGHKAPIVCV 599
           +  VWD++ GK I    GH  PI  V
Sbjct: 340 AAIVWDVRTGKSIMNLQGHAKPIYSV 365

>Scas_585.8
          Length = 460

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 81/173 (46%), Gaps = 10/173 (5%)

Query: 298 WRNGRCRIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDG 354
           W        L + H   V  ++++H    + +G  D  + IW   + N+++     HT+ 
Sbjct: 117 WNGTSFNESLMQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQ-PNFNMVKEFENAHTEC 175

Query: 355 VKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASA 410
           ++ I F  +D K +T S D  +++WN+  G    T  GH   + S D + +  +IVSAS 
Sbjct: 176 IRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCDWHPEMGLIVSASK 235

Query: 411 DKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIR 461
           D  VK+W   S  C  T+      V   +  P      ++ S DK+ R++DIR
Sbjct: 236 DNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIR 288

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 8/77 (10%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-----IVSGSHDKSIKVWDL 580
            ++CS DN +K+W  S+G+  RT  GH    WDI + ++      IVS S D  +K+WD 
Sbjct: 188 FVTCSDDNVLKIWNFSNGQVERTLSGHH---WDIKSCDWHPEMGLIVSASKDNLVKLWDP 244

Query: 581 QNGKCIQTFTGHKAPIV 597
           ++G+CI T    K  ++
Sbjct: 245 RSGQCISTIIKFKHTVL 261

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 61/151 (40%), Gaps = 6/151 (3%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYI 380
           R L   +Y+   ++W+  S N    +  H   V  I +      M +   D  I++W   
Sbjct: 103 RRLVVATYNGEFSLWNGTSFNE-SLMQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPN 161

Query: 381 TGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCV 437
                     H + +  +S  +     V+ S D  +K+W+  + +   TL GH   +   
Sbjct: 162 FNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSC 221

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKV 468
             HP+     S+S D  +++WD R+  CI  
Sbjct: 222 DWHPEMGLIVSASKDNLVKLWDPRSGQCIST 252

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQNG 583
           + S   D  IK+W+ +       +  H E + DI+  N   + V+ S D  +K+W+  NG
Sbjct: 146 MCSGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNG 205

Query: 584 KCIQTFTGH 592
           +  +T +GH
Sbjct: 206 QVERTLSGH 214

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 85/195 (43%), Gaps = 27/195 (13%)

Query: 405 IVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKL-HPKSFTCYSSSDDKTLRMWDIRTN 463
           +V A+ +    +W+  S     ++ H   V+C++  H   + C S   D  +++W    N
Sbjct: 105 LVVATYNGEFSLWNGTSFNESLMQAHDSAVSCIQYSHAGDWMC-SGDADGGIKIWQPNFN 163

Query: 464 SCIKVFRGHVGQVQKVIPLTIKDTENLVVDE----KIEKVPNPELEEDFADDCTGI---- 515
             +K F     +  + I  +  D++ +   +    KI    N ++E   +     I    
Sbjct: 164 -MVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCD 222

Query: 516 FDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT--QFGHVEGVWDIAADNFRIVSG---- 569
           + P +     ++S S DN +KLW+  SG+CI T  +F H      +    F+   G    
Sbjct: 223 WHPEMGL---IVSASKDNLVKLWDPRSGQCISTIIKFKHT-----VLKTRFQPTRGNLLA 274

Query: 570 --SHDKSIKVWDLQN 582
             S DKS +V+D+++
Sbjct: 275 AISKDKSCRVFDIRH 289

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 80/358 (22%), Positives = 134/358 (37%), Gaps = 119/358 (33%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKMITASLDKTIRVW------ 377
           + +GSYD  V  WD  SGN+ ++ +GH+  ++ + Y  + ++++A  D+T+R+W      
Sbjct: 118 IISGSYDGIVRTWDL-SGNVQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKNDD 176

Query: 378 -----------------NYITGSCISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHV 419
                            N   G  ++   GH+  V+S+D S    I+SAS D ++  W  
Sbjct: 177 LKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFWST 236

Query: 420 ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD--IRTNSCIKVFRGHVGQVQ 477
             +   T+    E +N    +P +    ++   + L M D  IR  + + +   H   V+
Sbjct: 237 IYKEM-TVVDPLEDIN----NPNNKISTAARKRRKLTMKDGTIRRRAPLSLLESHTAPVE 291

Query: 478 KVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKL 537
           +VI                          D  D+  G             S S D+TIK 
Sbjct: 292 QVI-------------------------FDSTDNTVG------------YSVSQDHTIKT 314

Query: 538 WEVSSGRCIRTQ---------------------------------------------FGH 552
           W++ + RCI T+                                              GH
Sbjct: 315 WDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGSSARHITLHDPRVGASSKVTQQQLIGH 374

Query: 553 VEGV--WDIAADNFRIV-SGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFV 607
              V   D   +N  I+ SGSHD ++KVWD+++   + T T      V  G+ D  F 
Sbjct: 375 KNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTITREDKS-VQKGVNDKVFA 431

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 51/107 (47%), Gaps = 25/107 (23%)

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKSIKVW----- 578
           H++S S D  ++ W++S G   +   GH   +  +    N R+VS  +D+++++W     
Sbjct: 117 HIISGSYDGIVRTWDLS-GNVQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKND 175

Query: 579 ------------------DLQNGKCIQTFTGHKAPIVCVGIGDSSFV 607
                             ++++GK +    GHKAP+V + + D+S +
Sbjct: 176 DLKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRI 222

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 87/238 (36%), Gaps = 58/238 (24%)

Query: 394 SVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
           S L V    K I+S S D  V+ W +         GH+  +  VK +  +    S+ +D+
Sbjct: 107 SSLDVGDGSKHIISGSYDGIVRTWDLSGNVQKQYSGHSGPIRAVK-YISNTRLVSAGNDR 165

Query: 454 TLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCT 513
           TLR+W  + N  +K+      Q      + I+D + L +   +E    P +  D +D+  
Sbjct: 166 TLRLWKTK-NDDLKLTSQQQAQEDDDDEVNIEDGKTLAI---LEGHKAPVVSIDVSDN-- 219

Query: 514 GIFDPNLKYPTHLLSCSLDNTIKLWEV----------------------SSGR------- 544
                     + +LS S DN+I  W                        ++ R       
Sbjct: 220 ----------SRILSASYDNSIGFWSTIYKEMTVVDPLEDINNPNNKISTAARKRRKLTM 269

Query: 545 ------------CIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
                        + +    VE V   + DN    S S D +IK WDL   +CI T T
Sbjct: 270 KDGTIRRRAPLSLLESHTAPVEQVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRT 327

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 12/83 (14%)

Query: 306 QLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKSGNLIRRLT--------GHTDG 354
           Q   GH + V SL     N  +L +GS+D TV +WD +S + +  +T        G  D 
Sbjct: 369 QQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTITREDKSVQKGVNDK 428

Query: 355 VKGIYFDDQ-KMITASLDKTIRV 376
           V  + + ++  +I+A  DK I++
Sbjct: 429 VFAVKWAEKVGIISAGQDKKIQI 451

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 75/163 (46%), Gaps = 8/163 (4%)

Query: 307 LFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DD 362
           L + H   V ++K++H    + +G  D  + IW      +      HT+ ++ + F  +D
Sbjct: 130 LMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSND 189

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVE 420
            K +T S D  +++WN+  G       GH   V S D + +  +I SAS D  VK+W   
Sbjct: 190 SKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDPR 249

Query: 421 SRTCY-TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIR 461
           S  C  ++      V   +  P K     + S DK+ R++DIR
Sbjct: 250 SGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 62/149 (41%), Gaps = 5/149 (3%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYI 380
           R L   +Y    ++W+  S      +  H   V  + +  D   MI+   D  I++W   
Sbjct: 106 RRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPN 165

Query: 381 TGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCV 437
                     H +S+  ++  S     V+ S D  +K+W+  + +    L GH   V   
Sbjct: 166 FSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSC 225

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCI 466
             HP+     S+S D  +++WD R+ +CI
Sbjct: 226 DWHPEMGLIASASKDNLVKLWDPRSGNCI 254

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-----IVSGSHDKSIKVWDL 580
            ++CS DN +K+W  S+G+  R   GH    WD+ + ++      I S S D  +K+WD 
Sbjct: 192 FVTCSDDNILKIWNFSNGKQERVLSGH---HWDVKSCDWHPEMGLIASASKDNLVKLWDP 248

Query: 581 QNGKCIQTFTGHKAPIV 597
           ++G CI +    K  ++
Sbjct: 249 RSGNCISSILKFKHTVL 265

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNG 583
           ++S   D  IK+W+ +          H E + D+A  +++ + V+ S D  +K+W+  NG
Sbjct: 150 MISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNG 209

Query: 584 KCIQTFTGH 592
           K  +  +GH
Sbjct: 210 KQERVLSGH 218

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 88/231 (38%), Gaps = 56/231 (24%)

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVWHV 419
           ++++ A+      +WN  + +  +  + H DS ++   Y      ++S  AD  +K+W  
Sbjct: 106 RRLVVATYSGEFSLWNASSFTFETLMQAH-DSAVTTMKYSHDSDWMISGDADGMIKIWQP 164

Query: 420 ESRTCYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
                  +   HTE +  +          + SDD  L++W+       +V  GH   V+ 
Sbjct: 165 NFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKS 224

Query: 479 VIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLW 538
                  D              +PE+         G+          + S S DN +KLW
Sbjct: 225 C------DW-------------HPEM---------GL----------IASASKDNLVKLW 246

Query: 539 EVSSGRCIRT--QFGHVEGVWDIAADNFRIVSG------SHDKSIKVWDLQ 581
           +  SG CI +  +F H      +    F+   G      S DKS +V+D++
Sbjct: 247 DPRSGNCISSILKFKHT-----VLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 126/306 (41%), Gaps = 64/306 (20%)

Query: 305 IQLFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLI-RRLTGHTDGVKGIYF 360
           + ++ GH  G  +L+F  +   L  +G  D  + IWD     L+ R   GH   +    F
Sbjct: 167 LHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSF 226

Query: 361 --DDQKMITASLDKTIRVWNYITGSCIS--TYRGHQDSVLSVDSYKKIIVSASADKTVKV 416
             D+ +  ++S DKT+++W+  TG  I+  +++   + +      K+ ++   +D   K+
Sbjct: 227 SHDNVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDS--KI 284

Query: 417 WHVESRT------CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
            H + R             H   +N ++  P      SSSDDK++R+W+ + N  IK   
Sbjct: 285 RHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIK--- 341

Query: 471 GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH--LLS 528
                        I DT+         + P P ++                +P H    +
Sbjct: 342 ------------QISDTD---------QYPAPWIQ---------------LHPEHNQFAA 365

Query: 529 CSLDNTIKLWEVSSG--RCIRTQF-GH----VEGVWDIAADNFRIVSGSHDKSIKVWDLQ 581
            S+DN+I ++ +     R  R  F GH       ++DIA D   + +G     + +WD +
Sbjct: 366 QSMDNSIYVYSMKPKYKRHPRKAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRLFIWDWK 425

Query: 582 NGKCIQ 587
             K ++
Sbjct: 426 TTKILR 431

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 520 LKYPTHL-LSCSLDNTIKLWEVSSGRCIRTQF-GHVEGV--WDIAADNFRIVSGSHDKSI 575
           L+   HL LS   D  +K+W++   R +   + GH + +     + DN +  S S+DK++
Sbjct: 183 LRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSYDKTV 242

Query: 576 KVWDLQNGKCIQTFTGHKAP 595
           K+WD + G  I   +    P
Sbjct: 243 KIWDTETGDIINRLSFKATP 262

>Scas_700.27*
          Length = 433

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 90/205 (43%), Gaps = 20/205 (9%)

Query: 404 IIVSASADKTVKVWHVESRTC-YTLRGHTEWVN---CVKLHPKSFTCYSSSDDKTLRMWD 459
           +I +A  D  V++W + +R    TL GH   +N   C+ + P+  +C   S D T+R+WD
Sbjct: 220 LIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSC---STDATIRLWD 276

Query: 460 IRTNSCIKVFRGHVGQVQKVI--PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           I     +KV   H   V+ +   P     +     D +  K+P   L  +F  D  GI +
Sbjct: 277 IVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLPEGGLLTNFNSDGLGIIN 336

Query: 518 P-NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF-----GHVEGVWDIAADNF-----RI 566
             ++     L + S +  +  ++  SG   ++       G +E    I    F     R+
Sbjct: 337 TLSINQDDVLFAGSDNGMLSFYDYKSGHKYQSMMTKEIPGSLESERGILCSTFDRTGLRL 396

Query: 567 VSGSHDKSIKVWDLQNGKCIQTFTG 591
           ++G  DKSIK+W + +    +T  G
Sbjct: 397 LTGETDKSIKIWSMDSDATPETDPG 421

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY--FDDQKMITASLDKTIRVWNYIT 381
           L+ T   DS V +WD ++   +  L GH + +  ++    D ++++ S D TIR+W+ + 
Sbjct: 220 LIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQIVSCSTDATIRLWDIVA 279

Query: 382 GSCISTYRGHQDSVLSV 398
           G  +     H+ SV ++
Sbjct: 280 GKSMKVITHHKKSVRNI 296

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 532 DNTIKLWEVSSGRCIRTQFGH---VEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQT 588
           D+ ++LW++ +   + T  GH   +  V  +  D  +IVS S D +I++WD+  GK ++ 
Sbjct: 227 DSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDP-QIVSCSTDATIRLWDIVAGKSMKV 285

Query: 589 FTGHKAPIVCVGIGDSSF 606
            T HK  +  +    + F
Sbjct: 286 ITHHKKSVRNIAFHPTEF 303

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 10/77 (12%)

Query: 324 LLFTGSYDSTVAIWDTKSGN-----LIRRLTGHTDGVKGIY---FDDQ--KMITASLDKT 373
           +LF GS +  ++ +D KSG+     + + + G  +  +GI    FD    +++T   DK+
Sbjct: 345 VLFAGSDNGMLSFYDYKSGHKYQSMMTKEIPGSLESERGILCSTFDRTGLRLLTGETDKS 404

Query: 374 IRVWNYITGSCISTYRG 390
           I++W+  + +   T  G
Sbjct: 405 IKIWSMDSDATPETDPG 421

>Kwal_26.8975
          Length = 445

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/364 (20%), Positives = 128/364 (35%), Gaps = 121/364 (33%)

Query: 313 DGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKMITASLD 371
           D V +L      + +GSYD  V  W+  SG + ++  GH+  V+ + Y    ++++ + D
Sbjct: 103 DWVSALDVGGDKIVSGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYISSTRLVSGAND 161

Query: 372 KTIRVW----------------NYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVK 415
           +T+R+W                +   G  ++    H+  V++VD     I+S S D ++ 
Sbjct: 162 RTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISGSYDNSIG 221

Query: 416 VWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK---TLRMWDIRTNSCIKVFRGH 472
            W            H E      +        S++  +    L+   +R  S + +   H
Sbjct: 222 FWST---------NHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALLESH 272

Query: 473 VGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLD 532
              V++V+                          DFAD   G             S S D
Sbjct: 273 TAPVEEVL-------------------------FDFADKTVG------------YSVSQD 295

Query: 533 NTIKLWEVSSGRCIRTQF------------------------------------------ 550
           +TIK W++ + RC+ T+                                           
Sbjct: 296 HTIKTWDLVTARCVDTKSTSYSLLSLAQLPQLNLLACGSSARHITLHDPRVGSSTKITQQ 355

Query: 551 ---GHVEGVWDIAADN-----FRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIG 602
              GH   V  +A D      + + SGSHD ++KVWD+++   + T T  +   V  GI 
Sbjct: 356 QLNGHKNFV--VALDTCPEMEYMLCSGSHDGTVKVWDVRSSAPMYTIT--REAEVVKGIN 411

Query: 603 DSSF 606
           D  F
Sbjct: 412 DKVF 415

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 49/101 (48%), Gaps = 18/101 (17%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKSIKVW------ 578
           ++S S D  ++ W +S G+  +   GH   V  +    + R+VSG++D+++++W      
Sbjct: 115 IVSGSYDGIVRTWNLS-GKVEKQYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKNDE 173

Query: 579 ----------DLQNGKCIQTFTGHKAPIVCVGIGDSSFVSG 609
                     D++ GK +     HKAP+V V +     +SG
Sbjct: 174 LKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISG 214

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 91/206 (44%), Gaps = 47/206 (22%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDT------------------------- 339
           + + + H   V+++  +   + +GSYD+++  W T                         
Sbjct: 191 LAILEAHKAPVVTVDVSGDRIISGSYDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKR 250

Query: 340 -----KSGNLIRR-----LTGHTDGVKGIYFD--DQKM-ITASLDKTIRVWNYITGSCIS 386
                K G++ RR     L  HT  V+ + FD  D+ +  + S D TI+ W+ +T  C+ 
Sbjct: 251 RRLALKDGSVRRRSPLALLESHTAPVEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVD 310

Query: 387 TYRGHQDSVLSVDSYKKIIV----SASADKTVKVWHVESRTCYT---LRGHTEWVNCVKL 439
           T +    S+LS+    ++ +    S++   T+    V S T  T   L GH  +V  +  
Sbjct: 311 T-KSTSYSLLSLAQLPQLNLLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALDT 369

Query: 440 HPK-SFTCYSSSDDKTLRMWDIRTNS 464
            P+  +   S S D T+++WD+R+++
Sbjct: 370 CPEMEYMLCSGSHDGTVKVWDVRSSA 395

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 87/223 (39%), Gaps = 37/223 (16%)

Query: 391 HQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSS 450
           ++D V ++D     IVS S D  V+ W++  +      GH+  V  VK +  S    S +
Sbjct: 101 NEDWVSALDVGGDKIVSGSYDGIVRTWNLSGKVEKQYAGHSGAVRAVK-YISSTRLVSGA 159

Query: 451 DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFAD 510
           +D+TLR+W  + +            V++   L I           +E    P +  D + 
Sbjct: 160 NDRTLRLWKTKNDELKNNLAAEEDDVEEGKTLAI-----------LEAHKAPVVTVDVSG 208

Query: 511 D--CTGIFDPNLKY------------PTHLLSCSLDNTIK------LWEVSSGR-----C 545
           D   +G +D ++ +            P   L  ++ +  K      L + S  R      
Sbjct: 209 DRIISGSYDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLAL 268

Query: 546 IRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQT 588
           + +    VE V    AD     S S D +IK WDL   +C+ T
Sbjct: 269 LESHTAPVEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVDT 311

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 558 DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG-IGDSSFVSG 609
           D+  D  +IVSGS+D  ++ W+L +GK  + + GH   +  V  I  +  VSG
Sbjct: 109 DVGGD--KIVSGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYISSTRLVSG 158

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 306 QLFKGHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI 358
           Q   GH + V++L        +L +GS+D TV +WD +S   +  +T   + VKGI
Sbjct: 355 QQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKVWDVRSSAPMYTITREAEVVKGI 410

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 111/246 (45%), Gaps = 25/246 (10%)

Query: 301 GRCRIQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV-KGIY 359
           G+  +    GH   + SL  +   L + S+D T  +W   +G +   L GH+  V     
Sbjct: 89  GQEPVYTLVGHEGNICSLSGDFESLVSSSWDKTAKVW--TNGIVKWELKGHSASVWDAKL 146

Query: 360 FDDQKMITASLDKTIRVWNYITGSCISTY-RGHQDSV--LSVDSYKKIIVSASADKTVKV 416
            +D  ++TAS D T+++W    G+   T+ + H D V  + +    K  VS S D T+K+
Sbjct: 147 LNDGSVLTASADTTVKLWK--NGTLAKTFDKLHSDVVRNICILDDGKHFVSCSNDGTLKL 204

Query: 417 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD-------IRTNSCIKVF 469
            ++E    +   GH  +V  VK  P S    S  +D+T+R+W+       + T   I ++
Sbjct: 205 SNLEGGILHEFIGHESFVYAVKQLP-SGDIVSCGEDRTVRIWNMDGTIKQVITLPAISIW 263

Query: 470 RGH--------VGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLK 521
                      VG   K+I +  ++ + L   E+I  +   ++EE   +  T  FD +  
Sbjct: 264 TVDVLPNGDIVVGSSDKIIRIFTENEQRLASQEEITSL-QKQVEESAVNAQTMGFDESKL 322

Query: 522 YPTHLL 527
            P+ +L
Sbjct: 323 KPSSVL 328

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 109/261 (41%), Gaps = 22/261 (8%)

Query: 344 LIRRLTGHTDGVKGIY-FDDQKMITASLDKTIRVWNYIT-----GSCISTYRGHQDSVLS 397
           L  +L GHT  V+ +      ++ +AS D T+R+WN        GS   +     +S L+
Sbjct: 4   LSAQLRGHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNS-LT 62

Query: 398 VDSYKKIIVSASADKTV----KVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
            D+ + ++     +K +     +  +     YTL GH    N   L     +  SSS DK
Sbjct: 63  YDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEG--NICSLSGDFESLVSSSWDK 120

Query: 454 TLRMWDIRTNSCIK-VFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDC 512
           T ++W   TN  +K   +GH   V     L          D  ++   N  L + F    
Sbjct: 121 TAKVW---TNGIVKWELKGHSASVWDAKLLNDGSVLTASADTTVKLWKNGTLAKTFDKLH 177

Query: 513 TGIFDP--NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-DNFRIVSG 569
           + +      L    H +SCS D T+KL  +  G  +    GH   V+ +    +  IVS 
Sbjct: 178 SDVVRNICILDDGKHFVSCSNDGTLKLSNLEGG-ILHEFIGHESFVYAVKQLPSGDIVSC 236

Query: 570 SHDKSIKVWDLQNGKCIQTFT 590
             D+++++W++ +G   Q  T
Sbjct: 237 GEDRTVRIWNM-DGTIKQVIT 256

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 97/224 (43%), Gaps = 20/224 (8%)

Query: 389 RGHQDSVLSVDSYKKI-IVSASADKTVKVWHVESRTCY---TLRGHTEWVNCVKLHPKSF 444
           RGH   V SV S     + SAS D TV++W++++   +         ++VN +    K  
Sbjct: 9   RGHTQDVRSVVSLSTTQVASASRDGTVRIWNLDADGNWEGSIAFSSEKFVNSLTYDAKQC 68

Query: 445 TCYSSSDDKTLRMWD---IRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVD--EKIEKV 499
             +    +K +             +    GH G +  +      D E+LV    +K  KV
Sbjct: 69  VLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSL----SGDFESLVSSSWDKTAKV 124

Query: 500 -PNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT-QFGHVEGVW 557
             N  ++ +       ++D  L     +L+ S D T+KLW+  +G   +T    H + V 
Sbjct: 125 WTNGIVKWELKGHSASVWDAKLLNDGSVLTASADTTVKLWK--NGTLAKTFDKLHSDVVR 182

Query: 558 DIAA--DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           +I    D    VS S+D ++K+ +L+ G  +  F GH++ +  V
Sbjct: 183 NICILDDGKHFVSCSNDGTLKLSNLEGG-ILHEFIGHESFVYAV 225

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 71/156 (45%), Gaps = 24/156 (15%)

Query: 308 FKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMIT 367
           F+ H   +  L  + R L +GS D  + I+D +    +  L  H   +  + F      +
Sbjct: 102 FQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA--S 159

Query: 368 ASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVES-RTCYT 426
           +S D  +              +G ++S        K ++SAS D  + VW V+   T  T
Sbjct: 160 SSEDAAVS-------------KGSKNS--------KWLLSASEDHKIMVWRVKDWETVGT 198

Query: 427 LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           L+GHT  VN V +HP +    S SDD ++R+W++ T
Sbjct: 199 LKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMT 234

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 77/200 (38%), Gaps = 43/200 (21%)

Query: 425 YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTI 484
           +  + H+  + C+ +  +     S S+D+ +R++D++    +     H G +  +     
Sbjct: 100 FHFQAHSLSIKCLAVSRRYLV--SGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 152

Query: 485 KDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR 544
                        +  +P    + A    G    N K+   LLS S D+ I +W V    
Sbjct: 153 -------------QFSHPASSSEDAAVSKG--SKNSKW---LLSASEDHKIMVWRVKDWE 194

Query: 545 CIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQ---------------NGKCIQ 587
            + T  GH   V   DI   N   +S S D SI++W+L                NG C++
Sbjct: 195 TVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMTLRNAAVLKLRKYNTNGTCVR 254

Query: 588 TFTGHKAPIVCVGIGDSSFV 607
            + G K     VG+ D   +
Sbjct: 255 -WLGAKGDYFAVGLRDRVLI 273

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%)

Query: 559 IAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGD 610
           +A     +VSGS+D+ I+++DLQ  K + T   H+  I  +     +  S D
Sbjct: 112 LAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSSED 163

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/111 (19%), Positives = 49/111 (44%), Gaps = 16/111 (14%)

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKL-HPK 442
           I  ++ H  S+  +   ++ +VS S D+ ++++ ++ R    TL  H   +  ++  HP 
Sbjct: 99  IFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA 158

Query: 443 SFT--------------CYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           S +                S+S+D  + +W ++    +   +GH  +V  V
Sbjct: 159 SSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDV 209

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 82/174 (47%), Gaps = 11/174 (6%)

Query: 307 LFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDGVKGIYFD-- 361
           + + H   V +++++H    L +G  D  + IW   + N+++ L   H + V+ + F   
Sbjct: 118 IMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQ-PNFNMVKVLDQAHMECVRDVSFSGT 176

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHV 419
           D K +T S D  +++WN+  G       GH   V S D +    +IVS S D  +K+W  
Sbjct: 177 DSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPTMGLIVSGSKDNLIKLWDP 236

Query: 420 ESRTCY-TLRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTN-SCIKVFR 470
            S  C  T+ G    +   K  P K       + DK+ +++DIR N   +K FR
Sbjct: 237 RSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFR 290

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 8/77 (10%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR-----IVSGSHDKSIKVWDL 580
            ++CS DN +K+W  S+G+  R   GH    WD+ + ++      IVSGS D  IK+WD 
Sbjct: 180 FVTCSDDNILKIWNFSNGQQERVLSGHH---WDVKSCDWHPTMGLIVSGSKDNLIKLWDP 236

Query: 581 QNGKCIQTFTGHKAPIV 597
           ++G+CI T  G K  I+
Sbjct: 237 RSGQCISTILGFKHTII 253

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 90/240 (37%), Gaps = 53/240 (22%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI---IVSASADKTVKVW 417
           + ++++ A+      +WN  T +  S  + H DS ++   Y      ++S  +D  +K+W
Sbjct: 92  EGRRLVVATYSGEFSLWNGSTFNFESIMQAH-DSAVTTMEYSHAGDWLISGDSDGIIKIW 150

Query: 418 HVESRTCYTL-RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
                    L + H E V  V          + SDD  L++W+       +V  GH   V
Sbjct: 151 QPNFNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDV 210

Query: 477 QKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIK 536
           +         T  L+V                                   S S DN IK
Sbjct: 211 KSC---DWHPTMGLIV-----------------------------------SGSKDNLIK 232

Query: 537 LWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSG------SHDKSIKVWDL-QNGKCIQTF 589
           LW+  SG+CI T  G       I    F+   G      + DKS K++D+ QN K +++F
Sbjct: 233 LWDPRSGQCISTILGFKH---TIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSF 289

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 59/154 (38%), Gaps = 5/154 (3%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYI 380
           R L   +Y    ++W+  + N    +  H   V  + +      +I+   D  I++W   
Sbjct: 94  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN 153

Query: 381 TGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCV 437
                   + H + V  +S        V+ S D  +K+W+  + +    L GH   V   
Sbjct: 154 FNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSC 213

Query: 438 KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRG 471
             HP      S S D  +++WD R+  CI    G
Sbjct: 214 DWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILG 247

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNG 583
           L+S   D  IK+W+ +          H+E V D++    + + V+ S D  +K+W+  NG
Sbjct: 138 LISGDSDGIIKIWQPNFNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNG 197

Query: 584 KCIQTFTGH 592
           +  +  +GH
Sbjct: 198 QQERVLSGH 206

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 108/257 (42%), Gaps = 27/257 (10%)

Query: 343 NLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-- 399
           N+     GHT  + G+ F  + +++T+S D T  +W+      +  Y  H   VL++   
Sbjct: 165 NVTSIFKGHTGYISGVEFVSESRVVTSSGDMTCALWDIPKAKRVREYSDHLGDVLAISIP 224

Query: 400 ----SYKKIIVSASADKTVKVWHVESRTC---YTLRGHTEWVNCVKLHPKSFTCYSSSDD 452
               S   +  S  +D    +W V S +    +++       NC+K  P   +    +DD
Sbjct: 225 VTNLSKNNMFASCGSDGYTFIWDVRSPSAVQQFSIGSCDS--NCLKFFPDGNSVAVGNDD 282

Query: 453 KTLRMWDIRTNSCIKVF----RGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDF 508
            T+ ++D+R +  I ++    RG   Q + V         N              L  ++
Sbjct: 283 GTISLFDLRADCTIALYSINDRGSPLQKENVFL-----NSNEYQSSSSSPKSPISLATNY 337

Query: 509 ADDCTGIFDPNLKYPTHLL-SCSLDNTIKLWEVSSGRCIRTQFGH---VEGVWDIAADNF 564
            +D  G+   +      L+ SC ++   ++W+V  G  + +  GH   + GV   + D  
Sbjct: 338 FED-RGVISLDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGV-KCSPDGM 395

Query: 565 RIVSGSHDKSIKVWDLQ 581
            I +GS D+++K+W  Q
Sbjct: 396 AICTGSWDQTLKLWTPQ 412

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 69/154 (44%), Gaps = 12/154 (7%)

Query: 348 LTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVL--SVDSYKK 403
           L GHT+ +    +  D + +++AS D  + VW+ +TG   S        VL  ++     
Sbjct: 81  LKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCALSPSGA 140

Query: 404 IIVSASADKTVKVWH------VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
           +  SA  +    ++       V+       +GHT +++ V+   +S    +SS D T  +
Sbjct: 141 LAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSES-RVVTSSGDMTCAL 199

Query: 458 WDIRTNSCIKVFRGHVGQVQKV-IPLTIKDTENL 490
           WDI     ++ +  H+G V  + IP+T     N+
Sbjct: 200 WDIPKAKRVREYSDHLGDVLAISIPVTNLSKNNM 233

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 314 GVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITAS 369
           GV+SL F+   RL+++   +    +WD   G ++  L GH + + G+    D   + T S
Sbjct: 342 GVISLDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGVKCSPDGMAICTGS 401

Query: 370 LDKTIRVW 377
            D+T+++W
Sbjct: 402 WDQTLKLW 409

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 42/89 (47%), Gaps = 12/89 (13%)

Query: 523 PTHLLSCS--LDNTIKLWEVSSGRCIRTQF--------GHVEGVWDIAADNFRIVSGSHD 572
           P+  L+ S  L+N   ++ +  G  ++           G++ GV  ++    R+V+ S D
Sbjct: 137 PSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSES--RVVTSSGD 194

Query: 573 KSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
            +  +WD+   K ++ ++ H   ++ + I
Sbjct: 195 MTCALWDIPKAKRVREYSDHLGDVLAISI 223

>Kwal_34.15818
          Length = 349

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 107/251 (42%), Gaps = 32/251 (12%)

Query: 348 LTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSYKK 403
           L GH   +  + F+ +   + T + D    VW  I G  + T+ GHQ ++ S  VD + +
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 404 IIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
             V+ SAD ++K+W V+  T  +T +  T         P     +S S DK L + D   
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKT---------PVRRVQFSPSGDKILAVLD--- 113

Query: 463 NSCIKVFRGHVGQVQKVIPLTI-KDTENL-VVDEKIEKVPNPELEEDFADDCTGIFDPNL 520
                   G +G    V   T+ +D E   +VD   E   N    E F       +  N 
Sbjct: 114 --------GVMGYPGSVTVYTVRRDPETKDIVDISEEPTFNILTREGFEIAAVAAWSFN- 164

Query: 521 KYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVW 578
              T++++   D  +  +E  SG  I +   H + V DI  + D    ++ S D + K+ 
Sbjct: 165 --DTYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYFITSSRDSAAKLV 222

Query: 579 DLQNGKCIQTF 589
           D +  + ++T+
Sbjct: 223 DTETLEVLKTY 233

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 60/164 (36%), Gaps = 22/164 (13%)

Query: 314 GVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLD 371
            V +  FN   +  G  D  V+ ++  SG  I     HT  V  I F  D    IT+S D
Sbjct: 157 AVAAWSFNDTYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYFITSSRD 216

Query: 372 KTIRVWNYITGSCISTYRGHQDSVLS---VDSYKKIIVSASADKTVKVWHVESR------ 422
              ++ +  T   + TY    D  L+   +   K+ ++         V    SR      
Sbjct: 217 SAAKLVDTETLEVLKTYE--TDCPLNSACITPLKQFVILGGGQDAKDVTTTSSREGKFEA 274

Query: 423 ---------TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
                        ++GH   +N V + P+  +  S  +D  +R+
Sbjct: 275 RFYHKIFQDEIGRVKGHFGPLNYVAVSPQGTSYASGGEDGFVRL 318

>Scas_721.7
          Length = 325

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 68/142 (47%), Gaps = 17/142 (11%)

Query: 292 FQVESNWRNGRCRIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLT 349
           F +E       C  +L  GH   V+SL +N    LLFT S D ++ IWDT  G +++ ++
Sbjct: 79  FTIEITHLTHGCLHRLM-GHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKTIS 137

Query: 350 GHTDGVKGIYF----DDQKMITASLDKTIRVWNYITGSCISTYRGHQ-----DSVLSVDS 400
            H++ V  +      D   + + S D  IR+++  TG C+ T    +     D V+ +  
Sbjct: 138 AHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQ 197

Query: 401 YK-----KIIVSASADKTVKVW 417
            +     K ++ +S D  VK+W
Sbjct: 198 VRFSPNGKFLLVSSFDGIVKIW 219

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 83/195 (42%), Gaps = 45/195 (23%)

Query: 405 IVSASADKTVKVWHVESRTCYTL--RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           +++ +    + ++ +++R  +++    H   ++ V   P +    S+SDD T+ +  + T
Sbjct: 29  LIAVTQLTQILIYDLQTRAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEITHL-T 87

Query: 463 NSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKY 522
           + C+    GH      VI LT  D+ NL                                
Sbjct: 88  HGCLHRLMGHTA---PVISLTYNDSGNL-------------------------------- 112

Query: 523 PTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA----DNFRIVSGSHDKSIKVW 578
              L + S+D +IK+W+   G  ++T   H E V  ++     D+  + SGS D  I+++
Sbjct: 113 ---LFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLF 169

Query: 579 DLQNGKCIQTFTGHK 593
           D + G C++T T  K
Sbjct: 170 DTRTGHCLKTLTYDK 184

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 79/195 (40%), Gaps = 46/195 (23%)

Query: 405 IVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS 464
           + SAS D T+++ H+     + L GHT  V  +  +      ++SS D+++++WD    +
Sbjct: 72  LASASDDFTIEITHLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGA 131

Query: 465 CIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPT 524
            +K    H    + V+ L+I    +  V                                
Sbjct: 132 ILKTISAHS---ESVVSLSICPDRDSSV-------------------------------- 156

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRT-----QFGHVEGVWDIAADNFR-----IVSGSHDKS 574
            L S S D  I+L++  +G C++T      +   +GV  I+   F      ++  S D  
Sbjct: 157 -LASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSPNGKFLLVSSFDGI 215

Query: 575 IKVWDLQNGKCIQTF 589
           +K+WD   G  ++TF
Sbjct: 216 VKIWDCVRGYVVRTF 230

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNF--RIVSGSHDKSIKVWDLQNG 583
           L S S D TI++  ++ G C+    GH   V  +  ++    + + S D+SIK+WD  +G
Sbjct: 72  LASASDDFTIEITHLTHG-CLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHG 130

Query: 584 KCIQTFTGHKAPIVCVGI 601
             ++T + H   +V + I
Sbjct: 131 AILKTISAHSESVVSLSI 148

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 10/107 (9%)

Query: 502 PELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQF--GHVEGVWDI 559
           P LEE         F PN +    L++ +    I ++++ + R I +     HV  + ++
Sbjct: 9   PLLEESRGHCTCARFSPNGR----LIAVTQLTQILIYDLQT-RAIHSIIPTSHVAPISEV 63

Query: 560 A--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDS 604
           A   DN  + S S D +I++  L +G C+    GH AP++ +   DS
Sbjct: 64  AWSPDNQCLASASDDFTIEITHLTHG-CLHRLMGHTAPVISLTYNDS 109

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 110/227 (48%), Gaps = 27/227 (11%)

Query: 262 PGNSPNQTVAARARNSRYYTRPWKVIYR--ERFQVESNWRNGRCRIQLFKGHMDGVLSLK 319
           PG  P+ T    +R+ +     W  + R  E +  E++    + R  L   H  GV  + 
Sbjct: 11  PGGGPS-TCGVFSRDGQ-----WLAVVRGIEVYIYETS--GYQLRETLVLEHAAGVSQIC 62

Query: 320 F--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIR 375
           +  + + + + S D TV +   + G L+ RL GHT  V  + ++++   + T+S+D++I+
Sbjct: 63  WSPDGKCIASCSDDFTVVVTHRQLG-LLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIK 121

Query: 376 VWNYITGSCISTYRGHQDSVLSV---DSYKKIIVSASADKTVKVWHVESRTCY-TLRGHT 431
           VW+ +TG+ + T   H + V+S+   D+   I+ S S D  ++++   +  C  TL    
Sbjct: 122 VWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDK 181

Query: 432 EWVNCVKLHPKSFTCYSS--------SDDKTLRMWDIRTNSCIKVFR 470
           +W +   + P +   +S+        S D  +++WD  +   ++ F+
Sbjct: 182 DWQSETGVVPIAKVKFSANTKYLLVKSYDGVVKIWDSVSGDVVRTFK 228

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 82/197 (41%), Gaps = 47/197 (23%)

Query: 403 KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           K I S S D TV V H +    + L GHT  V  +  + K    ++SS D+++++WD+ T
Sbjct: 68  KCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLT 127

Query: 463 NSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKY 522
            + +K    H                             P +  D +D+   I       
Sbjct: 128 GTVMKTMSAH---------------------------SEPVVSIDLSDNDGSI------- 153

Query: 523 PTHLLSCSLDNTIKLWEVSSGRCIRT-----QFGHVEGVWDIAADNFR-----IVSGSHD 572
              L S S D  I++++ ++G C++T      +    GV  IA   F      ++  S+D
Sbjct: 154 ---LSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYD 210

Query: 573 KSIKVWDLQNGKCIQTF 589
             +K+WD  +G  ++TF
Sbjct: 211 GVVKIWDSVSGDVVRTF 227

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA---DNFRIVSGSHDKSIKVWDLQN 582
           L + S+D +IK+W+V +G  ++T   H E V  I     D   + SGSHD  I+++D   
Sbjct: 111 LFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTAT 170

Query: 583 GKCIQTFT 590
           G C++T T
Sbjct: 171 GHCLKTLT 178

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQNG 583
           + SCS D T+ +     G   R   GH   V  +  +N    + + S D+SIKVWD+  G
Sbjct: 70  IASCSDDFTVVVTHRQLGLLHRL-VGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTG 128

Query: 584 KCIQTFTGHKAPIVCVGIGD 603
             ++T + H  P+V + + D
Sbjct: 129 TVMKTMSAHSEPVVSIDLSD 148

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 15/124 (12%)

Query: 315 VLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRL--------TGHTDGVKGIYFDDQK 364
           +  +KF  N + L   SYD  V IWD+ SG+++R            H  G+  +Y    +
Sbjct: 192 IAKVKFSANTKYLLVKSYDGVVKIWDSVSGDVVRTFKPSNKKYNLTHCCGMDFMYPQSTQ 251

Query: 365 --MITASLDK-TIRVWNYITGSCISTYRGHQ--DSVLSVDSYKKIIVSASADKTVKVWHV 419
             +I +  +K  I  W+  T + +   +  +   +++S+D +  ++ S S      +W  
Sbjct: 252 SPLILSGYEKGEIYCWDSNTKAELQVLKIEECDSAIISIDCHNNLMCSLSLAGNCTIWKY 311

Query: 420 ESRT 423
            + T
Sbjct: 312 VTET 315

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 79/163 (48%), Gaps = 15/163 (9%)

Query: 327 TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITGSC 384
           +GS D TV I   + G L  +L GH+  V  + F+     + TAS+D++I+ W+ ++G+ 
Sbjct: 72  SGSEDFTVEITHLEYGRL-HKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTL 130

Query: 385 ISTYRGHQDSVLSVDSY---KKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLH 440
           + T   H D V+S+D+      I+ S S D  ++++  ES  C  TL    +W     + 
Sbjct: 131 LKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVV 190

Query: 441 PKSFTCYS--------SSDDKTLRMWDIRTNSCIKVFRGHVGQ 475
           P S   +S         S D  +++WD      ++ F+   G+
Sbjct: 191 PISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGE 233

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 121/289 (41%), Gaps = 53/289 (18%)

Query: 332 STVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYR 389
           + + ++    G   R  T HT+ +  I +  D   + + S D T+ + +   G  +   R
Sbjct: 35  TAICVYSVGDGGCARYETTHTEPINDICWSPDSACVASGSEDFTVEITHLEYGR-LHKLR 93

Query: 390 GHQDSVLSV--DSYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTC 446
           GH   VLSV  +    ++ +AS D+++K W V S T   T+  H++ V  +       T 
Sbjct: 94  GHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSIDTPDCDATI 153

Query: 447 YSS-SDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELE 505
            SS S D  +R++D  +  C+K               T+   ++   D+ +  VP  +++
Sbjct: 154 LSSGSYDGLIRIFDTESGHCLK---------------TLTYDKDWQTDDGV--VPISQVK 196

Query: 506 EDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEG---------- 555
                     F  N K+   LL  SLD  +KLW+   G  +RT F    G          
Sbjct: 197 ----------FSRNGKF---LLVRSLDGVVKLWDFIRGCVVRT-FKDASGESRMKYSCGM 242

Query: 556 ---VWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH--KAPIVCV 599
                D  A +  +V G  D +I VW+ Q+    QT  G    +P++ V
Sbjct: 243 DFLYPDSEAADVMVVVGGEDGNICVWNAQSKAVAQTLKGQHEDSPVIAV 291

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (48%), Gaps = 15/129 (11%)

Query: 304 RIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD 361
           R+   +GH   VLS+ FN +  LL T S D ++  WD  SG L++ ++ H+D V  I   
Sbjct: 88  RLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSIDTP 147

Query: 362 D---QKMITASLDKTIRVWNYITGSCISTYRGHQ-----DSVLSVDSYK-----KIIVSA 408
           D     + + S D  IR+++  +G C+ T    +     D V+ +   K     K ++  
Sbjct: 148 DCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPISQVKFSRNGKFLLVR 207

Query: 409 SADKTVKVW 417
           S D  VK+W
Sbjct: 208 SLDGVVKLW 216

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAAD--NFRIVSGSHDKSIKVWDLQNG 583
           + S S D T+++  +  GR  + + GH   V  +  +     + + S D+SIK WD+ +G
Sbjct: 70  VASGSEDFTVEITHLEYGRLHKLR-GHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSG 128

Query: 584 KCIQTFTGHKAPIVCVGIGD 603
             ++T + H  P+V +   D
Sbjct: 129 TLLKTMSAHSDPVVSIDTPD 148

>Scas_692.29
          Length = 456

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/339 (20%), Positives = 122/339 (35%), Gaps = 110/339 (32%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVW-- 377
           + + + T SYD  +  W+  SG + ++ +GH+  ++ + F  D ++++A  D+T+R+W  
Sbjct: 114 DKKAIITASYDGVIRTWNL-SGKVQKQYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKT 172

Query: 378 -----------------NYITGSCISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHV 419
                            N   G  ++   GH+  V+S+D S    I+S+S D ++ +W  
Sbjct: 173 KNNDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSSSYDNSIGLWST 232

Query: 420 ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
             +    +    E  N      K  T        TL+   IR  + + +   H   V++ 
Sbjct: 233 IYKEMTVVDPMEEINNA---DNKISTAARKRRKLTLKDGTIRRRAPLSLLESHTAPVEQA 289

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                                      D  DD  G             S S D+TIK W+
Sbjct: 290 -------------------------SFDINDDTVG------------YSVSQDHTIKTWD 312

Query: 540 VSSGRCIRTQ---------------------------------------------FGHVE 554
           + + RCI T+                                              GH  
Sbjct: 313 LVTARCIDTKTTSYSLLSLTQLPTLNLLACGSSARHITLHDPRMGASSKVTQHQLIGHKN 372

Query: 555 GV--WDIAADNFRIV-SGSHDKSIKVWDLQNGKCIQTFT 590
            V   D   +N  I+ SGSHD ++KVWD+++   + T T
Sbjct: 373 FVVSLDTCPENEYILCSGSHDGTVKVWDVRSTAPMYTIT 411

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 90/240 (37%), Gaps = 66/240 (27%)

Query: 394 SVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
           S + V   KK I++AS D  ++ W++  +      GH+  +  VK    +    S+ +D+
Sbjct: 107 SSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKFISDT-RLVSAGNDR 165

Query: 454 TLRMWDIRTN-SCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDC 512
           TLR+W  + N S ++ F     +        I+D + L + E   K P            
Sbjct: 166 TLRLWKTKNNDSVVQHFDEEDEEAN------IEDGKTLAILEG-HKAP------------ 206

Query: 513 TGIFDPNLKYPTHLLSCSLDNTIKLW---------------------EVSSGRCIRTQFG 551
             +   ++   + +LS S DN+I LW                     ++S+    R +  
Sbjct: 207 --VVSLDVSNTSRILSSSYDNSIGLWSTIYKEMTVVDPMEEINNADNKISTAARKRRKLT 264

Query: 552 HVEGV---------------------WDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFT 590
             +G                      +DI  D     S S D +IK WDL   +CI T T
Sbjct: 265 LKDGTIRRRAPLSLLESHTAPVEQASFDINDDTVG-YSVSQDHTIKTWDLVTARCIDTKT 323

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 50/102 (49%), Gaps = 21/102 (20%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKSIKVW------ 578
           +++ S D  I+ W +S G+  +   GH   +  +    + R+VS  +D+++++W      
Sbjct: 118 IITASYDGVIRTWNLS-GKVQKQYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKTKNND 176

Query: 579 -------------DLQNGKCIQTFTGHKAPIVCVGIGDSSFV 607
                        ++++GK +    GHKAP+V + + ++S +
Sbjct: 177 SVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRI 218

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 558 DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG-IGDSSFVSG 609
           D++ D   I++ S+D  I+ W+L +GK  + ++GH  PI  V  I D+  VS 
Sbjct: 110 DVSQDKKAIITASYDGVIRTWNL-SGKVQKQYSGHSGPIRAVKFISDTRLVSA 161

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 3/35 (8%)

Query: 310 GHMDGVLSLKF---NHRLLFTGSYDSTVAIWDTKS 341
           GH + V+SL     N  +L +GS+D TV +WD +S
Sbjct: 369 GHKNFVVSLDTCPENEYILCSGSHDGTVKVWDVRS 403

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 64/131 (48%), Gaps = 13/131 (9%)

Query: 345 IRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD----- 399
           I     H+  VK +    + +++ S D+ IR+++      + T  GHQ S+ ++      
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGK 93

Query: 400 -------SYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSD 451
                     K ++SAS D  + VW V+    + TL+GHT  +N   +HP +    S S+
Sbjct: 94  DADGQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSE 153

Query: 452 DKTLRMWDIRT 462
           D ++R+W++ T
Sbjct: 154 DHSIRLWNLMT 164

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 74/194 (38%), Gaps = 48/194 (24%)

Query: 425 YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTI 484
           +  + H+  V C+ +  +     S S+D+ +R++D++    +    GH G +  +     
Sbjct: 35  FHFQAHSLSVKCLDISKRYLV--SGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRG 92

Query: 485 KDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR 544
           KD +                              +++    LLS S D+ I +W V    
Sbjct: 93  KDADG----------------------------QDIQLNKWLLSASEDHKIIVWRVKDWE 124

Query: 545 CIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDL---------------QNGKCIQ 587
              T  GH   +  +DI   N   VS S D SI++W+L               QNG+ ++
Sbjct: 125 NFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNLMTVKKAGVLKLRKYNQNGQFVR 184

Query: 588 TFTGHKAPIVCVGI 601
            + G     + VG+
Sbjct: 185 -WCGENGSYIAVGL 197

>Kwal_55.21450
          Length = 503

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 87/192 (45%), Gaps = 29/192 (15%)

Query: 299 RNGRCR-----IQLFKGHMDG---VLSLKFNHRLLFTGSYDSTVAIWDT-KSGNLIRRLT 349
           R+ RC      I  + GH +G   +L L  +  L  +   D+ V IWD  +   L+R   
Sbjct: 192 RSFRCYLPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYR 251

Query: 350 GHTDGVKGIYFDDQ--KMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVS 407
           GH+  V+GI F+ +  + ++ S D+ I++W+  TG        HQ S   + +  +   S
Sbjct: 252 GHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKV-----RHQYSYSCIPNCAEFRPS 306

Query: 408 ASADKTVKVWHVESRTCYTLRG------------HTEWVNCVKLHPKSFTCYSSSDDKTL 455
            S +  V + + E R  Y LR             H   +  +K  P      SSS+DK++
Sbjct: 307 NSNEFIVGLSNSEIRH-YDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSM 365

Query: 456 RMWDIRTNSCIK 467
           R+W+ + N  IK
Sbjct: 366 RIWENQINIPIK 377

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 527 LSCSLDNTIKLWEVSSGR-CIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNG 583
           LS   DN +K+W++   R  +R   GH + V  I+  ++    +S S D+ IK+WD + G
Sbjct: 227 LSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETG 286

Query: 584 KCIQTFT 590
           K    ++
Sbjct: 287 KVRHQYS 293

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 103/244 (42%), Gaps = 43/244 (17%)

Query: 344 LIRRLTGHTDGVKGI-YFDDQKMI-TASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY 401
           L+  L GH   +  + Y    K I +AS D T R+W+  T   +    GH   V S+ S+
Sbjct: 257 LLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSL-SF 315

Query: 402 K---KIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
           +    ++ S   D    +W + S +   TL GH++ +  V   P  +   +   D  + +
Sbjct: 316 QCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINV 375

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           WDIR        +   GQ+ +++        N+V   +  K       ED          
Sbjct: 376 WDIR--------KRDEGQLNQILA-----HRNIVTQVRFSK-------EDGG-------- 407

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSI 575
                   L+SC  DN I ++   +   + +  GH + +   DI+ ++  +VSG  D+SI
Sbjct: 408 ------KKLVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSI 461

Query: 576 KVWD 579
           K+W+
Sbjct: 462 KLWN 465

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 77/164 (46%), Gaps = 11/164 (6%)

Query: 307 LFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DD 362
           L +GH  GV SL F  +  L+ +G  DS   +WD +SG+ +  L GH+  +  + +  + 
Sbjct: 302 LQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNG 361

Query: 363 QKMITASLDKTIRVWNYIT--GSCISTYRGHQDSVLSVDSYK----KIIVSASADKTVKV 416
            ++ T   D  I VW+        ++    H++ V  V   K    K +VS   D  + V
Sbjct: 362 YQVATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLINV 421

Query: 417 WHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
           +  ++     +L GHT+ +  + +   S    S   D+++++W+
Sbjct: 422 YSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKC 585
           S S D T +LW+ S+ + +  Q GH +GV+ ++   D   + SG  D    +WD+++G  
Sbjct: 282 SASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSK 341

Query: 586 IQTFTGHKAPIVCVG 600
           + T  GH  PI  V 
Sbjct: 342 VMTLAGHSKPIYTVA 356

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 67/162 (41%), Gaps = 40/162 (24%)

Query: 422 RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP 481
           R    L GH   ++ VK HP      S+S D T R+WD  T+  + +  GH    + V  
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHD---KGVFS 312

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVS 541
           L+ +   +LV                    C+G                +D+   LW++ 
Sbjct: 313 LSFQCDGSLV--------------------CSG---------------GMDSLSMLWDIR 337

Query: 542 SGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQ 581
           SG  + T  GH + ++ +A   + +++ +G  D  I VWD++
Sbjct: 338 SGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIR 379

>Kwal_56.24163
          Length = 729

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 58/116 (50%), Gaps = 15/116 (12%)

Query: 405 IVSASADKTVKVWHVESRTC-YTLRGH-TEWVNCVKLHPKSFTCY--SSSDDKTLRMWDI 460
             SA  D TVK+W +   T  +TL+ H T  VN V  +P     Y  +SSDD+T+++WD 
Sbjct: 13  FASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDY 72

Query: 461 RTNSCIKVFRGHVGQVQKVI-----PLTIKDTENLVVD------EKIEKVPNPELE 505
           +T SC+    GH+  V   +     P+ +  +E+  +        K+EK  N  LE
Sbjct: 73  QTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNTYKLEKTLNLGLE 128

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 63/132 (47%), Gaps = 16/132 (12%)

Query: 331 DSTVAIWDTKSGNLIRRLTGH-TDGVKGIYF----DDQKMITASLDKTIRVWNYITGSCI 385
           D TV IW          L  H T GV  + +    D   +IT+S D+T+++W+Y T SC+
Sbjct: 19  DHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCV 78

Query: 386 STYRGHQDSVLSVDSYK------KIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVK 438
           +T  GH  +V    SY        II+S S D T+KVW+  + +   TL    E   C+ 
Sbjct: 79  ATLEGHMANV----SYAVFHPSLPIILSGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIA 134

Query: 439 LHPKSFTCYSSS 450
            HP     Y +S
Sbjct: 135 THPTGKRNYIAS 146

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 519 NLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGH-VEGV----WDIAADNFRIVSGSHDK 573
           N K P+   S  LD+T+K+W +       T   H   GV    +    D   +++ S D+
Sbjct: 6   NPKDPSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDR 65

Query: 574 SIKVWDLQNGKCIQTFTGHKAPI 596
           ++K+WD Q   C+ T  GH A +
Sbjct: 66  TVKIWDYQTKSCVATLEGHMANV 88

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV-WDIAADNFRIV-SGSHDKSIKVWDLQN 582
           +L++ S D T+K+W+  +  C+ T  GH+  V + +   +  I+ SGS D ++KVW+   
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

Query: 583 GKCIQTF 589
            K  +T 
Sbjct: 117 YKLEKTL 123

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWN 378
           L T S D TV IWD ++ + +  L GH   V    F      +++ S D T++VWN
Sbjct: 58  LITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWN 113

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 5/73 (6%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQNG 583
           L SCS D++  +W   +G  + T  GH   +W I  D F    V+GS D SIK+WD+ NG
Sbjct: 25  LFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNG 84

Query: 584 KCIQTFTGHKAPI 596
           +C+ T+   K+P+
Sbjct: 85  QCVATW---KSPV 94

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 310 GHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKM 365
           GH   +  +K+N    LLF+ S DS+ ++W + +G  +  L GHT  +  I  D   +  
Sbjct: 8   GHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYC 67

Query: 366 ITASLDKTIRVWNYITGSCISTYR 389
           +T S D +I++W+   G C++T++
Sbjct: 68  VTGSADYSIKLWDVSNGQCVATWK 91

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 347 RLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSYK 402
           +LTGH   +  + ++ +   + + S D +  VW  + G  + T  GH  ++ S  VD + 
Sbjct: 5   KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFT 64

Query: 403 KIIVSASADKTVKVWHVESRTC 424
           K  V+ SAD ++K+W V +  C
Sbjct: 65  KYCVTGSADYSIKLWDVSNGQC 86

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 390 GHQDSVLSVDSYKK--IIVSASADKTVKVWH-VESRTCYTLRGHTEWVNCVKLHPKSFTC 446
           GH+  +  V   K+  ++ S S D +  VW+ +      TL GHT  +  + +   +  C
Sbjct: 8   GHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYC 67

Query: 447 YSSSDDKTLRMWDIRTNSCIKVFRGHV 473
            + S D ++++WD+    C+  ++  V
Sbjct: 68  VTGSADYSIKLWDVSNGQCVATWKSPV 94

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 522 YPTHLLSCSLDNTIKLWEVSSGRCIRT 548
           +  + ++ S D +IKLW+VS+G+C+ T
Sbjct: 63  FTKYCVTGSADYSIKLWDVSNGQCVAT 89

>Kwal_27.12239
          Length = 316

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 61/123 (49%), Gaps = 15/123 (12%)

Query: 310 GHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI---YFDDQK 364
           GH   V S+K+  +  LL + S D ++ IWD  SG L+R L+ H++ V  I    FD   
Sbjct: 97  GHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFDPSI 156

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQD-----SVLSVDSYK-----KIIVSASADKTV 414
           + + S D  IR+++  TG C+ T    +D      V+ +   K     K ++  S D  +
Sbjct: 157 LSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGIL 216

Query: 415 KVW 417
           K+W
Sbjct: 217 KIW 219

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 96/238 (40%), Gaps = 49/238 (20%)

Query: 364 KMITASLDKTIRVWNY--ITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVES 421
           K +   +D  I V+N    + +  ST      S L      + I +AS D T+ + H+  
Sbjct: 30  KYVAICVDVDIVVFNLEDQSSTTFSTLHSRPLSDLCWSPDSQCIATASDDFTIIITHIVF 89

Query: 422 RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIP 481
              + L GHT  V  VK   K     S S D+++++WDI + + ++    H         
Sbjct: 90  GELHRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAH--------- 140

Query: 482 LTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVS 541
                       E +  +  P             FDP++     L S S D  I++++ +
Sbjct: 141 -----------SEPVVSIDLPP------------FDPSI-----LSSGSYDGLIRIFDTA 172

Query: 542 SGRCIRT-----QFGHVEGVWDIAADNFR-----IVSGSHDKSIKVWDLQNGKCIQTF 589
           +G C++T      +    GV  I+   F      ++  S D  +K+WD   GK ++TF
Sbjct: 173 TGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTF 230

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR---IVSGSHDKSIKVWDLQN 582
           L SCS+D +IK+W++ SG  +RT   H E V  I    F    + SGS+D  I+++D   
Sbjct: 114 LCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTAT 173

Query: 583 GKCIQTFTGHK 593
           G C++T T  K
Sbjct: 174 GHCLKTLTYDK 184

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 102/244 (41%), Gaps = 50/244 (20%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWH 418
           D Q + TAS D TI + + + G  +    GH   V SV    K  ++ S S D+++K+W 
Sbjct: 69  DSQCIATASDDFTIIITHIVFGE-LHRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWD 127

Query: 419 VESRTCY-TLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRTNSCIKVFRGHVGQV 476
           + S T   TL  H+E V  + L P   +  SS S D  +R++D  T  C+K         
Sbjct: 128 ILSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTLTYD---- 183

Query: 477 QKVIPLTIKD--TENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNT 534
                   KD  +EN VV       P  +++          F  N KY   LL  SLD  
Sbjct: 184 --------KDWQSENGVV-------PISQVK----------FSRNGKY---LLVKSLDGI 215

Query: 535 IKLWEVSSGRCIRT-QFGHVEGVWDIAADNFR----------IVSGSHDKSIKVWDLQNG 583
           +K+W+   G+ +RT + G    +      +F           +VSG+    I  WD Q  
Sbjct: 216 LKIWDFVRGKVVRTFKSGESSSLRYSCGMDFLYPQDQTVDPIVVSGTESGQIVCWDSQTK 275

Query: 584 KCIQ 587
              Q
Sbjct: 276 NLTQ 279

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 77/164 (46%), Gaps = 15/164 (9%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWN 378
           + + + T S D T+ I     G L  RL GHT  V  + +  +   + + S+D++I++W+
Sbjct: 69  DSQCIATASDDFTIIITHIVFGEL-HRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWD 127

Query: 379 YITGSCISTYRGHQDSVLSVDSY---KKIIVSASADKTVKVWHVESRTCY-TLRGHTEWV 434
            ++G+ + T   H + V+S+D       I+ S S D  ++++   +  C  TL    +W 
Sbjct: 128 ILSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQ 187

Query: 435 NCVKLHPKSFTCYS--------SSDDKTLRMWDIRTNSCIKVFR 470
           +   + P S   +S         S D  L++WD      ++ F+
Sbjct: 188 SENGVVPISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTFK 231

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 55/105 (52%), Gaps = 13/105 (12%)

Query: 305 IQLFKGHMDGVLSL---KFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTD-------- 353
           ++    H + V+S+    F+  +L +GSYD  + I+DT +G+ ++ LT   D        
Sbjct: 134 LRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVV 193

Query: 354 GVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVL 396
            +  + F  + + ++  SLD  +++W+++ G  + T++  + S L
Sbjct: 194 PISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRTFKSGESSSL 238

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           + S S D+SIK+WD+ +G  ++T + H  P+V + +
Sbjct: 114 LCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDL 149

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 77/164 (46%), Gaps = 15/164 (9%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWN 378
           + + + T S D T+ I     G L  RL GHT  V  + +  +   + +AS+D++I++W+
Sbjct: 67  DSQCIATASDDFTIEINHITYGRL-HRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWD 125

Query: 379 YITGSCISTYRGHQDSVLSVDSY---KKIIVSASADKTVKVWHVESRTCY-TLRGHTEW- 433
            +TG+ + T   H + V+S+D       I+ S S D  ++++   +  C  TL    +W 
Sbjct: 126 VLTGTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWK 185

Query: 434 -------VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
                  ++ VK           S D  L++WD    S ++ F+
Sbjct: 186 SENGVVPISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTFK 229

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 15/129 (11%)

Query: 304 RIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF- 360
           R+    GH   VLSL +  +  LL + S D ++ IWD  +G L++ ++ H++ V  I   
Sbjct: 89  RLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMP 148

Query: 361 --DDQKMITASLDKTIRVWNYITGSCISTYRGHQD-----SVLSVDSYK-----KIIVSA 408
             D   + + S D  IR+++  TG C+ T    +D      V+ +   K     K ++  
Sbjct: 149 VCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVK 208

Query: 409 SADKTVKVW 417
           S D  +K+W
Sbjct: 209 SLDGVLKIW 217

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 119/272 (43%), Gaps = 54/272 (19%)

Query: 349 TGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKI 404
           T H + +  I +  D Q + TAS D TI + N+IT   +    GH   VLS+   S   +
Sbjct: 53  TSHVESMSDICWSPDSQCIATASDDFTIEI-NHITYGRLHRLVGHTAPVLSLVYTSKGNL 111

Query: 405 IVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSS-SDDKTLRMWDIRT 462
           + SAS D+++K+W V + T   T+  H+E V  + +     +  SS S D  +R++D  T
Sbjct: 112 LCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTT 171

Query: 463 NSCIKVFRGHVGQVQKVIPLTIKD--TENLVVDEKIEKVPNPELEEDFADDCTGIFDPNL 520
             C+K                 KD  +EN VV       P  +++          F  N 
Sbjct: 172 GHCLKTLTYD------------KDWKSENGVV-------PISQVK----------FSVNG 202

Query: 521 KYPTHLLSCSLDNTIKLWEVSSGRCIRT-------QFGHVEGV-WDIAADNFR---IVSG 569
           KY   LL  SLD  +K+W+   G  +RT       +  +  G+ +   +D      +V+G
Sbjct: 203 KY---LLVKSLDGVLKIWDFIRGSVVRTFKICDSTKLKYSCGMDFLYPSDQLSSPVVVAG 259

Query: 570 SHDKSIKVWDLQNGKCIQ--TFTGHKAPIVCV 599
                I  WD Q+ K +Q   +    +P+V V
Sbjct: 260 GESDGIYCWDAQSKKLLQHINYKHQNSPVVSV 291

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 96/240 (40%), Gaps = 49/240 (20%)

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHV 419
           D K I  S   +  ++N   G        H +S+  +      + I +AS D T+++ H+
Sbjct: 26  DGKFIAVSQGTSYLLYNVSDGLSAFIPTSHVESMSDICWSPDSQCIATASDDFTIEINHI 85

Query: 420 ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
                + L GHT  V  +    K     S+S D+++++WD+ T + +K    H       
Sbjct: 86  TYGRLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAH------- 138

Query: 480 IPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
                         E +  +  P            + DP++     L S S D  I++++
Sbjct: 139 -------------SEPVVSIDMP------------VCDPSI-----LSSGSYDGLIRIFD 168

Query: 540 VSSGRCIRT-----QFGHVEGVWDIAADNFRI-----VSGSHDKSIKVWDLQNGKCIQTF 589
            ++G C++T      +    GV  I+   F +     +  S D  +K+WD   G  ++TF
Sbjct: 169 TTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTF 228

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 80/184 (43%), Gaps = 31/184 (16%)

Query: 304 RIQLFKGHMDGVLSL---KFNHRLLFTGSYDSTVAIWD---TKSGNLIRRLTGHTDGVKG 357
           +I LF+GH   VL      F+ R+L +GS D  + +W+   T S +  +   G+ + V  
Sbjct: 73  QIPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAP 132

Query: 358 IYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW 417
           + F                   +TG       GH   VL   + + ++ S+S D TV++W
Sbjct: 133 VKF-------------------LTGHQRKV--GH---VLYHPTAQGVLASSSLDHTVRLW 168

Query: 418 HVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG-QV 476
           +VE  T   +  H + V  +          +   DK LR+WDIR    +    GH G + 
Sbjct: 169 NVEQGTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKN 228

Query: 477 QKVI 480
           Q+V+
Sbjct: 229 QRVV 232

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 71/193 (36%), Gaps = 35/193 (18%)

Query: 427 LRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIK 485
            RGHT  V      P       S SDD  + +W+I         +   G V+ V P+   
Sbjct: 77  FRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVEHVAPVKFL 136

Query: 486 DTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH---LLSCSLDNTIKLWEVSS 542
                    K+  V                    L +PT    L S SLD+T++LW V  
Sbjct: 137 TGHQ----RKVGHV--------------------LYHPTAQGVLASSSLDHTVRLWNVEQ 172

Query: 543 GR--CIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAP----I 596
           G    + T    V  +   +     + +   DK ++VWD++ G+ +    GH  P    +
Sbjct: 173 GTNPIVLTHPDMVTSM-SFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPKNQRV 231

Query: 597 VCVGIGDSSFVSG 609
           V +G  D    +G
Sbjct: 232 VWLGNSDRLATTG 244

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 69/176 (39%), Gaps = 22/176 (12%)

Query: 311 HMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF----DDQK 364
           H D V S+ F++    L T   D  + +WD + G ++    GH+ G K        +  +
Sbjct: 181 HPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHS-GPKNQRVVWLGNSDR 239

Query: 365 MITASL----DKTIRVW---NYITGSCISTYRGHQDSVLSV----DSYKKIIVSASADKT 413
           + T       D+ I VW   N   G     Y   Q S + +    DS K + V+   D  
Sbjct: 240 LATTGFSKLSDRQIAVWDAFNLEKGQLGGFYNVDQSSGILMPFYDDSNKILYVAGKGDGN 299

Query: 414 VKVWHVESRTCYTLR--GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK 467
           ++ +  +    Y L     TE      + PK     +  +++ LR +    + CI+
Sbjct: 300 IRYYEFQDDELYELSEFQSTEPQRGFAVAPKR--SVNVKENEVLRAYKTVRDQCIE 353

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRI--VSGSHDKSIKVWDLQNG 583
           L +CS D +  +W  ++G  + T  GH+  +W I +D+  +  V+GS D +IKVW L NG
Sbjct: 25  LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNG 84

Query: 584 KCIQTF 589
           +C+QT+
Sbjct: 85  QCVQTW 90

 Score = 48.5 bits (114), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 304 RIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD 361
           R  +  GH   +  +K+N    LLFT S D + ++W + +G  +  L GH   +  I  D
Sbjct: 2   RPIVLMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSD 61

Query: 362 DQKM--ITASLDKTIRVWNYITGSCISTY 388
              +  +T S D TI+VW  + G C+ T+
Sbjct: 62  HTSLYCVTGSADYTIKVWTLMNGQCVQTW 90

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 348 LTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKII 405
           L GH   +  + ++ +   + T S D +  VW    G  + T  GH  S+ S+DS    +
Sbjct: 6   LMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSL 65

Query: 406 --VSASADKTVKVWHVESRTC 424
             V+ SAD T+KVW + +  C
Sbjct: 66  YCVTGSADYTIKVWTLMNGQC 86

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 3/83 (3%)

Query: 390 GHQDSVLSVDSYKK--IIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTC 446
           GH+  +  V   ++  ++ + S D +  VW+  +     TL GH   +  +     S  C
Sbjct: 8   GHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYC 67

Query: 447 YSSSDDKTLRMWDIRTNSCIKVF 469
            + S D T+++W +    C++ +
Sbjct: 68  VTGSADYTIKVWTLMNGQCVQTW 90

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 74/158 (46%), Gaps = 23/158 (14%)

Query: 324 LLFTGSYDSTVAIW-----DTKSG-----NLIRRLTGHTDGVKGIYF--DDQKMITASLD 371
           LL  GS+DST++IW     D + G      L+  + GH + VKGI +  D   + T S D
Sbjct: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132

Query: 372 KTIRVWNYITG----SCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVW--HVESRT 423
           K++ +W          CIS  + H   V  V  + K  ++ S+S D TV++W  + +   
Sbjct: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192

Query: 424 CYT-LRGH--TEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
           C   L GH  T W +            S SDD T+R+W
Sbjct: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 35.8 bits (81), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 72/328 (21%), Positives = 110/328 (33%), Gaps = 94/328 (28%)

Query: 308 FKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSG--NLIRRL--TGHTDGVKGIYFD 361
            K H D V S+ F     LL TGS D  + +   K+G  NL+  L  T H   V+ + + 
Sbjct: 9   LKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWR 68

Query: 362 DQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHV 419
                +   S D TI +W   T S +    G +                          +
Sbjct: 69  PHSDLLAAGSFDSTISIW---TQSDLDLEEGAK--------------------------L 99

Query: 420 ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI----RTNSCIKVFRGHVGQ 475
           E      + GH   V  +          + S DK++ +W+         CI V + H   
Sbjct: 100 EMELLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQD 159

Query: 476 VQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTI 535
           V+ V+  T     NL                                   L S S D+T+
Sbjct: 160 VKHVVWHT---KHNL-----------------------------------LASSSYDDTV 181

Query: 536 KLWEV--SSGRCIRTQFGHVEGVW--DIA--ADNFRIVSGSHDKSIKVW--------DLQ 581
           ++W+       C     GH   +W  D +   D  R+ SGS D +++VW        D Q
Sbjct: 182 RIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQ 241

Query: 582 NGKCIQTF-TGHKAPIVCVGIGDSSFVS 608
              C  T    H++ I  V    S  ++
Sbjct: 242 EWVCESTLPNAHRSQIYGVAWSPSGRIA 269

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 79/182 (43%), Gaps = 27/182 (14%)

Query: 304 RIQLFKGHMDGVLSLKFN----HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY 359
           ++ LF+GH   VL   F+    HR+  +GS DS + IWD        +   H D      
Sbjct: 73  QVPLFRGHTAQVLDTDFDPFNDHRIA-SGSDDSKIGIWDIPEN---YKFHDHVD------ 122

Query: 360 FDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHV 419
            +D + I       I+   ++TG       GH   VL     + ++ S+S D TVK+W+V
Sbjct: 123 -EDGEPI------DIKPVKFLTGHARKV--GH---VLYHPVAENVLASSSGDYTVKLWNV 170

Query: 420 ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG-QVQK 478
           E+        H + V  +          + + DK LR+W+IR    +     H G + Q+
Sbjct: 171 ETGKDMITLKHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQR 230

Query: 479 VI 480
           V+
Sbjct: 231 VV 232

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 27/170 (15%)

Query: 427 LRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIK 485
            RGHT  V      P       S SDD  + +WDI  N     F  HV +  +  P+ IK
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYK---FHDHVDEDGE--PIDIK 131

Query: 486 DTENLVV-DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR 544
             + L     K+  V    L    A++              L S S D T+KLW V +G+
Sbjct: 132 PVKFLTGHARKVGHV----LYHPVAENV-------------LASSSGDYTVKLWNVETGK 174

Query: 545 CIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
            + T   H + V  +  + D   + + + DK ++VW+++  K +     H
Sbjct: 175 DMIT-LKHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAH 223

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 65/130 (50%), Gaps = 12/130 (9%)

Query: 345 IRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK-- 402
           I     H+  VK +    + +++ S D+ IR+++      + T   HQ S+ ++   K  
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVS 93

Query: 403 ---------KIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDD 452
                    K ++SAS D  + VW V+    + TL+GHT  +N + +HP +    S S+D
Sbjct: 94  DQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSED 153

Query: 453 KTLRMWDIRT 462
            ++R+W++ T
Sbjct: 154 HSIRLWNLMT 163

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 13/125 (10%)

Query: 308 FKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF---DDQK 364
           F+ H   V  L  + R L +GS D  + I+D +    +  L  H   +  + F    DQ+
Sbjct: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQE 96

Query: 365 --------MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTV 414
                   +++AS D  I VW         T +GH   +  +D +   +++ S S D ++
Sbjct: 97  PKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSI 156

Query: 415 KVWHV 419
           ++W++
Sbjct: 157 RLWNL 161

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 60/159 (37%), Gaps = 33/159 (20%)

Query: 424 CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLT 483
            +  + H+  V C+ +  +     S S+D+ +R++D++    +     H G +  +    
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLV--SGSNDEHIRIYDLQKRKELGTLLAHQGSITNL---- 87

Query: 484 IKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSG 543
                      K  KV + E              P       LLS S DN I +W V   
Sbjct: 88  -----------KFSKVSDQE--------------PKSTSGKWLLSASEDNKIIVWRVKDW 122

Query: 544 RCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDL 580
               T  GH   +   DI   N  + S S D SI++W+L
Sbjct: 123 ENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNL 161

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
           +VSGS+D+ I+++DLQ  K + T   H+  I
Sbjct: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSI 84

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 82/195 (42%), Gaps = 43/195 (22%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQ--K 364
           + H+  +  LKF  +   L + S D  + IW  K G+  R L GH   V  I   D+   
Sbjct: 133 QAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRN 192

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADK------TVKVWH 418
           +++ASLD TIR+W   TG+ I T+   ++    V+S   I +    D+      T K  +
Sbjct: 193 VLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNS---IALFVGTDRQLHEISTSKKNN 249

Query: 419 VESRTC--YTLRGHTEWVNCVKLH-----------PKSFTC---------------YSSS 450
           +E  T   Y + GH   V  + +H           P  FTC               Y+  
Sbjct: 250 LEFGTYGKYVIAGHVSGV--ITVHNVFSKEQTIQLPSKFTCSCNSLTVDGNNANYIYAGY 307

Query: 451 DDKTLRMWDIRTNSC 465
           ++  L  WD+R+  C
Sbjct: 308 ENGMLAQWDLRSPEC 322

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFR-IVSGSHDKSIKVWDLQNG 583
           L+S S D  +K+W V  G   RT  GH   V DIA  D  R ++S S D +I++W+   G
Sbjct: 151 LISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTG 210

Query: 584 KCIQTFTGHKAP 595
             I TF   + P
Sbjct: 211 TTIHTFNRKENP 222

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 405 IVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463
           ++S+S D  +K+W V +     TL GH   V  + +  +     S+S D T+R+W+  T 
Sbjct: 151 LISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTIRLWECGTG 210

Query: 464 SCIKVF 469
           + I  F
Sbjct: 211 TTIHTF 216

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 43/121 (35%), Gaps = 38/121 (31%)

Query: 428 RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDT 487
           + H   +  +K  P      SSS D  L++W ++  S  +   GH   V          T
Sbjct: 133 QAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATV----------T 182

Query: 488 ENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIR 547
           +  ++D                               ++LS SLD TI+LWE  +G  I 
Sbjct: 183 DIAIIDRG----------------------------RNVLSASLDGTIRLWECGTGTTIH 214

Query: 548 T 548
           T
Sbjct: 215 T 215

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 23/38 (60%)

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGD 603
           ++S S D  +K+W +++G   +T  GH+A +  + I D
Sbjct: 151 LISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIID 188

>Scas_685.11
          Length = 384

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 63/132 (47%), Gaps = 14/132 (10%)

Query: 345 IRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD----- 399
           I     H   VK +    + +++ S D+ IR+++      + T   HQ S+ ++      
Sbjct: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSK 93

Query: 400 --------SYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSS 450
                   S  K ++SAS D  + +W V+    + TL+GH   +N V +HP +    S S
Sbjct: 94  TENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVS 153

Query: 451 DDKTLRMWDIRT 462
           +D ++R+W++ T
Sbjct: 154 EDHSIRLWNLMT 165

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 75/189 (39%), Gaps = 33/189 (17%)

Query: 398 VDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
           V SY+  I+  S D ++K         +  + H   V C+ +  +     S S+D+ +R+
Sbjct: 10  VGSYEHNILCLSLDLSLKTPLF--TPIFHFQAHALSVKCLDVSKRYLV--SGSNDEHIRI 65

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           +D++    +     H G +   +  +   TEN                     D  G   
Sbjct: 66  YDLQKRKELGTLLAHQGSITN-LKFSKSKTEN--------------------GDGEG--- 101

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSI 575
            N K+   LLS S DN I +W V       T  GH+  +   DI   N   +S S D SI
Sbjct: 102 SNNKW---LLSASEDNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSI 158

Query: 576 KVWDLQNGK 584
           ++W+L   K
Sbjct: 159 RLWNLMTVK 167

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGDELG 613
           +VSGS+D+ I+++DLQ  K + T   H+  I  +    S   +GD  G
Sbjct: 54  LVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTENGDGEG 101

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 49/108 (45%), Gaps = 14/108 (12%)

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESR-TCYTLRGHTEWVNCVKLHPKS 443
           I  ++ H  SV  +D  K+ +VS S D+ ++++ ++ R    TL  H   +  +K   KS
Sbjct: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF-SKS 92

Query: 444 FT------------CYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
            T              S+S+D  + +W ++        +GH+ ++  V
Sbjct: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 21/128 (16%)

Query: 311 HMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSG---------------NLIRRLTGHTD 353
           H   V +LKF  +++ L +GS D  + IW+ + G               N+ RRL  H +
Sbjct: 76  HTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDN 135

Query: 354 GVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSAS 409
            ++ I +  D   ++T  LD++I VWN  T   I  +  HQ  V  V  D   K   +AS
Sbjct: 136 DIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDPANKYFATAS 195

Query: 410 ADKTVKVW 417
            D+TVKV+
Sbjct: 196 DDRTVKVF 203

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYIT 381
           +L T   D ++ +W+  +   I+R   H   VKG+ FD  ++   TAS D+T++V+ Y  
Sbjct: 148 ILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDPANKYFATASDDRTVKVFRYHK 207

Query: 382 GSCIS 386
           G+ +S
Sbjct: 208 GTDLS 212

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 88/226 (38%), Gaps = 48/226 (21%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           D Q++ T  LD  IR+W                SV  +  + K  VS  A +        
Sbjct: 28  DGQRVATGGLDGKIRIW----------------SVADILVFAKPKVSWPARE-----EQL 66

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480
            +    +  HT  V  +K  P +    S SDDK L +W+              G VQ + 
Sbjct: 67  RKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWE-----------KEEGAVQPLF 115

Query: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV 540
            +   D E+  V  ++    N     D  D C   + P+    + L++  LD +I +W  
Sbjct: 116 DME-NDLEHWNVRRRLVAHDN-----DIQDIC---WAPD---SSILVTVGLDRSIIVWNG 163

Query: 541 SSGRCIR---TQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNG 583
           S+   I+       HV+GV    A+ +   + S D+++KV+    G
Sbjct: 164 STFEKIKRFDVHQSHVKGVVFDPANKY-FATASDDRTVKVFRYHKG 208

>Scas_717.68
          Length = 908

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 383 SCISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHP 441
           SC   ++ H   VL +D S    ++++S D+TVK+WH+E +T      H ++V CV+ HP
Sbjct: 319 SCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHP 378

Query: 442 KSFTCY-SSSDDKTLRMWDIRTN 463
                + S   D  +R+W I  N
Sbjct: 379 TDDRFFISGCLDHKVRLWSILEN 401

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 499 VPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWD 558
           V NP   + F +    + D +      L++ S+D T+KLW +     ++T F H + V  
Sbjct: 315 VFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKT-FQHQDFVTC 373

Query: 559 I---AADNFRIVSGSHDKSIKVWDL 580
           +     D+   +SG  D  +++W +
Sbjct: 374 VRFHPTDDRFFISGCLDHKVRLWSI 398

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 7/70 (10%)

Query: 545 CIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV--- 599
           C +    H   V D+  + +NF I S S D+++K+W L+    ++TF  H+  + CV   
Sbjct: 320 CFKIFKEHTADVLDLDWSKNNFLITS-SMDRTVKLWHLERQTSLKTFQ-HQDFVTCVRFH 377

Query: 600 GIGDSSFVSG 609
              D  F+SG
Sbjct: 378 PTDDRFFISG 387

>Scas_720.45
          Length = 755

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 6/108 (5%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYR-GHQDSVLSVDSY----KKIIVSASADKTVK 415
           D     +  LD+T++VW+    +   T   G +  V  VD Y    K  ++++S D T K
Sbjct: 9   DPNTFASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCK 68

Query: 416 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           VW  ++++C  TL GH   V+    HP      S S+D TL++W+  T
Sbjct: 69  VWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 63/134 (47%), Gaps = 12/134 (8%)

Query: 327 TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-------DDQKMITASLDKTIRVWNY 379
           +G  D TV +W    G      T ++   KG+ +       D   +IT+S D T +VW+Y
Sbjct: 15  SGCLDRTVKVWSL--GQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKVWDY 72

Query: 380 ITGSCISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHVES-RTCYTLRGHTEWVNC 436
            T SC++T  GH  +V     +    II+S S D T+K+W+  + +   TL    E   C
Sbjct: 73  QTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSATYKVEKTLSLGLERSWC 132

Query: 437 VKLHPKSFTCYSSS 450
           +  HP     Y +S
Sbjct: 133 IATHPTGKKNYIAS 146

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 9/94 (9%)

Query: 405 IVSASADKTVKVWHVESRTC-YTLR-GHTEWVNCVKLHPKSFTCY--SSSDDKTLRMWDI 460
             S   D+TVKVW +   T  +TL  G  + VN V  +P     Y  +SSDD T ++WD 
Sbjct: 13  FASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKVWDY 72

Query: 461 RTNSCIKVFRGHVGQV-----QKVIPLTIKDTEN 489
           +T SC+    GH+  V        +P+ I  +E+
Sbjct: 73  QTKSCVATLEGHMANVSFAVFHPTLPIIISGSED 106

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 5/83 (6%)

Query: 519 NLKYPTHLLSCSLDNTIKLWEVSSGRCIRT-QFGHVEGV----WDIAADNFRIVSGSHDK 573
           N K P    S  LD T+K+W +       T   G  +GV    +    D   +++ S D 
Sbjct: 6   NPKDPNTFASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDL 65

Query: 574 SIKVWDLQNGKCIQTFTGHKAPI 596
           + KVWD Q   C+ T  GH A +
Sbjct: 66  TCKVWDYQTKSCVATLEGHMANV 88

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV-WDIAADNFRIV-SGSHDKSIKVWDLQN 582
           +L++ S D T K+W+  +  C+ T  GH+  V + +      I+ SGS D ++K+W+   
Sbjct: 57  YLITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

Query: 583 GKCIQTFT 590
            K  +T +
Sbjct: 117 YKVEKTLS 124

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYIT 381
           L T S D T  +WD ++ + +  L GH   V    F      +I+ S D T+++WN  T
Sbjct: 58  LITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

>Scas_719.52
          Length = 628

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 96/219 (43%), Gaps = 39/219 (17%)

Query: 276 NSRYYTRPWKVIYRERFQVESNWRNGRC--RIQLFKGHMDGVLSL---KFNHRLLFTGSY 330
           N ++ +  W       F V      G+C  ++ LF+GH   VL      FN  ++ + S 
Sbjct: 43  NGKFISVNWNASGGGAFAVIPVAEVGKCPDQVPLFRGHTAQVLDTDFDPFNDHIIASSSD 102

Query: 331 DSTVAIW--------------DTKSGNL--IRRLTGHTDGVKGIYF---DDQKMITASLD 371
           DS + IW              D +  N+  ++ L+GH+  V  + F    +  + ++SLD
Sbjct: 103 DSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAENVLASSSLD 162

Query: 372 KTIRVWNYITGSCISTYRGHQDSVLSVD-SY-KKIIVSASADKTVKVWHV-ESRTCYTLR 428
            T+++WN  TG  + T + H D V S+  SY    + +   DK ++VW + E +      
Sbjct: 163 YTVKLWNIETGEAVITLK-HPDMVTSMSFSYGGNHLATVCRDKKLRVWDIREGKIVSEGP 221

Query: 429 GHTE-------WV-NCVKLHPKSFTCYSSSDDKTLRMWD 459
            H         W+ N  +L   + T +S   D+ + +WD
Sbjct: 222 AHAGAKNQRVVWLGNSDRL---ATTGFSRLSDRQIGIWD 257

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 68/173 (39%), Gaps = 33/173 (19%)

Query: 427 LRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIK 485
            RGHT  V      P       SSSDD  + +W I  +   + +    G+ + + P+   
Sbjct: 77  FRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFL 136

Query: 486 DTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC 545
              +     K+  V               +F P  +    L S SLD T+KLW + +G  
Sbjct: 137 SGHS----RKVGHV---------------LFHPVAE--NVLASSSLDYTVKLWNIETGEA 175

Query: 546 IRTQFGHVEGVWDIAADNFRIVSGSH------DKSIKVWDLQNGKCIQTFTGH 592
           + T   H + V  ++        G+H      DK ++VWD++ GK +     H
Sbjct: 176 VIT-LKHPDMVTSMSFS----YGGNHLATVCRDKKLRVWDIREGKIVSEGPAH 223

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/232 (20%), Positives = 79/232 (34%), Gaps = 70/232 (30%)

Query: 382 GSC---ISTYRGHQDSVLSVDS---YKKIIVSASADKTVKVWHVESRTCYT--------- 426
           G C   +  +RGH   VL  D       II S+S D  + +W +     +          
Sbjct: 68  GKCPDQVPLFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEP 127

Query: 427 --------LRGHTEWVNCVKLHPKSFTCYSSSD-DKTLRMWDIRTNSCIKVFRGHVGQVQ 477
                   L GH+  V  V  HP +    +SS  D T+++W+I T   +           
Sbjct: 128 KNIKPVKFLSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAV----------- 176

Query: 478 KVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKL 537
               +T+K               +P++    +    G          HL +   D  +++
Sbjct: 177 ----ITLK---------------HPDMVTSMSFSYGG---------NHLATVCRDKKLRV 208

Query: 538 WEVSSGRCIRTQFGHVEG-----VWDIAADNFRIVSGSH--DKSIKVWDLQN 582
           W++  G+ +     H        VW   +D       S   D+ I +WD  N
Sbjct: 209 WDIREGKIVSEGPAHAGAKNQRVVWLGNSDRLATTGFSRLSDRQIGIWDAFN 260

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 83/187 (44%), Gaps = 20/187 (10%)

Query: 299 RNGRCRIQLFKGHMDGVLS--------LKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRL 348
            +G  R+   +G +  +LS        +K+N     + T   D+   +W+  SG  ++  
Sbjct: 214 ESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHF 273

Query: 349 ------TGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DS 400
                 T  + GV   + D  K     +  +I V+N      I   RGH  ++ ++  + 
Sbjct: 274 SFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLTTIAYNE 333

Query: 401 YKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
           + K+++SAS D T++VW   +    +   GH++ +          T  S+S D ++R+W 
Sbjct: 334 HNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDD-TIISTSMDGSIRVWS 392

Query: 460 IRTNSCI 466
           + +NS +
Sbjct: 393 LASNSTV 399

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/271 (21%), Positives = 112/271 (41%), Gaps = 57/271 (21%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITG 382
           L TG     + +W  + G L   L+ H   +  I +  D+  ++T   D    VWN ++G
Sbjct: 209 LLTGVESGELRLWSVE-GKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267

Query: 383 SCISTYR----GHQDSVLSVDSY---KKIIVSASADKTVKVWHVE-SRTCYTLRGHTEWV 434
           + +  +     G ++S L VD+    +          ++ V+++  S+    LRGH++ +
Sbjct: 268 TAVQHFSFKEAGTEES-LGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTL 326

Query: 435 NCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDE 494
             +  +  +    S+SDD TLR+W     +   VF GH   +                  
Sbjct: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSA--------------- 371

Query: 495 KIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVE 554
                        + DD T            ++S S+D +I++W ++S   + +    V+
Sbjct: 372 ------------HWVDDDT------------IISTSMDGSIRVWSLASNSTVAS--ATVD 405

Query: 555 GVWD----IAADNFRIVSGSHDKSIKVWDLQ 581
           GV +    ++ D  +  +G+ D  + V+D+Q
Sbjct: 406 GVPNFTGALSPDQGKFATGTLDGEVMVYDIQ 436

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 47/83 (56%), Gaps = 3/83 (3%)

Query: 308 FKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQK 364
            +GH   + ++ +N  ++LL + S D+T+ +W   + N      GH+  +   ++ DD  
Sbjct: 319 LRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDT 378

Query: 365 MITASLDKTIRVWNYITGSCIST 387
           +I+ S+D +IRVW+  + S +++
Sbjct: 379 IISTSMDGSIRVWSLASNSTVAS 401

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 77/201 (38%), Gaps = 29/201 (14%)

Query: 414 VKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHV 473
           +++W VE +    L  H   + C+K +       +   D    +W++ + + ++ F    
Sbjct: 218 LRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGTAVQHFSFKE 277

Query: 474 GQVQKVIPLTIKDTENLVVDEKI---EKVPNPELEEDFADDCTGIFDP------------ 518
              +          E+L VD      +K   P ++        GI  P            
Sbjct: 278 AGTE----------ESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRGHSKTLT 327

Query: 519 NLKYPTH---LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKS 574
            + Y  H   LLS S DNT+++W   +       +GH + +      D+  I+S S D S
Sbjct: 328 TIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVDDDTIISTSMDGS 387

Query: 575 IKVWDLQNGKCIQTFTGHKAP 595
           I+VW L +   + + T    P
Sbjct: 388 IRVWSLASNSTVASATVDGVP 408

>KLLA0F16038g complement(1487475..1490063) weakly similar to
           ca|CA1657|IPF16022 Candida albicans unknown function,
           hypothetical start
          Length = 862

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWDTKSGN---LIRRLTGHTDGVKGIYF-----DDQKMIT 367
           L L+  +  +     D T+ I+D  S +   L+R L    DG+   +F      DQ + +
Sbjct: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADSDQILCS 666

Query: 368 ASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHV 419
           +SLDKTIR ++Y TG C++ Y  H D V+ + +     V+ + +  +  W +
Sbjct: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEI 718

 Score = 36.2 bits (82), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 95/222 (42%), Gaps = 26/222 (11%)

Query: 371 DKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK----IIVSASADKTVKVWHVES---RT 423
           D T ++  Y    C    + H  ++  +  Y+K    I+++ S D+T+    + +     
Sbjct: 491 DSTGKLSVYKDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNFIELRAGEWNI 550

Query: 424 CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR-TNSCIKVFRGHVGQVQKVIPL 482
           C T++ +    N ++L       Y+ S D+T+  + I   ++ + V +  +  V+   PL
Sbjct: 551 CETVKDNKG--NIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETILSVKNS-PL 607

Query: 483 TIKDTENLVVDEKIEKV---------PNPELEEDFADDCTGI----FDPNLKYPTHLLSC 529
            ++ T + ++  + +K            P L     D   GI    F  N      L S 
Sbjct: 608 RLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADSDQILCSS 667

Query: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSG 569
           SLD TI+ +  ++G+C+   + H + V  +   A+ F  V+G
Sbjct: 668 SLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTG 709

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 69/147 (46%), Gaps = 8/147 (5%)

Query: 326 FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITGS 383
           F GS + ++ I++ +SG L ++   H   V GI  D  ++KM++  LD  +  +++   +
Sbjct: 476 FIGSSNGSITIYNMQSGILRKKYKLHKRAVTGISLDGMNRKMVSCGLDGIVGFYDFNKST 535

Query: 384 CISTYRGHQDSVLSVDSYKK---IIVSASADKTVKVW-HVESRTCYTLRGHTEWVNCVKL 439
            +   +   D+ ++   Y +   +   A  D ++ V   V  R    L GH+  +     
Sbjct: 536 LLGKLK--LDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDF 593

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTNSCI 466
            P+     S+S D T+R WD+ T  CI
Sbjct: 594 SPEGRWIVSASLDSTIRTWDLPTGGCI 620

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 526 LLSCSLDN-TIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQN 582
           L + +LD+ +I + +  + R +R  +GH   +  +D + +   IVS S D +I+ WDL  
Sbjct: 557 LFALALDDLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPT 616

Query: 583 GKCI 586
           G CI
Sbjct: 617 GGCI 620

>Scas_660.7*
          Length = 603

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 15/126 (11%)

Query: 331 DSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-----DDQKMITASLDKTIRVWNYITGSCI 385
           D  +  +D+K+G  ++ +   ++ ++G  F     D+ K +TAS D TIRVW+  +  C+
Sbjct: 214 DRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRVWDVNSSKCV 273

Query: 386 STY---RGHQDSVLS------VDSYKKIIVSASADKTVKVWHVESRTCYT-LRGHTEWVN 435
             +       D+VL       V S +  IVS S D T+ ++ +E     T ++GH++ + 
Sbjct: 274 QKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGIT 333

Query: 436 CVKLHP 441
            + ++P
Sbjct: 334 ALAVNP 339

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 62/131 (47%), Gaps = 33/131 (25%)

Query: 448 SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEED 507
           ++S D T+R+WD+ ++ C          VQK + +T    +N++ D+++  V + E    
Sbjct: 255 TASADATIRVWDVNSSKC----------VQKWV-VTSSSDDNVLRDQQVGVVASQE---- 299

Query: 508 FADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIV 567
                             ++S SLD T+ ++++     I +  GH +G+  +A +   ++
Sbjct: 300 ----------------GRIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALAVN--PLI 341

Query: 568 SGSHDKSIKVW 578
           +GS+D  I  W
Sbjct: 342 TGSYDGKIMDW 352

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 45/97 (46%), Gaps = 9/97 (9%)

Query: 514 GIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT---------QFGHVEGVWDIAADNF 564
           GIF  +       ++ S D TI++W+V+S +C++               + V  +A+   
Sbjct: 241 GIFALSWIDENKFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEG 300

Query: 565 RIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           RIVS S D ++ ++ L+    I +  GH   I  + +
Sbjct: 301 RIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALAV 337

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 324 LLFTGSYDSTVAIWDTKSG-NLIRRLTGHTDGVKGIYFDDQK-MITASLDKTIRVWN 378
           L+ TGS D+ + ++  K    +I+RL  H DG+  + ++D   +++   D  I+ W 
Sbjct: 543 LVATGSLDTNIFVYSIKRPMKIIKRLNAHKDGISALLWEDASTLVSTGADACIKKWG 599

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/123 (18%), Positives = 57/123 (46%), Gaps = 12/123 (9%)

Query: 314 GVLSLKF-NHRLLFTGSYDSTVAIWDTKSGNLIRR--LTGHTDG-------VKGIYFDDQ 363
           G+ +L + +     T S D+T+ +WD  S   +++  +T  +D        V  +   + 
Sbjct: 241 GIFALSWIDENKFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEG 300

Query: 364 KMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRT 423
           ++++ SLD T+ ++     + I++ +GH   + ++      +++ S D  +  W  +   
Sbjct: 301 RIVSLSLDGTLNIFQLEQDNIITSIKGHSKGITAL--AVNPLITGSYDGKIMDWSNKPEV 358

Query: 424 CYT 426
            +T
Sbjct: 359 AHT 361

>Kwal_33.15136
          Length = 473

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/319 (21%), Positives = 129/319 (40%), Gaps = 55/319 (17%)

Query: 306 QLFKGHMDGVLSLKFNHRLL---FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           QL  GH DGV ++  N+ +L    T S D  V  W+  +   +     H   + G+    
Sbjct: 61  QLGYGHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTP 120

Query: 363 QK---------MITASLDKTIRVWNYIT----------------GSCISTYRGHQDSVLS 397
           Q          M++   D+T+++W+  T                   I T+ G + + L 
Sbjct: 121 QHLSQNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHG-EHAFLG 179

Query: 398 VDSYKKIIVSASADKTVKVW-HVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSS-DDKTL 455
           +D ++      +    + +W    SR    L    + V+ VK +      ++S+  D ++
Sbjct: 180 IDHHRSNSNFVTGGAEINLWDSTRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSV 239

Query: 456 RMWDIRTNSCIKVFRGHVGQVQKVIPLTI----KDTENLVVDEKIEKVPNPELE------ 505
            ++D+RTNS  + F      VQK+    +     +  N VV  +       ++       
Sbjct: 240 VLYDLRTNSPTQKF------VQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRAL 293

Query: 506 EDFADDCTGIFDPNLKYPT--HLLSCSLDNTIKLWEVSSGRCIRT----QFGHVEGVWDI 559
             F D  + + D +   PT   +++ S D TI++++V  G         +  HV  V   
Sbjct: 294 HVFKDHVSAVMDVDFS-PTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQV-KY 351

Query: 560 AADNFRIVSGSHDKSIKVW 578
             D+  IVSGS D ++++W
Sbjct: 352 TMDSRYIVSGSDDGNVRMW 370

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 25/124 (20%)

Query: 261 NPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKF 320
           NP  + N  VA    N+ YY                + RN    + +FK H+  V+ + F
Sbjct: 265 NPMEAYNFVVANEDHNAYYY----------------DMRNLSRALHVFKDHVSAVMDVDF 308

Query: 321 NHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY-----FDDQKMITASLDKT 373
           +     + TGSYD T+ I+  K G+   R   HT  ++ ++      D + +++ S D  
Sbjct: 309 SPTGDEIVTGSYDKTIRIYQVKHGH--SREIYHTKRMQHVFQVKYTMDSRYIVSGSDDGN 366

Query: 374 IRVW 377
           +R+W
Sbjct: 367 VRMW 370

>Kwal_14.884
          Length = 395

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 68/156 (43%), Gaps = 20/156 (12%)

Query: 308 FKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMIT 367
           F+ H   V  L  + R L +GS D  + I+D +    +  L  H   +  + F     I 
Sbjct: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96

Query: 368 ASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCY-T 426
              +           + ++T RG+           K ++SAS D  + +W V+    + T
Sbjct: 97  DKNEDD---------TGLTTGRGNS----------KWLISASDDHNLVIWRVKDWENFGT 137

Query: 427 LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           L+GH   +N   +HP +    S S+D ++R+W++ T
Sbjct: 138 LKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 67/164 (40%), Gaps = 27/164 (16%)

Query: 425 YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTI 484
           +  + H+  V C+ +  +     S S+D+ +R++D++    +     H G +  +     
Sbjct: 35  FHFQAHSLSVKCLDISKRYLV--SGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 87

Query: 485 KDTENLVVDEKIEKVPNPELEEDFADDCTGIFDP--NLKYPTHLLSCSLDNTIKLWEVSS 542
                        K       ED  +D TG+     N K+   L+S S D+ + +W V  
Sbjct: 88  -------------KFSKGTKIEDKNEDDTGLTTGRGNSKW---LISASDDHNLVIWRVKD 131

Query: 543 GRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQNGK 584
                T  GH   +  +DI   N   +S S D SI++W+L   K
Sbjct: 132 WENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           +VSGS+D+ I+++DLQ  K + T   H+  I  +
Sbjct: 54  LVSGSNDEHIRIYDLQKRKELGTLLSHQGSITAL 87

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 84/191 (43%), Gaps = 19/191 (9%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRL--TGHTDGVKGIYFDD 362
           ++  K H D   S+  +  LL TGS D  + + D ++  L+  L  T H   V+ + +  
Sbjct: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66

Query: 363 QKMITA--SLDKTIRVWNY----ITGSC--ISTYRGHQDSVLSV--DSYKKIIVSASADK 412
              + A  S D T+ +W       +G    ++   GH++ V SV        + + S DK
Sbjct: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDK 126

Query: 413 TVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN--SC 465
           +V +W      E   C + L+ H++ V  +  H       SSS D T+R+W  + +   C
Sbjct: 127 SVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWEC 186

Query: 466 IKVFRGHVGQV 476
             V  GH G V
Sbjct: 187 AAVLSGHGGTV 197

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 74/159 (46%), Gaps = 19/159 (11%)

Query: 324 LLFTGSYDSTVAIW----DTKSGN--LIRRLTGHTDGVKGIYF--DDQKMITASLDKTIR 375
           +L  GS+D+TV+IW    D  SG   L+  + GH + VK + +  D   + T S DK++ 
Sbjct: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129

Query: 376 VWNYITGS----CISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWHVES---RTCYT 426
           +W     S    C S  + H   V  +   + + ++ S+S D TV++W  +         
Sbjct: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189

Query: 427 LRGH--TEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463
           L GH  T W +  +         S SDD T+R+W   T+
Sbjct: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIWRCLTD 228

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 89/223 (39%), Gaps = 35/223 (15%)

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLR-----GHTEWVNCVKL 439
           + + + H D   SVD  K ++ + SAD+ +K+  V+ R    +       H + V  V  
Sbjct: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64

Query: 440 HPKSFTCYSSSDDKTLRMWDIRTN------SCIKVFRGHVGQVQKVIPLTIKDTENLVV- 492
            P      + S D T+ +W    +        + V  GH  +V+ V      D   L   
Sbjct: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAW--SHDGAYLATC 122

Query: 493 --DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH---------LLSCSLDNTIKLW--E 539
             D+ +      EL E+F  +C  +   + +   H         L S S D+T+++W  +
Sbjct: 123 SRDKSVWIWEADELSEEF--ECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQ 180

Query: 540 VSSGRCIRTQFGHVEGVW----DIAADNFRIVSGSHDKSIKVW 578
                C     GH   VW    + A    R+ SGS D ++++W
Sbjct: 181 DDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

>Kwal_55.21559
          Length = 351

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 76/174 (43%), Gaps = 25/174 (14%)

Query: 311 HMDGVLSLKF--NHRLLFTGSYDSTVAIW----------DTKSGNLIRRLTGHTDGVKGI 358
           H   V S+ F  +  +L  GS+DST++IW          D     L+  + GH + VK +
Sbjct: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135

Query: 359 YFDDQKMITASL--DKTIRVWNY----ITGSCISTYRGHQDSVLSV--DSYKKIIVSASA 410
            +       AS   DK++ +W          C+S  + H   V  V   S   ++ S+S 
Sbjct: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195

Query: 411 DKTVKVWHVES---RTCYTLRGH--TEWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
           D T+++W  ++        L GH  T W +  +    S    S SDD T+R+W+
Sbjct: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 91/220 (41%), Gaps = 33/220 (15%)

Query: 391 HQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLR-----GHTEWVNCVKLHPKSFT 445
           H D + S+D  K ++ ++S+D+ +K+ ++++     +       H + V  V   P S  
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 446 CYSSSDDKTLRMW----------DIRTNSCIKVFRGHVGQVQKV-IPLTIKDTENLVVDE 494
             + S D T+ +W          D      + +  GH  +V+ V    +     +   D+
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAVSWSHSGYYLASCSRDK 151

Query: 495 KIEKVPNPELEEDFADDCTGIFDPNLKYPTH---------LLSCSLDNTIKLW--EVSSG 543
            +      EL E++  +C  +   + +   H         L S S D+TI+LW  +    
Sbjct: 152 SVWIWEADELGEEY--ECLSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDW 209

Query: 544 RCIRTQFGHVEGVW----DIAADNFRIVSGSHDKSIKVWD 579
            C     GH   VW    + +  + R+ S S D +++VW+
Sbjct: 210 ECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 323 RLLFTGSYDSTVAIW--DTKSGNLIRRLTGHTDGVKGIYFDDQ----KMITASLDKTIRV 376
            LL + SYD T+ +W  D         L GH   V    F+      ++ + S D T+RV
Sbjct: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247

Query: 377 WNYI 380
           WNY+
Sbjct: 248 WNYV 251

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 74/158 (46%), Gaps = 23/158 (14%)

Query: 324 LLFTGSYDSTVAIW--DTKSGN--------LIRRLTGHTDGVKGIYF--DDQKMITASLD 371
           +L  GS+DSTV+IW  D    N        L+  + GH + +K + +  D + + T S D
Sbjct: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGELLATCSRD 130

Query: 372 KTIRVWNYITGS----CISTYRGHQDSVLSVDSYKK--IIVSASADKTVKVWH---VESR 422
           K++ +W          CIS  + H   V  V  ++   ++ S+S D TV++W     +  
Sbjct: 131 KSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWE 190

Query: 423 TCYTLRGH--TEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
            C  L GH  T W +  +    +    S SDD T+R+W
Sbjct: 191 CCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 94/227 (41%), Gaps = 42/227 (18%)

Query: 391 HQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLR-----GHTEWVNCVKLHPKSF 444
           H D   SVD +   I+ + S D+ +K+  V+ R+   +       H + V  V   P S 
Sbjct: 13  HDDKCWSVDVNNGGIMATGSTDRKIKL--VDIRSFQIIEELDDTAHKKTVRSVAWRPHSN 70

Query: 445 TCYSSSDDKTLRMW-----------DIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVV- 492
              + S D T+ +W           D+ T   + +  GH  +++ V      D E L   
Sbjct: 71  ILAAGSFDSTVSIWGKDDDGYNDENDLETE-LLAIIEGHENEIKCV--AWSHDGELLATC 127

Query: 493 --DEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH---------LLSCSLDNTIKLWEV- 540
             D+ +      E+ E+F  +C  +   + +   H         L S S D+T+++W+  
Sbjct: 128 SRDKSVWIWEADEMGEEF--ECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDC 185

Query: 541 -SSGRCIRTQFGHVEGVW----DIAADNFRIVSGSHDKSIKVWDLQN 582
                C     GH   VW    + +  N R+ SGS D ++++W L++
Sbjct: 186 DDDWECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLED 232

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 101/253 (39%), Gaps = 23/253 (9%)

Query: 343 NLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--- 398
           N+     GHT  +  I F D+  ++TAS D T  +W+      +  Y  H   VL++   
Sbjct: 172 NVASIFKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIP 231

Query: 399 -----DSYKKIIVSASADKTVKVWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDD 452
                ++      S  +D    +W   S +   +   +   +N ++      +  + SD+
Sbjct: 232 EEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDN 291

Query: 453 KTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFAD-- 510
             + M+D+R++  I  F    G  ++    T      +  + +     +P+  +  +   
Sbjct: 292 GAINMYDLRSDCSIATFSLFRGYEERTPTPTY-----MAANMEYNTAQSPQTLKSTSSSY 346

Query: 511 -DCTGIFDPNLKYPTHLL-SCSLDNTIKLWEVSSGRCIRTQFGH---VEGVWDIAADNFR 565
            D  G+   +      L+ SC  D    +W+V  G  +    GH   V GV   + D   
Sbjct: 347 LDNQGVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRS-SPDGLA 405

Query: 566 IVSGSHDKSIKVW 578
           + +GS D ++K+W
Sbjct: 406 VCTGSWDSTMKIW 418

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/258 (20%), Positives = 105/258 (40%), Gaps = 51/258 (19%)

Query: 348 LTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSYKK 403
           L GH + +    +  D +++++AS D  + +W+  +G   +        VLS  +     
Sbjct: 88  LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSST 147

Query: 404 IIVSASADKTVKVWHV--ESRTCYTL----RGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
           ++ SA  +    ++ V  E+R    +    +GHT +++ ++    +    ++S D T  +
Sbjct: 148 LVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHIL-TASGDMTCAL 206

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           WDI     ++ +  H+G V  +                I + PN E   +          
Sbjct: 207 WDIPKAKRVREYSDHLGDVLAL---------------AIPEEPNSENSSN---------- 241

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-----DNFRIVSGSHD 572
                     SC  D    +W+  S   +++ + +     DI A     D   IV+GS +
Sbjct: 242 -------TFASCGSDGYTYIWDSRSPSAVQSFYVNDS---DINALRFFKDGMSIVAGSDN 291

Query: 573 KSIKVWDLQNGKCIQTFT 590
            +I ++DL++   I TF+
Sbjct: 292 GAINMYDLRSDCSIATFS 309

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 314 GVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITAS 369
           GV+SL F+   RL+++   D    +WD   G ++ +L GH   V G+    D   + T S
Sbjct: 351 GVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGS 410

Query: 370 LDKTIRVWN 378
            D T+++W+
Sbjct: 411 WDSTMKIWS 419

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 524 THLLSCSLDNTIKLWEVSS----GRCIRTQF-GHVEGVWDIA-ADNFRIVSGSHDKSIKV 577
           T + S  L+N   ++ VS      + + + F GH   + DI   DN  I++ S D +  +
Sbjct: 147 TLVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAHILTASGDMTCAL 206

Query: 578 WDLQNGKCIQTFTGHKAPIVCVGI 601
           WD+   K ++ ++ H   ++ + I
Sbjct: 207 WDIPKAKRVREYSDHLGDVLALAI 230

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 304 RIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF- 360
           +I   +GH   +  +    N +LL + S D ++ IWD  SG L+ R  GHT  +  + F 
Sbjct: 173 KIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFF 232

Query: 361 -DDQKMITASLDKTIRVWNY 379
            DD ++I+ S D T RVWNY
Sbjct: 233 NDDTQLISVSEDCTCRVWNY 252

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIKVWDLQN 582
           L SCS D +I +W++ SG+ +   +GH   +W++    D+ +++S S D + +VW+ +N
Sbjct: 196 LASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKN 254

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 520 LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNF--RIVSGSHDKSIKV 577
           L++   + + ++ N I +WE+ S + I T  GH   ++ +   N    + S S D+SI +
Sbjct: 148 LRHKVLVNAGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIII 207

Query: 578 WDLQNGKCIQTFTGHKAPI 596
           WD+ +GK +    GH A I
Sbjct: 208 WDMVSGKLLSRAWGHTARI 226

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 5/105 (4%)

Query: 374 IRVWNYITGSCISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVW-HVESRTCYTLRGH 430
           I VW   +   I T RGH+ S+  V +    K++ S S D+++ +W  V  +      GH
Sbjct: 163 IIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGH 222

Query: 431 TEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCI--KVFRGHV 473
           T  +  +K         S S+D T R+W+ + +      +F  H+
Sbjct: 223 TARIWNLKFFNDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHL 267

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 50/102 (49%), Gaps = 5/102 (4%)

Query: 322 HRLLF-TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASL--DKTIRVWN 378
           H++L   G+  + + +W+  S   I  L GH   +  +   +   + AS   D++I +W+
Sbjct: 150 HKVLVNAGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWD 209

Query: 379 YITGSCISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWH 418
            ++G  +S   GH   + ++  +     ++S S D T +VW+
Sbjct: 210 MVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWN 251

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 86/214 (40%), Gaps = 48/214 (22%)

Query: 373 TIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHT 431
           T++  +++ G     Y G     + V  +K ++ + +    + VW ++S+   +TLRGH 
Sbjct: 126 TVKSTHFVEGERSILYSGS----IKVLRHKVLVNAGTIMNGIIVWELDSKKKIHTLRGHE 181

Query: 432 EWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLV 491
             +  V          S SDD+++ +WD+ +   +    GH  ++  +            
Sbjct: 182 GSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNL------------ 229

Query: 492 VDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR-CIRTQF 550
                         + F DD            T L+S S D T ++W   +    I+  F
Sbjct: 230 --------------KFFNDD------------TQLISVSEDCTCRVWNYKNDELTIKDIF 263

Query: 551 -GHV-EGVW--DIAADNFRIVSGSHDKSIKVWDL 580
             H+ + VW  D+   N   +SG +D  +KV +L
Sbjct: 264 ESHLTKNVWGVDVEETNLIAISGGNDGRLKVTEL 297

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 79/170 (46%), Gaps = 22/170 (12%)

Query: 305 IQLFKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           I + +GH   V SL F++   L+ T   D+   IWD +SG  I  L GH+   K IY  D
Sbjct: 298 ILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHS---KPIYSVD 354

Query: 363 -----QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK---IIVSASADKTV 414
                 ++ + S D TI+VW+      + T   H   V  V   K+    +VS+  DK V
Sbjct: 355 WSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQNGGYLVSSGYDKKV 414

Query: 415 KVWH----VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
            +++    ++ R   +L GH + V  + +       YS+  D+++  W +
Sbjct: 415 NIFNDGNWIKER---SLEGHLDKVMSIDIVGPDI--YSAGWDRSVNKWGV 459

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 71/170 (41%), Gaps = 25/170 (14%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMI------------TASLDK 372
           +F  ++D  + I+D+          G    VK +Y +D +              + S DK
Sbjct: 236 IFVCTHDGRIVIYDS----------GDETTVKILYKNDARFAQVRCHPCNSFIGSTSFDK 285

Query: 373 TIRVWNYITGSCISTYRGHQDSVLSVDSYK--KIIVSASADKTVKVWHVES-RTCYTLRG 429
           T  + + +  + I    GH   V S+  +    ++ +A  D    +W + S +   +L+G
Sbjct: 286 TWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQG 345

Query: 430 HTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
           H++ +  V      +   S S D T+++WDIR    ++    H   V +V
Sbjct: 346 HSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQV 395

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKC 585
           +  LD    +W++ SG+ I +  GH + ++ +  + + +++ SGS D +IKVWD++    
Sbjct: 322 TAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGN 381

Query: 586 IQTFTGHKAPIVCV 599
           ++T   H + +  V
Sbjct: 382 VETILAHNSIVSQV 395

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 2/74 (2%)

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKC 585
           S S D T  L +      I  Q GH   V+ ++   D   + +   D    +WD+++GK 
Sbjct: 280 STSFDKTWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKN 339

Query: 586 IQTFTGHKAPIVCV 599
           I +  GH  PI  V
Sbjct: 340 IMSLQGHSKPIYSV 353

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 84/196 (42%), Gaps = 26/196 (13%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGN--LIRRL--TGHTDGVKGIYF 360
           I+  K + + + S  F+  +L TGS D  + +   K  +  LI  L  T H   ++ + +
Sbjct: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIRSVAW 66

Query: 361 DDQKMITA--SLDKTIRVW-------NYITGSCISTYRGHQDSVLSV----DSYKKIIVS 407
                + A  S D T+ +W              ++   GH++ V  V    D Y   + +
Sbjct: 67  RPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGY--YLAT 124

Query: 408 ASADKTVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
            S DK+V +W      E   C + L+ H++ V  V  HP      SSS D T+R+W    
Sbjct: 125 CSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYD 184

Query: 463 N--SCIKVFRGHVGQV 476
           +   C+ V  GH G V
Sbjct: 185 DDWECVAVLNGHEGTV 200

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 98/262 (37%), Gaps = 62/262 (23%)

Query: 341 SGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRV----WNYITGSCISTYRGHQDSVL 396
           S NLI+ L  + + +    F    + T S D+ I++    ++  T   +     H+ ++ 
Sbjct: 3   SINLIKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDDFTLIDVLDETAHKKAIR 62

Query: 397 SVD--SYKKIIVSASADKTVKVWHVESRTCYT--------LRGHTEWVNCVKLHPKSFTC 446
           SV    +  ++ + S D TV +W  E     T        + GH   V  V      +  
Sbjct: 63  SVAWRPHTSLLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYL 122

Query: 447 YSSSDDKTLRMWDIRTNS----CIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
            + S DK++ +W+   +     CI V + H   V+ VI                   P+ 
Sbjct: 123 ATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWH-----------------PSE 165

Query: 503 ELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV--SSGRCIRTQFGHVEGVWDIA 560
            L                     L S S D+T+++W+       C+    GH   VW   
Sbjct: 166 AL---------------------LASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSD 204

Query: 561 ADN----FRIVSGSHDKSIKVW 578
            D     FR+ SGS D +++VW
Sbjct: 205 FDKTEGVFRLCSGSDDSTVRVW 226

 Score = 32.7 bits (73), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNL--IRRLTGHTDGVKGIYFDDQ----KMITASLDKTI 374
           +  LL + SYD TV IW     +   +  L GH   V    FD      ++ + S D T+
Sbjct: 164 SEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTV 223

Query: 375 RVWNYI 380
           RVW Y+
Sbjct: 224 RVWKYM 229

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 70/143 (48%), Gaps = 25/143 (17%)

Query: 304 RIQLFKGHMDGVLSL---KFNHRLLFTGSYDSTVAIWDT-----------KSGN-----L 344
           ++ LF+GH   VL      FN  ++ +GS D  + IW+            + GN      
Sbjct: 85  QVPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKP 144

Query: 345 IRRLTGHTDGVKGIYF---DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-S 400
           +R L+GH+  V  + F    +  + ++SLD T+++W+ I+   +     H D V S+  S
Sbjct: 145 VRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWD-ISQEEVKFTLKHPDMVTSMSFS 203

Query: 401 YK-KIIVSASADKTVKVWHVESR 422
           Y  K +V+ S DK ++VW V + 
Sbjct: 204 YDGKHLVTVSRDKKLRVWDVRAE 226

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 6/92 (6%)

Query: 305 IQLFKGHMDGVLSLKFN---HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF- 360
           +++  GH   V  L F+     +L + S D TV IWD  S   ++    H D V  + F 
Sbjct: 145 VRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDI-SQEEVKFTLKHPDMVTSMSFS 203

Query: 361 -DDQKMITASLDKTIRVWNYITGSCISTYRGH 391
            D + ++T S DK +RVW+      +S    H
Sbjct: 204 YDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAH 235

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 74/190 (38%), Gaps = 29/190 (15%)

Query: 427 LRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIK 485
            RGHT  V      P       S SDD  + +W+I  +  +  +    G  + + P+ + 
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 486 DTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC 545
              +  V   +                   F P  +    L S SLD T+K+W++S    
Sbjct: 149 SGHSRKVGHLL-------------------FHPLAE--NILASSSLDYTVKIWDISQ-EE 186

Query: 546 IRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAP----IVCV 599
           ++    H + V  ++   D   +V+ S DK ++VWD++  K +     H       +V +
Sbjct: 187 VKFTLKHPDMVTSMSFSYDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHSGAKNQRVVWL 246

Query: 600 GIGDSSFVSG 609
           G  D    +G
Sbjct: 247 GDTDKVATTG 256

>Scas_605.18
          Length = 424

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/252 (20%), Positives = 100/252 (39%), Gaps = 19/252 (7%)

Query: 343 NLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--- 398
           N++    GHT  +  I F D+  +IT+S D T  +W+      +  Y  H   VL++   
Sbjct: 171 NVVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALP 230

Query: 399 ------DSYKKIIVSASADKTVKVWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCYSS 449
                 ++   I  S  +D    +W  ++RT   ++        VN ++      +  + 
Sbjct: 231 PPSADENTGANIFASCGSDGYTYIW--DTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTG 288

Query: 450 SDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFA 509
            DD  + M+D+R++  I  +    G +QK I      + N+       + P         
Sbjct: 289 GDDGVINMFDLRSDCAIASYSLQQG-IQKEIRDPTYMSSNMEYSRGSPQSPISTAISSSY 347

Query: 510 DDCTGIFDPNLKYPTHLL-SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRI 566
            D  G+   +      L+ +C  D    +W+V     +    GH   V  +  + D   +
Sbjct: 348 LDNQGVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDGLGV 407

Query: 567 VSGSHDKSIKVW 578
            +GS D ++++W
Sbjct: 408 CTGSWDSTMRIW 419

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 6/73 (8%)

Query: 314 GVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITAS 369
           GV+SL F++  RL+F    D    IWD     ++ +L GH++ V  +    D   + T S
Sbjct: 352 GVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGS 411

Query: 370 LDKTIRVW--NYI 380
            D T+R+W  NY+
Sbjct: 412 WDSTMRIWSPNYM 424

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/255 (20%), Positives = 97/255 (38%), Gaps = 44/255 (17%)

Query: 348 LTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSYKK 403
           L GH + +    +  D + +++AS D  + +W+  +G   +        VLS  +     
Sbjct: 87  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDTASGLKRNAIPLDSQWVLSCALSPSGN 146

Query: 404 IIVSASADKTVKVWHV------ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRM 457
           +  SA  +    ++ V      +       +GHT +++ ++    S    +SS D T  +
Sbjct: 147 LAASAGLNNNCTIYRVSKENRVQQNVVSIFKGHTCYISDIEFLDNSHII-TSSGDMTCAL 205

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           WDI     ++ +  H+G V  +                   +P P      AD+ TG   
Sbjct: 206 WDIPKAKRVREYADHLGDVLAL------------------ALPPPS-----ADENTG--- 239

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSI 575
                     SC  D    +W+  +   ++  F     V  I    D   IV+G  D  I
Sbjct: 240 -----ANIFASCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDDGVI 294

Query: 576 KVWDLQNGKCIQTFT 590
            ++DL++   I +++
Sbjct: 295 NMFDLRSDCAIASYS 309

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 82/215 (38%), Gaps = 30/215 (13%)

Query: 422 RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG-QVQKVI 480
           ++  TL+GH   ++  +    S +  S+S D  + +WD  T S +K  R  +    Q V+
Sbjct: 82  QSTLTLKGHNNKISDFRWSRDSKSILSASQDGFMLIWD--TASGLK--RNAIPLDSQWVL 137

Query: 481 PLTIKDTENLVVDEKIEK---VPNPELEEDFADDCTGIFDPNLKY--------PTHLLSC 529
              +  + NL     +     +     E     +   IF  +  Y         +H+++ 
Sbjct: 138 SCALSPSGNLAASAGLNNNCTIYRVSKENRVQQNVVSIFKGHTCYISDIEFLDNSHIITS 197

Query: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-----AD-----NFRIVSGSHDKSIKVWD 579
           S D T  LW++   + +R    H+  V  +A     AD     N     GS D    +WD
Sbjct: 198 SGDMTCALWDIPKAKRVREYADHLGDVLALALPPPSADENTGANIFASCGS-DGYTYIWD 256

Query: 580 LQNGKCIQTFTGHKAPIVCVGI---GDSSFVSGDE 611
            +    +Q F      +  +     G+S    GD+
Sbjct: 257 TRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDD 291

>Kwal_26.8628
          Length = 422

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/252 (20%), Positives = 99/252 (39%), Gaps = 18/252 (7%)

Query: 344 LIRRLTGHTDGVKGI-YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV---- 398
           ++    GHT  V  + +F++  +ITAS D T  +W+      I+ +  H   VL++    
Sbjct: 167 IVSMFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALPP 226

Query: 399 ---DSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEW-VNCVKLHPKSFTCYSSSDDKT 454
               +   I  S  +D  V +W   +R        +E  ++ +K     +   + +DD  
Sbjct: 227 PHAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDGV 286

Query: 455 LRMWDIRTNSCIKVFR-GHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFAD--- 510
            RM+D+R++  +  +      Q Q   P  + ++  L  D         +          
Sbjct: 287 ARMFDMRSDCAVASYSLSQNLQQQANSPTRLYNSSPLEYDVTPSNASLTKTSRSANSTYL 346

Query: 511 DCTGIFDPNLKYPTHLL-SCSLDNTIKLWEVSSGRCIRTQFGH---VEGVWDIAADNFRI 566
           D  GI   +      L+ +C  D    +W+      +    GH   + GV   + D   +
Sbjct: 347 DNQGIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGV-KTSPDGMAV 405

Query: 567 VSGSHDKSIKVW 578
            +GS D ++K+W
Sbjct: 406 CTGSWDATLKLW 417

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query: 314 GVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITAS 369
           G++SL F+   RL+     D    IWDT    ++ +L GH+  + G+    D   + T S
Sbjct: 350 GIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGVKTSPDGMAVCTGS 409

Query: 370 LDKTIRVW--NYI 380
            D T+++W  NY+
Sbjct: 410 WDATLKLWSPNYM 422

>Kwal_26.7655
          Length = 743

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVE 420
           +Q +  AS+D    V++ +       Y+ H   +L +D S    I++ S DKT ++WH +
Sbjct: 245 EQPIGPASMDLYAPVFHPLP---FRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCD 301

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCY-SSSDDKTLRMWDIRTNSC 465
                 +  H ++V C K HP     + S   D TLR+W I  NS 
Sbjct: 302 RPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSV 347

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 74/184 (40%), Gaps = 24/184 (13%)

Query: 305 IQLFKGHMDGVLSLKFNHR-LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--- 360
            ++++ H   +L L ++    + T S D T  +W       ++  T H D V    F   
Sbjct: 265 FRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPN 323

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--------------IIV 406
           DD+  I+  LD T+R+W+ +  S    Y    D + ++D+  +              II+
Sbjct: 324 DDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKYTAAGTFNGHIIIL 382

Query: 407 SASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCI 466
                + V  +HV  +      G T+ V            + S+ D  LR+     +S I
Sbjct: 383 YTRGLEMVSTFHVLEKP----NGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRI 438

Query: 467 KVFR 470
           ++FR
Sbjct: 439 RIFR 442

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 83/205 (40%), Gaps = 44/205 (21%)

Query: 305 IQLFKGHMDGVLSLKFNHR----LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360
           I+   GH   V   +F  R    LL T S D  + IWD  +G  I+    HT  ++ ++ 
Sbjct: 194 IKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHV 253

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV-----------DSYKKI----I 405
             + ++T S D  IR+ ++ +G+ +S   GH   V  V             Y+ +    +
Sbjct: 254 HGEFVLTGSNDSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQHV 313

Query: 406 VSASADKTVKVWHVES------------------RTCYTLRGHTEWVNCVKLHPKSFTCY 447
            SAS D T+++W V                    +    L  H  WV    L   +   +
Sbjct: 314 ASASRDGTIRLWKVSLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVR--DLRQFNDMLF 371

Query: 448 SSSDDKTLRMW-----DIRTNSCIK 467
           S SDD +++ W     ++ T +C K
Sbjct: 372 SCSDDGSVKCWSLDWTNLSTTTCKK 396

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKC 585
           L +CS D  +K+W++S+G CI++   H + +  +      +++GS+D +I++    +G  
Sbjct: 218 LATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGNG 277

Query: 586 IQTFTGHKAPIVCVGI 601
           +    GH  P+  V I
Sbjct: 278 LSMGIGHDFPVEKVLI 293

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 92/251 (36%), Gaps = 65/251 (25%)

Query: 385 ISTYRGHQDSVLSV-------DSYKKIIVSASADKTVKVWHVESRTCY----TLRGHTEW 433
           + +   H D + S+       +     + + S D   K+W +E  +      TL GH   
Sbjct: 144 LQSTMAHMDGITSISISLPNENGRPAYLATTSKDLNTKIWELELDSTLSHIKTLAGHEHT 203

Query: 434 VNCVKLHPKS--FTCYSSSDDKTLRMWDIRTNSCIKVFRGH---------------VGQV 476
           V+  +   +       + S D  L++WDI    CIK F+ H                G  
Sbjct: 204 VSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSN 263

Query: 477 QKVIPLTIKDTENLVV-----DEKIEKV----PNPE-LEEDFADDCTGIFDPNLKYPTHL 526
              I LT   + N +      D  +EKV    P+P+ L+  +           L +  H+
Sbjct: 264 DSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQPQYQP---------LGF-QHV 313

Query: 527 LSCSLDNTIKLWEVS-----------------SGRCIRTQFGHVEGVWDIAADNFRIVSG 569
            S S D TI+LW+VS                 + + I     H   V D+   N  + S 
Sbjct: 314 ASASRDGTIRLWKVSLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVRDLRQFNDMLFSC 373

Query: 570 SHDKSIKVWDL 580
           S D S+K W L
Sbjct: 374 SDDGSVKCWSL 384

>AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372)
           [3072 bp, 1023 aa]
          Length = 1023

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 67/147 (45%), Gaps = 4/147 (2%)

Query: 328 GSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITGSCI 385
           GS +  +++++ +SG   +    H   V G+  D  ++KM++  LD  +  +++ T S +
Sbjct: 566 GSSNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDFTTNSFL 625

Query: 386 STYR-GHQDSVLSVDSYKKIIVSASADKTVKVW-HVESRTCYTLRGHTEWVNCVKLHPKS 443
              + G   + L      ++   A  D +++V   V  R    L GH+  +      P  
Sbjct: 626 GKLQLGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDG 685

Query: 444 FTCYSSSDDKTLRMWDIRTNSCIKVFR 470
               S+S D TLR WD+ T +CI   R
Sbjct: 686 RWIVSASLDSTLRTWDLPTGTCIDGVR 712

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 16/141 (11%)

Query: 462 TNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEE--DFADDCTGIFDPN 519
           +N  I V+    G  +KV  +       L VD    K+ +  L+    F D  T  F   
Sbjct: 568 SNGGISVYNLQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDFTTNSFLGK 627

Query: 520 LKY-----------PTHLLSCSLDN-TIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFR 565
           L+             + L + +LD+ +I++ +  + R +R  +GH   +  +D + D   
Sbjct: 628 LQLGAPITQLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRW 687

Query: 566 IVSGSHDKSIKVWDLQNGKCI 586
           IVS S D +++ WDL  G CI
Sbjct: 688 IVSASLDSTLRTWDLPTGTCI 708

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 88/212 (41%), Gaps = 30/212 (14%)

Query: 276 NSRYYTRPWKVIYRERFQVESNWRNGRC--RIQLFKGHMDGVLSL---KFNHRLLFTGSY 330
           N +Y +  W       F +      G+   ++ LF+GH   VL      F+   + + S 
Sbjct: 43  NGKYLSVNWNSSGGGAFAIVPVSEPGKLPDQVPLFRGHTAQVLDTDFDPFDDNRVASSSD 102

Query: 331 DSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRG 390
           D  + IWD      I + +G  + +K I                    ++TG   S   G
Sbjct: 103 DGKIGIWDIPQDYSILK-SGDNEEIKDI----------------EPTKFLTGH--SRKVG 143

Query: 391 HQDSVLSVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSS 449
           H   +L   + K ++ S+S D TV++W+VE+    Y L+ H + V  +          + 
Sbjct: 144 H---ILYHPTAKDVLASSSLDYTVRIWNVETGEDIYKLK-HPDMVTSMSFSYDGTHLATV 199

Query: 450 SDDKTLRMWDIRTNSCIKVFRGHVG-QVQKVI 480
           + DK LR+W++R    +     H G + Q+V+
Sbjct: 200 ARDKKLRVWNVREEKVVSEGAAHAGAKNQRVV 231

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 32/172 (18%)

Query: 427 LRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIK 485
            RGHT  V      P       SSSDD  + +WDI  +  I                 +K
Sbjct: 77  FRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSI-----------------LK 119

Query: 486 DTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH---LLSCSLDNTIKLWEVSS 542
             +N    E+I+ +   +     +     I    L +PT    L S SLD T+++W V +
Sbjct: 120 SGDN----EEIKDIEPTKFLTGHSRKVGHI----LYHPTAKDVLASSSLDYTVRIWNVET 171

Query: 543 GRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           G  I  +  H + V  +  + D   + + + DK ++VW+++  K +     H
Sbjct: 172 GEDIY-KLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAH 222

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 46/231 (19%), Positives = 76/231 (32%), Gaps = 78/231 (33%)

Query: 385 ISTYRGHQDSVLSVDSYK---KIIVSASADKTVKVWHVES----------------RTCY 425
           +  +RGH   VL  D        + S+S D  + +W +                      
Sbjct: 74  VPLFRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPTK 133

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSD-DKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTI 484
            L GH+  V  +  HP +    +SS  D T+R+W++ T                      
Sbjct: 134 FLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETG--------------------- 172

Query: 485 KDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR 544
                    E I K+ +P++    +    G         THL + + D  +++W V   +
Sbjct: 173 ---------EDIYKLKHPDMVTSMSFSYDG---------THLATVARDKKLRVWNVREEK 214

Query: 545 CIRTQFGHVEGVWDIAADNFRIV-------------SGSHDKSIKVWDLQN 582
            +       EG     A N R+V             S   D+ I +WD  N
Sbjct: 215 VVS------EGAAHAGAKNQRVVWLGNSERLATTGFSKLSDRQIGIWDAFN 259

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 23/142 (16%)

Query: 348 LTGHTDGVKGIYFDDQKM--ITASLDKTIRVWN-----------YITGSC---------I 385
           L+GHTD +    +D ++   I+AS+D TIR+W+           Y T S          +
Sbjct: 7   LSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAM 66

Query: 386 STYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFT 445
            T RGH+  V  +    K +VSAS D +++ W   +        HT+      LH     
Sbjct: 67  YTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANTYFLKHFFDHTQLNTITALHVSDEV 126

Query: 446 CYSSSDDKTLRMWDIRTNSCIK 467
             S S+   L ++D+ +   ++
Sbjct: 127 LVSGSEG-LLNIYDLNSGLLVR 147

 Score = 36.6 bits (83), Expect = 0.030,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 22/88 (25%)

Query: 544 RCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDLQ----NGKC------------ 585
           +C+    GH + ++    D+   R +S S D +I++WDL+    NG+C            
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAK 61

Query: 586 ----IQTFTGHKAPIVCVGIGDSSFVSG 609
               + T  GH+A +  +G+ D   VS 
Sbjct: 62  ILGAMYTLRGHRALVGLLGLSDKFLVSA 89

 Score = 30.4 bits (67), Expect = 2.7,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 24/172 (13%)

Query: 425 YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR-----------TNS---CIKV-- 468
           Y L GHT+ +       +   C S+S D T+R+WD+            TNS   C K+  
Sbjct: 5   YILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILG 64

Query: 469 ----FRGHVGQVQKVIPLTIKDTENLVVDEKIEKV-PNPELEEDFADDCTGIFDPNLKYP 523
                RGH   V  ++ L+ K   +  VD  I     N    + F D         L   
Sbjct: 65  AMYTLRGHRALV-GLLGLSDKFLVSASVDGSIRCWDANTYFLKHFFDHTQLNTITALHVS 123

Query: 524 THLLSCSLDNTIKLWEVSSGRCIRTQ-FGHVEGVWDIA-ADNFRIVSGSHDK 573
             +L    +  + +++++SG  +R+      + VW+++  DN  + +   DK
Sbjct: 124 DEVLVSGSEGLLNIYDLNSGLLVRSDTLSGADNVWNVSFKDNTLVAAVERDK 175

>Kwal_23.4118
          Length = 939

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 69/159 (43%), Gaps = 24/159 (15%)

Query: 326 FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITGS 383
           F GS +  + +++ +SG   ++   H   V GI  D  ++KM++  LD  +  +++   S
Sbjct: 477 FVGSSNGGIGVYNLQSGLPRKKYRLHKKAVSGIAVDGMNRKMVSCGLDGIVGFYDFSKSS 536

Query: 384 C---------ISTYRGHQDS---VLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHT 431
                     +++   H+ S    L++D +  ++V A   K V+           L GH+
Sbjct: 537 YLGKLQLDAPVTSMVYHRSSDLFALALDDFSIVVVDAVTQKVVR----------QLWGHS 586

Query: 432 EWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
             ++     P      S+S D T R WD+ T  CI   R
Sbjct: 587 NRISSFDFSPDGRWIISTSLDGTARTWDLPTGCCIDGIR 625

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 526 LLSCSLDN-TIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQN 582
           L + +LD+ +I + +  + + +R  +GH   +  +D + D   I+S S D + + WDL  
Sbjct: 558 LFALALDDFSIVVVDAVTQKVVRQLWGHSNRISSFDFSPDGRWIISTSLDGTARTWDLPT 617

Query: 583 GKCI 586
           G CI
Sbjct: 618 GCCI 621

>Scas_571.4
          Length = 601

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 73/172 (42%), Gaps = 25/172 (14%)

Query: 427 LRGHTEWVNCVKLHP-KSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIK 485
            RGH   V      P   F   S+SDD  + +W+I  N  ++ +R               
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYR--------------- 129

Query: 486 DTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRC 545
           D+EN  +D +  K+    L          +F P ++    L S SLD T+K+W +  G+ 
Sbjct: 130 DSENKPMDIRPSKI----LSGHTRKVGHVLFHPRIR--NVLASSSLDFTVKIWNIKKGKV 183

Query: 546 IRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAP 595
           I T   H + V  +A   D   + + + +K + +WD+ + + +     H+ P
Sbjct: 184 IGT-LQHSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQIVSQTKSHQGP 234

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 61/141 (43%), Gaps = 20/141 (14%)

Query: 360 FDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK----------------- 402
           F+D K+ +AS D  I +WN      + TYR  ++  + +   K                 
Sbjct: 100 FNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKILSGHTRKVGHVLFHPR 159

Query: 403 --KIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
              ++ S+S D TVK+W+++         H++ V  +   P      + + +K L +WDI
Sbjct: 160 IRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDPDGAYLATITRNKKLTIWDI 219

Query: 461 RTNSCIKVFRGHVG-QVQKVI 480
            +   +   + H G + Q+V+
Sbjct: 220 ASKQIVSQTKSHQGPKNQRVV 240

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 13/124 (10%)

Query: 306 QLFKGHMDGVLSLKFNHRL---LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           ++  GH   V  + F+ R+   L + S D TV IW+ K G +I  L  H+D V  + FD 
Sbjct: 142 KILSGHTRKVGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVIGTLQ-HSDMVTAMAFDP 200

Query: 363 QKMITASL--DKTIRVWNYITGSCISTYRGHQ---DSVLSVDSYKKIIV----SASADKT 413
                A++  +K + +W+  +   +S  + HQ   +  +    Y +II     S S D+ 
Sbjct: 201 DGAYLATITRNKKLTIWDIASKQIVSQTKSHQGPKNQRVVWLGYSRIIATTGFSKSMDRE 260

Query: 414 VKVW 417
           + +W
Sbjct: 261 IGIW 264

>Scas_397.2
          Length = 410

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 49/120 (40%), Gaps = 38/120 (31%)

Query: 429 GHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTE 488
            H   +  +K  P      S S D  L++W I+  SC ++FRGH  ++          T+
Sbjct: 137 AHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKI----------TD 186

Query: 489 NLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT 548
           ++++          E   DF                  +S SLD T+KLWE  SG  +RT
Sbjct: 187 SVLI----------ERGRDF------------------VSSSLDGTMKLWECGSGSTVRT 218

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 403 KIIVSASADKTVKVWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR 461
           ++++S S+D  +K+W ++  +C    RGHT  +    L  +     SSS D T+++W+  
Sbjct: 152 EVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECG 211

Query: 462 TNSCIKVF 469
           + S ++ F
Sbjct: 212 SGSTVRTF 219

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWD-IAADNFR-IVSGSHDKSIKVWDLQNG 583
           +LS S D  +KLW +    C R   GH   + D +  +  R  VS S D ++K+W+  +G
Sbjct: 154 VLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTMKLWECGSG 213

Query: 584 KCIQTFTGHKAP 595
             ++TF   + P
Sbjct: 214 STVRTFMRRENP 225

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 310 GHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QKM 365
            H   + +LKF  +  ++ +GS D  + +W  K  +  R   GHT  +      +  +  
Sbjct: 137 AHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDF 196

Query: 366 ITASLDKTIRVWNYITGSCISTY 388
           +++SLD T+++W   +GS + T+
Sbjct: 197 VSSSLDGTMKLWECGSGSTVRTF 219

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 328 GSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCI 385
           G+ + +++++D++  +   +   H   +  + F    + +++ S D  +++W+    SC 
Sbjct: 115 GNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCP 174

Query: 386 STYRGH----QDSVLSVDSYKKIIVSASADKTVKVW 417
             +RGH     DSVL      +  VS+S D T+K+W
Sbjct: 175 RIFRGHTSKITDSVLI--ERGRDFVSSSLDGTMKLW 208

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIV 597
           ++SGS D  +K+W +++  C + F GH + I 
Sbjct: 154 VLSGSSDMQLKLWSIKDASCPRIFRGHTSKIT 185

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 66/155 (42%), Gaps = 24/155 (15%)

Query: 326 FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITG- 382
           F GS +  + +++ +SG L ++   H   V G+  D  ++KM++  LD  I  +++    
Sbjct: 474 FVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVSCGLDGIIGFYDFNESK 533

Query: 383 --------SCISTYRGHQDS---VLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHT 431
                   + I++   H+ S     ++D    ++V     K V+           L GH 
Sbjct: 534 YLGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVVR----------QLWGHG 583

Query: 432 EWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCI 466
             +      P      S+S D T+R WD+ T SCI
Sbjct: 584 NRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 307 LFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--D 361
           L K  MD  ++    HR   L      D ++ + DT +  ++R+L GH + +    F  D
Sbjct: 535 LGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPD 594

Query: 362 DQKMITASLDKTIRVWNYITGSCI 385
            + +++ASLD TIR W+  TGSCI
Sbjct: 595 GRWLVSASLDSTIRTWDLPTGSCI 618

 Score = 36.2 bits (82), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 110/301 (36%), Gaps = 80/301 (26%)

Query: 344 LIRRLTGHTDGVKGIYFDDQK---MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDS 400
            +R   GH+     I F D +   +++AS DK+  VW +      S  +  Q   LS   
Sbjct: 340 FLRSRGGHSQPATSIAFADDESHFILSASRDKS--VWAF------SLRKDAQSQELSQRL 391

Query: 401 YKKIIVSASADKTVKVWHVESRTCYTLRGHT-EWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
           +KK   +  A  T++    E  +         EW N +  H +S         K  R WD
Sbjct: 392 HKKNDGNRVAGSTMREKFPEVSSIAIENARIGEWENILTAHNES---------KAARTWD 442

Query: 460 IRT---------------------------------NSCIKVFRGHVGQVQKVIPLTIKD 486
           +R+                                 N  I V+    G ++K   L  + 
Sbjct: 443 MRSKRVGRWTFETIDDGMVKSVAISQCGNFGFVGSSNGGIGVYNMQSGMLRKKYRLHKRA 502

Query: 487 TENLVVDEKIEKVPNPELEEDFADDCTGIFDPN-LKY-----------------PTHLLS 528
              + VD    K+ +  L     D   G +D N  KY                  + L +
Sbjct: 503 VTGVAVDGMNRKMVSCGL-----DGIIGFYDFNESKYLGKLQMDAPITSMVYHRSSDLCA 557

Query: 529 CSLDN-TIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQNGKC 585
            +LD+ +I + +  + + +R  +GH   +  +D + D   +VS S D +I+ WDL  G C
Sbjct: 558 FALDDLSIVVVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSC 617

Query: 586 I 586
           I
Sbjct: 618 I 618

>Scas_719.30
          Length = 940

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 69/153 (45%), Gaps = 20/153 (13%)

Query: 326 FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITGS 383
           F GS +  +++++ +SG L ++   H   V GI  D  ++KM++  LD  +  +++    
Sbjct: 477 FVGSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLDGIVGFYDF---- 532

Query: 384 CISTYRGHQDSVLSVDS-YKKIIVSASAD---------KTVKVWHVESRTCYTLRGHTEW 433
             ST+ G     L +D+   K++   S+D           V +  V  R      GH+  
Sbjct: 533 NKSTFLGK----LQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQRVVRQFWGHSNR 588

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCI 466
           +  +   P      S+S D T+R WD+ T  CI
Sbjct: 589 ITALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 106/301 (35%), Gaps = 80/301 (26%)

Query: 344 LIRRLTGHTDGVKGIYFDDQK---MITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDS 400
            +R   GH+     I F D +   ++++S D+++  W +      S  +  Q   LS   
Sbjct: 343 FLRSRGGHSQPPTTITFADSESHFILSSSRDRSL--WGF------SLRKDAQSQELSQRV 394

Query: 401 YKKIIVSASADKTVKVWHVESRTCYTLRGHT-EWVNCVKLHPKSFTCYSSSDDKTLRMWD 459
           +KK      A  T+K    E            +W N +  H          D+K  R WD
Sbjct: 395 HKKADGGRIAGSTMKEKFPEIIALAIENARIGDWENVITAH---------KDEKFARTWD 445

Query: 460 IRT---------------------------------NSCIKVFRGHVGQVQKVIPLTIKD 486
           +RT                                 N  I VF    G ++K   L  K 
Sbjct: 446 MRTKRVGRWTFPTSDDGFVKSVALSQCGNFGFVGSSNGGISVFNMQSGILRKKYRLHKKT 505

Query: 487 TENLVVDEKIEKVPNPELEEDFADDCTGIFDPN---------LKYP---------THLLS 528
              + +D    K+ +  L     D   G +D N         L  P         + L +
Sbjct: 506 VTGIALDGMNRKMVSCGL-----DGIVGFYDFNKSTFLGKLQLDAPITKMVYHRSSDLFA 560

Query: 529 CSLDN-TIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQNGKC 585
             LD+ +I L +  + R +R  +GH   +   D + D   IVS S D +I+ WDL  G C
Sbjct: 561 LILDDLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGC 620

Query: 586 I 586
           I
Sbjct: 621 I 621

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 89/214 (41%), Gaps = 28/214 (13%)

Query: 388 YRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTC 446
           Y+ H   VL ++ S    I+SAS DKTVK+WH + +       H ++V CV+ HP     
Sbjct: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333

Query: 447 Y-SSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL-------TIKDTENLVVDEKIEK 498
           + S   D   R+W I  +     F      +   + L       TI  T N  V   + +
Sbjct: 334 FISGCLDHKCRLWSILDDEV--SFEYDCQDLITSVTLSPEEGKYTIIGTFNGYVHILMTR 391

Query: 499 VPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSG-RCIRTQFGHVEGVW 557
              P      AD  T       +   H++    D+ I+     +G +  R+Q        
Sbjct: 392 GLTPVSSFHVADRQTQ------EQNAHVMVTETDSKIRHGPRVTGLQAFRSQLD------ 439

Query: 558 DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTG 591
               ++FR+V  S+D  I+++DL+  K ++   G
Sbjct: 440 ----NSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 552 HVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI---GDSSF 606
           HV+ V DI  + +NF I+S S DK++K+W       ++TF  H   + CV      D  F
Sbjct: 277 HVQDVLDINWSKNNF-ILSASMDKTVKLWHPDRKNSLKTFI-HPDFVTCVEFHPTDDRFF 334

Query: 607 VSG 609
           +SG
Sbjct: 335 ISG 337

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 68/159 (42%), Gaps = 24/159 (15%)

Query: 326 FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITGS 383
           F GS +  + +++ +SG   ++   H   V G+  D  ++KM++  LD  I  +++   +
Sbjct: 482 FVGSSEGGIGVYNLQSGLQRKKYRLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDFTKSA 541

Query: 384 C---------ISTYRGHQDS---VLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHT 431
                     +++   H+ S    +++D    +++ A   K V+           L GH+
Sbjct: 542 FLGKLQLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVR----------QLWGHS 591

Query: 432 EWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFR 470
             V      P      S+S D T+R WD+ T  CI   R
Sbjct: 592 NRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGVR 630

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 526 LLSCSLDN-TIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDLQN 582
           L + +LD+ +I + +  + + +R  +GH   V  +D + D   IVS S D +I+ WDL  
Sbjct: 563 LFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPT 622

Query: 583 GKCI 586
           G CI
Sbjct: 623 GGCI 626

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSASADKTVKVWH 418
           DD+ ++TAS+D +++V+N  TG+C++  + H   V  V  D   + I+S S D+++ ++ 
Sbjct: 163 DDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSINIYE 222

Query: 419 VESRTCYTLRGHTEWVNCVK 438
           +E R    +   T     +K
Sbjct: 223 IELRDSKDITSSTTSTELIK 242

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 100/219 (45%), Gaps = 38/219 (17%)

Query: 387 TYRGHQ---DSVLSVDSYKKIIVSASADKTVKVWHVESR-----TCYT--------LRGH 430
           T+RG Q   D+     + K  + +A  D  V++W +        TC          L  H
Sbjct: 20  TFRGSQADDDNDDENFNEKGELFTAGGDNKVRLWRLNCEETGKGTCKVDTIDFLSGLSLH 79

Query: 431 TEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENL 490
            + VN ++   +     S+ DD  + +W + TN   +  +  +G      P+   + +  
Sbjct: 80  EQAVNVIRFDHRGNVLASAGDDGQVLLWKL-TNEETRKKQQRMGDE----PV---EGDGW 131

Query: 491 VVDEKIEKVPNPELEEDFADDCTGIFD----PNLKYPTHLLSCSLDNTIKLWEVSSGRCI 546
            V +++    N +L+       + I+D    P+ KY   L++ S+DN++K++ V +G C+
Sbjct: 132 AVWKRLRGTAN-DLDNMPGGGASEIYDLSWSPDDKY---LVTASMDNSLKVFNVDTGNCV 187

Query: 547 RTQFGH---VEGV-WDIAADNFRIVSGSHDKSIKVWDLQ 581
                H   V+GV WD    N  I+S S D+SI +++++
Sbjct: 188 AFAKDHNHYVQGVTWDPL--NQYIISQSVDRSINIYEIE 224

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 9/81 (11%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKT 373
           LS   + + L T S D+++ +++  +GN +     H   V+G+ +D  +Q +I+ S+D++
Sbjct: 158 LSWSPDDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRS 217

Query: 374 IRVWNY-------ITGSCIST 387
           I ++         IT S  ST
Sbjct: 218 INIYEIELRDSKDITSSTTST 238

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFR-IVSGSHDKSIKVWDLQNG 583
            LS S+D  +K+W+ S+G  +RT  GH   V D A  D  R  VS S D S+K+W+    
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTS 232

Query: 584 KCIQTFTGHKAPIVCVGIGD 603
            C+ T   +   I C+ + +
Sbjct: 233 ACVFTLNSNDG-INCISLAN 251

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 365 MITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESR 422
            +++S+D  +++W+  TG+ + T+ GH  SV   ++    +  VSAS+D ++K+W   + 
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTS 232

Query: 423 TCYTLRGHTEWVNCVKL 439
            C       + +NC+ L
Sbjct: 233 ACVFTLNSNDGINCISL 249

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 4/87 (4%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD 362
           I+L + H   +   +F  N     + S D  + IWD  +G  +R   GHT  V      D
Sbjct: 151 IKLPEAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVD 210

Query: 363 --QKMITASLDKTIRVWNYITGSCIST 387
             +  ++AS D ++++W   T +C+ T
Sbjct: 211 RGRNFVSASSDGSLKLWECSTSACVFT 237

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 78/193 (40%), Gaps = 26/193 (13%)

Query: 405 IVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN 463
            +S+S D  +K+W   + T   T  GHT  VN   +  +     S+S D +L++W+  T+
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTS 232

Query: 464 SCIKVFRGHVG------QVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD 517
           +C+     + G         +  P T   T    +D   E   N E +  FA   +GI  
Sbjct: 233 ACVFTLNSNDGINCISLANYQGNPAT---TSYNALDHSNEY--NTEGKAVFAGHDSGIIT 287

Query: 518 PNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKV 577
            +  Y       +    + +   S   C+     H      IA D+  + +G  D +I  
Sbjct: 288 FHDIY-------NRKKILDILPASKSACVTLTSQH------IAGDDHYLFAGYSDGTIVS 334

Query: 578 WDLQN-GKCIQTF 589
           WD +N  K ++T 
Sbjct: 335 WDTRNVSKPVETL 347

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 61/175 (34%), Gaps = 48/175 (27%)

Query: 428 RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDT 487
             H   +   +  P      SSS D  L++WD  T + ++ F GH   V           
Sbjct: 155 EAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVN---------- 204

Query: 488 ENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIR 547
                              DFA          +    + +S S D ++KLWE S+  C+ 
Sbjct: 205 -------------------DFA---------MVDRGRNFVSASSDGSLKLWECSTSACVF 236

Query: 548 TQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQN-----GKCIQTFTGHKAPIV 597
           T     +G+  I+  N++        S    D  N     GK +  F GH + I+
Sbjct: 237 T-LNSNDGINCISLANYQ--GNPATTSYNALDHSNEYNTEGKAV--FAGHDSGII 286

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 66/143 (46%), Gaps = 10/143 (6%)

Query: 327 TGSYDSTVAIWDTKSGNLIRRLTGHTDGVK-GIYFDDQKMITA-SLDKTIRVWNYITGSC 384
            G+    V +W+  +G +++RL GH   +   +  DD +++ + S D++IRVW+  TG  
Sbjct: 156 AGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQ 215

Query: 385 ISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHV-----ESRTCYTLRGHTEWVNCV 437
           +    GH   +  L        +VS S D T +VW V     +    Y +   T+ V  V
Sbjct: 216 VGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVH-QTKSVWAV 274

Query: 438 KLHPKSFTCYSSSDDKTLRMWDI 460
            +        ++ +D  LR+ D+
Sbjct: 275 DVQEDDMVAVTAGNDGRLRLVDL 297

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 535 IKLWEVSSGRCIRTQFGHVEGVW-DIAADNFRIVSG-SHDKSIKVWDLQNGKCIQTFTGH 592
           + +WE+ +G  ++   GH   ++  + +D+ R+V+  S D+SI+VW L+ G+ +    GH
Sbjct: 163 VVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGH 222

Query: 593 KAPI 596
            A I
Sbjct: 223 TARI 226

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 6/55 (10%)

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI----AADNFRIVSGSHDKSIKVW 578
           SCS D +I++W + +G  +   +GH   +WD+     AD  ++VS S D + +VW
Sbjct: 198 SCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVAD--KLVSVSEDCTCRVW 250

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 555 GVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGD 603
           G   +  D   + +G+    + VW+L  G  +Q   GH+  I C  + D
Sbjct: 143 GSVKVVGDAVYVCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSD 191

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 1/74 (1%)

Query: 414 VKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
           V VW + +      L GH   + C  +        S SDD+++R+W + T   + +  GH
Sbjct: 163 VVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGH 222

Query: 473 VGQVQKVIPLTIKD 486
             ++  +  L + D
Sbjct: 223 TARIWDLRFLRVAD 236

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 51/117 (43%), Gaps = 11/117 (9%)

Query: 305 IQLFKGHMDGVLS--LKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           +Q  +GH   +    +  + RL+ + S D ++ +W  ++G  +    GHT  +  + F  
Sbjct: 174 VQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLR 233

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKI-IVSASADKTVKV 416
              K+++ S D T RVW       +   R  +++V  V   K +  V    D  V V
Sbjct: 234 VADKLVSVSEDCTCRVW------AVGAERMQEEAVYDVHQTKSVWAVDVQEDDMVAV 284

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 385 ISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKS 443
           + TY+ H   VL +D S    ++SAS DKT K+WH           H ++V CVK HP  
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCVKFHPTD 464

Query: 444 FTCY-SSSDDKTLRMWDI 460
              + S   D+  R+W I
Sbjct: 465 DRFFISGCLDQKCRLWSI 482

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 82/191 (42%), Gaps = 31/191 (16%)

Query: 305 IQLFKGHMDGVLSLKFN-HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--- 360
           ++ +K H+  VL + ++ +  L + S D T  +W       ++    H D V  + F   
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQ-HPDFVTCVKFHPT 463

Query: 361 DDQKMITASLDKTIRVW--------------NYITGSCISTYRGHQDSVLSVDSYKKIIV 406
           DD+  I+  LD+  R+W              + +T   ++   G    V + + Y  ++ 
Sbjct: 464 DDRFFISGCLDQKCRLWSILDDEVSFEFNCRDLVTSLTLTPGDGTYTIVGTFNGYIHVLQ 523

Query: 407 SASADKTVKVWHVESRTCYTLRGHTEWVNC------VKLHPK--SFTCYSSSDDKTLRMW 458
           +   +  +  +HV ++  +    +T  V C      V+  P+     C++S  D +LR+ 
Sbjct: 524 TKGLEH-ITSFHVTAKKTHE---NTHEVLCPSNDSKVRHGPRVTGLQCFNSLIDNSLRLV 579

Query: 459 DIRTNSCIKVF 469
              ++S I+VF
Sbjct: 580 VTSSDSRIRVF 590

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI---AADNFRIVSGSHDKSIKVWDL 580
           L+S S+D T KLW  S  R +++ F H + V  +     D+   +SG  D+  ++W +
Sbjct: 426 LISASMDKTAKLWHPSKMRSLKS-FQHPDFVTCVKFHPTDDRFFISGCLDQKCRLWSI 482

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 387 TYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFT 445
           ++ GH   +L +D S    +++ S DKTVK+WH + +       H ++V CVK HP    
Sbjct: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450

Query: 446 CY-SSSDDKTLRMWDI 460
            + S   D   R+W I
Sbjct: 451 FFISGCLDHKARLWSI 466

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 308 FKGHMDGVLSLKFN-HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF---DDQ 363
           F GH   +L + ++ +  + TGS D TV +W      L++    H D V  + F   DD+
Sbjct: 392 FLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPNDDR 450

Query: 364 KMITASLDKTIRVWNYI 380
             I+  LD   R+W+ +
Sbjct: 451 FFISGCLDHKARLWSIL 467

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 7/68 (10%)

Query: 547 RTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI--- 601
           R+  GH + + DI  + +NF +++GS DK++K+W     + ++ F  H   + CV     
Sbjct: 390 RSFLGHNQDILDIDWSKNNF-VLTGSMDKTVKLWHCDRKQLLKNFP-HPDFVTCVKFHPN 447

Query: 602 GDSSFVSG 609
            D  F+SG
Sbjct: 448 DDRFFISG 455

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 65/141 (46%), Gaps = 24/141 (17%)

Query: 311 HMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSG----------------NLIRRLTGHT 352
           H   V ++KF+   + L +GS D  + IW+ + G                N+ RRL  H 
Sbjct: 75  HAGSVTTVKFSPDGKYLASGSDDRILLIWELEGGTTQPMFGAESTDIEHWNVRRRLVAHD 134

Query: 353 DGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSA 408
           + ++ I +  D   M++  LD+ I +WN  T   +  +  HQ  V  V  D   K   +A
Sbjct: 135 NDIQDICWAPDSSIMVSVGLDRAIIIWNGSTFEKVKRFDVHQSHVKGVVFDPANKYFATA 194

Query: 409 SADKTVKV--WHVESRTCYTL 427
           S D+T+K+  +H    T +++
Sbjct: 195 SDDRTIKMFRYHKTGETSFSV 215

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 85/221 (38%), Gaps = 48/221 (21%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           D Q++ T  LD  IR+W+                +L   S      +AS DK + +    
Sbjct: 28  DSQRLATGGLDGKIRIWSI-------------PDILKFASNP----NASTDKDILM---- 66

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480
            +   T+  H   V  VK  P      S SDD+ L +W++             G  Q + 
Sbjct: 67  -KPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLIWELEG-----------GTTQPMF 114

Query: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV 540
                D E+  V  ++    N     D  D C   + P+      ++S  LD  I +W  
Sbjct: 115 GAESTDIEHWNVRRRLVAHDN-----DIQDIC---WAPDSSI---MVSVGLDRAIIIWNG 163

Query: 541 SSGRCIR---TQFGHVEGVWDIAADNFRIVSGSHDKSIKVW 578
           S+   ++       HV+GV    A+ +   + S D++IK++
Sbjct: 164 STFEKVKRFDVHQSHVKGVVFDPANKY-FATASDDRTIKMF 203

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 391 HQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPK-SFTCYS 448
           H   +L  D S    +++AS DKTVK+WH+   T      H ++V CV+ HP      +S
Sbjct: 213 HLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFS 272

Query: 449 SSDDKTLRMWDIRTNSCIKVF 469
              D T+R W I      + F
Sbjct: 273 GCLDHTVRTWSILEGEVAEAF 293

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 88/211 (41%), Gaps = 25/211 (11%)

Query: 306 QLFKGHMDGVLSLKFN-HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF---D 361
           ++F  H+  +L   ++ +  L T S D TV +W       ++    H D V  + F   D
Sbjct: 208 RVFGEHLQDILDCDWSKNSFLLTASMDKTVKLWHINRTTSLKTFV-HPDFVTCVRFHPHD 266

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYR-GHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           D+   +  LD T+R W+ + G     +  G     L V      ++  + +  V V H  
Sbjct: 267 DRFFFSGCLDHTVRTWSILEGEVAEAFNCGDLIMALDVSPDGNWLLIGTFNGYVHVLHTN 326

Query: 421 S----RTCYTLRGHTEWVNCVKLHPK-------SFTCYS------SSDDKTLRMWDIRTN 463
                 + + L+   E  N  +  PK           Y       +S+D  +R++D+ T 
Sbjct: 327 GLKLLHSFHLLQKPNETENRPRHGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTT 386

Query: 464 SCIKVFRGHVGQVQKVIP--LTIKDTENLVV 492
             +++FRG   +  ++    L ++D E++V+
Sbjct: 387 RLLEIFRGFSNESSRISAHHLEMEDGESVVL 417

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 56/121 (46%), Gaps = 6/121 (4%)

Query: 474 GQVQKVIPLTIKDTENLVVDEKIEKVP--NPELEEDFADDCTGIFDPNLKYPTHLLSCSL 531
           G+  + +P    + + +  D + +  P  +P+    F +    I D +    + LL+ S+
Sbjct: 174 GKRTEAVPAPGPERKEIPFDLEQQYAPVFHPDPHRVFGEHLQDILDCDWSKNSFLLTASM 233

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGVWDI---AADNFRIVSGSHDKSIKVWDLQNGKCIQT 588
           D T+KLW ++    ++T F H + V  +     D+    SG  D +++ W +  G+  + 
Sbjct: 234 DKTVKLWHINRTTSLKT-FVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGEVAEA 292

Query: 589 F 589
           F
Sbjct: 293 F 293

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 73/158 (46%), Gaps = 26/158 (16%)

Query: 349 TGHTDGVKGIYFD--DQKMITASLDKTIRVW----NYITGSCISTYRGHQDSVLSVD--- 399
           TGH D V  + +D   + M T S D+ I+V+    +        ++R H  S++S+D   
Sbjct: 6   TGHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWAS 65

Query: 400 -SYKKIIVSASADKTVKVWHVE-----------SRTCYTLRGHTEWVNCVKLHPKSFTCY 447
             Y +II SAS DKT+K+W  +           +R C TL      + CVK  P      
Sbjct: 66  PEYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLC-TLNDSKGSLYCVKFAPSHLGLR 124

Query: 448 SSS--DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLT 483
            +S  +D  +RM+D    S ++ +   +    KV+P+ 
Sbjct: 125 IASIGNDGIMRMYDALDPSNLRSWT--MTAEVKVLPVA 160

>Scas_615.11
          Length = 349

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 75/169 (44%), Gaps = 34/169 (20%)

Query: 324 LLFTGSYDSTVAIW-------------------DTKSGNLIRRLTGHTDGVKGIYF--DD 362
           LL  GS+DSTV+IW                   ++   +L+  + GH + VKGI +  D 
Sbjct: 74  LLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133

Query: 363 QKMITASLDKTIRVWNYITGS----CISTYRGHQDSVLSVDSYKKI--IVSASADKTVKV 416
             + + S DK++ +W          CIS  + H   V  V  + ++  + S+S D T+++
Sbjct: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193

Query: 417 W--HVESRTCYT-LRGHTEWVNCVKLHP----KSFTCYSSSDDKTLRMW 458
           W  + +   C   L GH   V C         +S    S SDD T+R+W
Sbjct: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 86/206 (41%), Gaps = 37/206 (17%)

Query: 308 FKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSG-----NLIRRL--TGHTDGVKGIYF 360
            K   D + SL ++H LL TGS D  + I +  +      +L+  L  T H   ++ + +
Sbjct: 9   LKLQNDKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAW 68

Query: 361 DDQKMITA--SLDKTIRVW-------------------NYITGSCISTYRGHQDSV--LS 397
                + A  S D T+ +W                   N +    ++   GH++ V  ++
Sbjct: 69  RPHSNLLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIA 128

Query: 398 VDSYKKIIVSASADKTVKVWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSSDD 452
                 ++ S S DK+V +W      E   C + L+ H++ V  V  HP+     SSS D
Sbjct: 129 WSHDGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYD 188

Query: 453 KTLRMWDIRTN--SCIKVFRGHVGQV 476
            T+R+W    +   C  V  GH G V
Sbjct: 189 DTIRLWKDYDDDWECAAVLNGHEGTV 214

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 91/231 (39%), Gaps = 47/231 (20%)

Query: 393 DSVLSVDSYKKIIVSASADKTVKVWHVES--RTCYTLRG------HTEWVNCVKLHPKSF 444
           D + S+D    ++ + S D+ +K+ +V +  R   +L        H + + CV   P S 
Sbjct: 14  DKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSN 73

Query: 445 TCYSSSDDKTLRMW---------------DIRTNSC----IKVFRGHVGQVQKVIPLTIK 485
              + S D T+ +W               +  TNS     + +  GH  +V+ +      
Sbjct: 74  LLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIA--WSH 131

Query: 486 DTENLVVDEKIEKVPNPELEEDFAD-DCTGIFDPNLKYPTH---------LLSCSLDNTI 535
           D   L    + + V   E ++D  + +C  +   + +   H         L S S D+TI
Sbjct: 132 DGALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTI 191

Query: 536 KLWEV--SSGRCIRTQFGHVEGVW------DIAADNFRIVSGSHDKSIKVW 578
           +LW+       C     GH   VW          ++ R+ SGS D +++VW
Sbjct: 192 RLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 324 LLFTGSYDSTVAIWDTKSGNL--IRRLTGH------TDGVKGIYFDDQKMITASLDKTIR 375
           LL + SYD T+ +W     +      L GH      +D  KG   +  ++ + S D T+R
Sbjct: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240

Query: 376 VWNYI 380
           VW YI
Sbjct: 241 VWRYI 245

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/316 (20%), Positives = 131/316 (41%), Gaps = 51/316 (16%)

Query: 306 QLFKGHMDGVLSLKFNHRL---LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI---- 358
           QL  GH DGV ++  N+ +   L T S D  +  W+  +   +     H   V G+    
Sbjct: 61  QLGYGHRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTP 120

Query: 359 -YFDDQK---MITASLDKTIRVWNYITG---------------SCISTYRGHQDSVLSVD 399
            Y   Q+   M++   DKT+++W+  +                  I T+ G + +  S+D
Sbjct: 121 SYLSPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHG-EHAFQSLD 179

Query: 400 SYKKIIVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSS-DDKTLRM 457
            +++     +    +++W    S+    L    + +N V+ +       +S+  D ++ +
Sbjct: 180 HHRQKSNFVTGGAQIELWDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVL 239

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTE--NLVVDEKIEKVPNPELE------EDFA 509
           +D+RTNS  +     + Q  +   +     E  N V+  +       ++         F 
Sbjct: 240 YDLRTNSPTQ----KIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFK 295

Query: 510 DDCTGIFDPNLKYPT--HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI-----AAD 562
           D  + + D +   PT   +++ S D TI++++V  G     +  H + +  I       D
Sbjct: 296 DHVSAVMDVDFS-PTGDEVVTGSYDKTIRIYQVKHGHS--REIYHTKRMQHIFQVKYTMD 352

Query: 563 NFRIVSGSHDKSIKVW 578
           +  IVSGS D ++++W
Sbjct: 353 SKYIVSGSDDGNVRLW 368

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 55/124 (44%), Gaps = 25/124 (20%)

Query: 261 NPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKF 320
           NP  + N  +A    N+ YY                + RN    + +FK H+  V+ + F
Sbjct: 263 NPVEAFNFVIANEDHNAYYY----------------DMRNMSKALHVFKDHVSAVMDVDF 306

Query: 321 NHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY-----FDDQKMITASLDKT 373
           +     + TGSYD T+ I+  K G+   R   HT  ++ I+      D + +++ S D  
Sbjct: 307 SPTGDEVVTGSYDKTIRIYQVKHGH--SREIYHTKRMQHIFQVKYTMDSKYIVSGSDDGN 364

Query: 374 IRVW 377
           +R+W
Sbjct: 365 VRLW 368

>Kwal_27.12586
          Length = 509

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 308 FKGHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGV-KGIYFDDQK 364
             GH   + +  FN  + +L +GS D T+ +W + S +      G+T G+    + DD K
Sbjct: 331 LNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWIDDDK 390

Query: 365 MITASLDKTIRVWNYITGS--CISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           +I  SLD ++R+W+++T +   IS   G      S+   K        D  V V+++E
Sbjct: 391 VIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDKLKFAIGKMDGEVTVYNIE 448

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 60/158 (37%), Gaps = 12/158 (7%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITG 382
             TG     + +W T    L      H   +  I +  D    +T  +D    VWN  TG
Sbjct: 221 FLTGVESGEIRLW-THDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTG 279

Query: 383 SCISTY----RGHQDSVLSVDSY----KKIIVSASADKTVKVWHVESRTCYTLRGHTEWV 434
           + +  +     G  DS L VD+      K ++             ESR    L GH+  +
Sbjct: 280 TALQQFSFRENGTVDS-LGVDASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGHSATI 338

Query: 435 NCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
                + ++    S SDDKTLR+W   + S    F G+
Sbjct: 339 TAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGN 376

>Kwal_14.1235
          Length = 607

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 97/227 (42%), Gaps = 51/227 (22%)

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
           +E    +  + HT  VN +KL+       S S DK +  WD+ +  CI  F+G   Q+  
Sbjct: 306 MEGHIAHYFKKHTSTVNQLKLNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQISS 365

Query: 479 VI--PL----TIKDT-----------------ENLVVDEKIEKVPNPELEEDFADDCT-- 513
           +   PL     I+DT                 ++L  DE+ E+    + E   A++ T  
Sbjct: 366 LEFRPLFSSVEIQDTSTEDDDDVQMKADDDDLDSLFGDEEEEEKRKAQEENTTAEESTKK 425

Query: 514 ------------GIFDPNLKYPTHLLSCSLDNTIKLWE--VSSGRCIRTQFGHVEGVWDI 559
                        +FD N    T L SC+ + +I++W+  ++S   ++   G     W +
Sbjct: 426 SPEEEISRSTLRTVFDEN----TFLGSCT-NGSIQIWDRRIASRPAMKLMRGPQTPPWCM 480

Query: 560 AA----DNFRIVSGSHDKSIKVWDLQ-NGKCIQT--FTGHKAPIVCV 599
           +A    D  R+ +G  + +++ +DL+  GK  +T  F     P+ CV
Sbjct: 481 SACWSTDGDRVYAGRRNATVEEYDLKIGGKTSKTLKFPSISGPVSCV 527

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 308 FKGHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF 360
           FK H   V  LK N+      +GS+D  V  WD  SG  I    G +  +  + F
Sbjct: 314 FKKHTSTVNQLKLNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQISSLEF 368

>Scas_721.128
          Length = 851

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 95/229 (41%), Gaps = 42/229 (18%)

Query: 385 ISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKS 443
           +  Y+ H   +L +D S    +++AS DK V +WH +  T      H ++V  V+ HPK 
Sbjct: 260 VRIYKEHSHDILDLDWSKNNFLLTASMDKLVSLWHPDRETSLKSFPHPDFVTSVRFHPKD 319

Query: 444 FTCYSSS-DDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
              + S   D   RMW I  N  +  F                D ++L+    I    +P
Sbjct: 320 DRFFVSGCLDHKCRMWSILENKVVYEF----------------DCQDLITAISI----SP 359

Query: 503 ELEE-----DFADDCTGIFDPNLK--YPTHLLSCSL------DNTIKLWEVSSGRCIRTQ 549
            + E      F    T +    LK  Y  H+L   +      D++ K      G+ ++  
Sbjct: 360 GVGEFTIIGTFNGYITILSTFELKPLYTFHVLDKHMQGNSGNDSSFKNL---LGQNLKNH 416

Query: 550 FG-HVEGV---WDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKA 594
            G  V G+    +   D+ +++  S D  I+++DL+  K I+ F G ++
Sbjct: 417 HGPRVTGLQLFLEKETDDLKLLVSSTDSRIRIFDLEKNKLIEVFKGFRS 465

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 67/156 (42%), Gaps = 30/156 (19%)

Query: 308 FKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMIT 367
           F+ H   V +L  + R L +GS D  + I+D +    +  L  H   +  + F       
Sbjct: 37  FQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFS-----R 91

Query: 368 ASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCY-T 426
           A+ DK                 G Q          K ++SAS D T+ +W V+    +  
Sbjct: 92  ATTDKD----------------GKQQG-------NKWLLSASEDHTIIIWRVKDWENFGK 128

Query: 427 LRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
           L+GH   +N + +HP S    S S+D ++R+W++ T
Sbjct: 129 LKGHNARINDLDIHP-SNRVASVSEDHSIRLWNLMT 163

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 41/93 (44%), Gaps = 19/93 (20%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFRIVSGSHDKSIKVWDL--- 580
           LLS S D+TI +W V          GH   +   DI   N R+ S S D SI++W+L   
Sbjct: 106 LLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSN-RVASVSEDHSIRLWNLMTA 164

Query: 581 ------------QNGKCIQTFTGHKAPIVCVGI 601
                       QNGK ++ + G  A    VG+
Sbjct: 165 KKAAVLKLKKYNQNGKYVR-WCGKDAGFFAVGL 196

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 566 IVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCV 599
           +VSGS+D+ I+++DLQ  K + T   H   I  +
Sbjct: 54  LVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSL 87

>Kwal_27.11126
          Length = 996

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 9/96 (9%)

Query: 508 FADDCTGIF----DPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-- 561
           F D    IF      N KY     SCS D +IKLW++ SG+ + T +GH   +W++    
Sbjct: 177 FTDHEGAIFFVTASKNGKYAA---SCSDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFD 233

Query: 562 DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIV 597
           ++ +++S S D + +VWD+     +   + H+  ++
Sbjct: 234 NDSKVISVSEDCTCRVWDISEDNTLSQASVHEGHLL 269

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 331 DSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTY 388
           D ++ +WD KSG L+    GHT  +  + F  +D K+I+ S D T RVW+    + +S  
Sbjct: 202 DRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQA 261

Query: 389 RGHQDSVLS------VDSYKKIIVSASADKTVKVWHVESRT 423
             H+  +L       VD+ + I  ++  D  +K+  +++++
Sbjct: 262 SVHEGHLLKSVWGLDVDNERMIAATSGNDGRIKLTDLKAKS 302

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 327 TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASL--DKTIRVWNYITGSC 384
            G+    V +WD +S   +   T H   +  +         AS   D++I++W+  +G  
Sbjct: 156 AGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSDDRSIKLWDLKSGQL 215

Query: 385 ISTYRGHQDSV---LSVDSYKKIIVSASADKTVKVWHV 419
           +ST  GH   +   L  D+  K+I S S D T +VW +
Sbjct: 216 LSTAWGHTARIWNLLFFDNDSKVI-SVSEDCTCRVWDI 252

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 72/171 (42%), Gaps = 37/171 (21%)

Query: 414 VKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGH 472
           V VW +ES +  +    H   +  V          S SDD+++++WD+++   +    GH
Sbjct: 163 VIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSDDRSIKLWDLKSGQLLSTAWGH 222

Query: 473 VGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLD 532
             ++  ++       +N   D K+  V         ++DCT            +   S D
Sbjct: 223 TARIWNLLFF-----DN---DSKVISV---------SEDCT----------CRVWDISED 255

Query: 533 NTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGS--HDKSIKVWDLQ 581
           NT+    V  G  +++       VW +  DN R+++ +  +D  IK+ DL+
Sbjct: 256 NTLSQASVHEGHLLKS-------VWGLDVDNERMIAATSGNDGRIKLTDLK 299

>Scas_680.11
          Length = 347

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQNG 583
           L SCS DN   +W   +G  + T  GH   +W I  D F    V+GS D SIK+W ++ G
Sbjct: 25  LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETG 84

Query: 584 KCIQT 588
           + + +
Sbjct: 85  ENVYS 89

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 348 LTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSYKK 403
           L GH   +  + ++ +   + + S D    VW  + G  + T  GH  ++ S  VD + +
Sbjct: 6   LMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTE 65

Query: 404 IIVSASADKTVKVWHVES 421
             V+ SAD ++K+W VE+
Sbjct: 66  YCVTGSADYSIKMWKVET 83

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 304 RIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD 361
           R  +  GH   +  +K+N    LLF+ S D+  ++W + +G  +  L GH   +  I  D
Sbjct: 2   RPIVLMGHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVD 61

Query: 362 D--QKMITASLDKTIRVWNYITGSCISTY 388
              +  +T S D +I++W   TG  + ++
Sbjct: 62  KFTEYCVTGSADYSIKMWKVETGENVYSW 90

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 3/80 (3%)

Query: 390 GHQDSVLSVDSYKK--IIVSASADKTVKVWH-VESRTCYTLRGHTEWVNCVKLHPKSFTC 446
           GH+  +  V   ++  ++ S S D    VW+ V      TL GH   +  + +   +  C
Sbjct: 8   GHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYC 67

Query: 447 YSSSDDKTLRMWDIRTNSCI 466
            + S D +++MW + T   +
Sbjct: 68  VTGSADYSIKMWKVETGENV 87

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 111/289 (38%), Gaps = 57/289 (19%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDG-VKGIYF--DD 362
           +GH D +L++    + + + TG  D  + +W T+S   ++ + T    G V G+ F  + 
Sbjct: 252 EGHYDEILTVAASPDGKYVVTGGRDKKLIVWSTESLAPVKVIPTKDRRGEVLGLAFRRNT 311

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVE 420
            ++  A  D  IR +     S +    GHQD V  +S  + ++ +   S D+T  +W + 
Sbjct: 312 DQLYAACADYKIRTFAINQFSQLEVLYGHQDIVADISALNMERCVTVGSRDRTCMLWKIA 371

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480
             T  T RG                      +K LR W  + NS                
Sbjct: 372 DETRLTFRG------------------GDDPEKLLRRWQ-KANS---------------- 396

Query: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV 540
                + EN   D+     P P    + + DC  + D      +H +S S +  I LW +
Sbjct: 397 -----EQENKDADDNTPAEP-PVFYGEGSIDCITMLD-----DSHFISGSDNGNISLWSL 445

Query: 541 SSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTF 589
           S  + +  Q   V        DN +I SG  D +++    Q  +  Q +
Sbjct: 446 SKKKPLFVQ--RVAHGVQPQPDNTKI-SGERDPAVRTQQAQGNRLAQPY 491

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 60/118 (50%), Gaps = 4/118 (3%)

Query: 303 CRIQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKG--I 358
            ++ L   H+  V ++K   ++ +L +GS D  + +W  + G+  R L GH+ G+    I
Sbjct: 132 SKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTII 191

Query: 359 YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKV 416
               + ++++SLD ++R+W   +G  IS +   +++   V S   ++   S   + +V
Sbjct: 192 IERGRNVLSSSLDGSVRLWELGSGKTISKFCRKENTTDGVTSMSLLVGEESTSMSAQV 249

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 4/72 (5%)

Query: 522 YPTH--LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWD--IAADNFRIVSGSHDKSIKV 577
           +P++  LLS S D  +K+W +  G   RT  GH  G+ D  I      ++S S D S+++
Sbjct: 150 FPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRL 209

Query: 578 WDLQNGKCIQTF 589
           W+L +GK I  F
Sbjct: 210 WELGSGKTISKF 221

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 83/214 (38%), Gaps = 48/214 (22%)

Query: 395 VLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRG-HTEWVNCVKLHPKSFTCYSSSDDK 453
           ++S D+    IV   +   + V+  E  +  +L G H   V  VK+ P +    S S D 
Sbjct: 104 LISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDM 163

Query: 454 TLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCT 513
            L++W +   S  +  +GH   +   I               IE+  N            
Sbjct: 164 QLKVWSLEDGSNPRTLKGHSAGITDTII--------------IERGRN------------ 197

Query: 514 GIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWD-IAADNFRIVSGSHD 572
                       +LS SLD +++LWE+ SG+ I ++F   E   D + + +  +   S  
Sbjct: 198 ------------VLSSSLDGSVRLWELGSGKTI-SKFCRKENTTDGVTSMSLLVGEESTS 244

Query: 573 KSIKVWDLQNGKCI-------QTFTGHKAPIVCV 599
            S +V D + G  +       Q F GH +  + V
Sbjct: 245 MSAQVTDRETGDRLEFGTEGKQVFAGHLSGTITV 278

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 364 KMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVWHVE- 420
           K++       I V+++   S +S    H   V +V  +    +++S S D  +KVW +E 
Sbjct: 113 KIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLED 172

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVF 469
                TL+GH+  +    +  +     SSS D ++R+W++ +   I  F
Sbjct: 173 GSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKTISKF 221

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 107/250 (42%), Gaps = 30/250 (12%)

Query: 348 LTGHTDGVKGIYFDDQK--MITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDSYKK 403
           L GH   +  + ++ +   + + + D    VW  I G  + T+ GH  ++ S  VD + +
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTE 65

Query: 404 IIVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
             V+ SAD +VK+W V +    YT +  T         P     +S + DK L + D   
Sbjct: 66  YAVTGSADFSVKLWKVCDGSNVYTWKTKT---------PVRRVEFSPAGDKILAVLD--- 113

Query: 463 NSCIKVFRGHVGQVQKVIPLTIKDTE-NLVVDEKIEKVPNPELEEDFADDCTGIFDPNLK 521
                   G+ G V   +   +++TE N +V+   E V      +DF       +    K
Sbjct: 114 -----GVMGYAGSV--TVYDVVRNTETNEIVNINEEPVFEILTHDDFGIASVASWGFEGK 166

Query: 522 YPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGSHDKSIKVWD 579
           Y   +++   D  +  ++  +G  + +   H + V DI  + D    ++ S D + K+ D
Sbjct: 167 Y---IVAGHKDGKVSKYDGENGEYLDSLELHEQSVSDIQFSPDRTYFITSSRDSASKLVD 223

Query: 580 LQNGKCIQTF 589
           + +   ++T+
Sbjct: 224 VTSFDVLKTY 233

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 108/258 (41%), Gaps = 40/258 (15%)

Query: 304 RIQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD 361
           R  + KGH   +  +K+N    L+F+ + DS  ++W   +G  +    GH   +  I  D
Sbjct: 2   RPIMLKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVD 61

Query: 362 D--QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW-- 417
              +  +T S D ++++W    GS + T++       +    +++  S + DK + V   
Sbjct: 62  QFTEYAVTGSADFSVKLWKVCDGSNVYTWK-------TKTPVRRVEFSPAGDKILAVLDG 114

Query: 418 ---HVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDD---KTLRMWDIRTNSCIKVFRG 471
              +  S T Y +  +TE    V ++ +      + DD    ++  W       +    G
Sbjct: 115 VMGYAGSVTVYDVVRNTETNEIVNINEEPVFEILTHDDFGIASVASWGFEGKYIVA---G 171

Query: 472 HV-GQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCS 530
           H  G+V K       D EN       E + + EL E    D    F P+    T+ ++ S
Sbjct: 172 HKDGKVSKY------DGENG------EYLDSLELHEQSVSDIQ--FSPDR---TYFITSS 214

Query: 531 LDNTIKLWEVSSGRCIRT 548
            D+  KL +V+S   ++T
Sbjct: 215 RDSASKLVDVTSFDVLKT 232

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFR--IVSGSHDKSIKVWDLQNG 583
           + SC+ D+   +W   +G  + T  GH+  +W I  D F    V+GS D S+K+W + +G
Sbjct: 25  IFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDG 84

Query: 584 KCIQTFTGHKAPI 596
             + T+   K P+
Sbjct: 85  SNVYTWK-TKTPV 96

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 78/180 (43%), Gaps = 29/180 (16%)

Query: 302 RCRIQLFKGHMDGVLSLKFNHRL---LFTGSYDSTVAIWDTKSGNLIRR-LTGHTDGVKG 357
           + ++     H +    L FN  +   L +GS D+TVA+WD ++    +  LT H D V  
Sbjct: 176 KAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVND 235

Query: 358 I---YFDDQKMITASLDKTIRVWN----------YITGSCISTYRGHQDSVLSVDSYKKI 404
           +    F+     T S DKT++V +            T S  +T    + S       + +
Sbjct: 236 VKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHS-------RNL 288

Query: 405 IVSASADKTVKVWHVE--SRTCYTLRGHTEWVNCVKLHPKS--FTCYSSSDDKTLRMWDI 460
           + +A  D  + ++ +   S   + + GH + V  V+  P +    C S SD + + +WD+
Sbjct: 289 LAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDL 347

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIKVWDL 580
           +++SCS D +IKLW + SG  + T +GH   +W +    ++ ++VS S D + +VWD+
Sbjct: 195 YVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 6/98 (6%)

Query: 327 TGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSC 384
            G+    V IWD  S   +  L GH   +  +    + + +++ S D++I++WN  +G  
Sbjct: 156 AGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGEL 215

Query: 385 ISTYRGHQDSVLS---VDSYKKIIVSASADKTVKVWHV 419
           +ST  GH   +     +D+  K +VS S D T +VW +
Sbjct: 216 LSTGWGHTARIWQLKFIDNDTK-VVSVSEDCTCRVWDI 252

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 535 IKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           + +W++ S   +    GH   ++   ++ +   +VS S D+SIK+W+L++G+ + T  GH
Sbjct: 163 VFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGH 222

Query: 593 KAPI 596
            A I
Sbjct: 223 TARI 226

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 310 GHMDGV--LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKM 365
           GH   +  ++L  N   + + S D ++ +W+ KSG L+    GHT  +  + F  +D K+
Sbjct: 179 GHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKV 238

Query: 366 ITASLDKTIRVWN 378
           ++ S D T RVW+
Sbjct: 239 VSVSEDCTCRVWD 251

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 396 LSVDSYKKIIVSA-SADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
           +SV S  K+ ++A +    V +W + S T  + L GH   +  V L        S SDD+
Sbjct: 144 ISVFSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDR 203

Query: 454 TLRMWDIRTNSCIKVFRGHVGQV 476
           ++++W++++   +    GH  ++
Sbjct: 204 SIKLWNLKSGELLSTGWGHTARI 226

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query: 345 IRRLTGHTDGVKGIYFDDQKMITASL--DKTIRVWNYITGSCISTYRGHQDSVLSVD-SY 401
           I +L GH   +  + F+ +  + AS   D TIRVW+   G+ I  + GH  +++S+    
Sbjct: 352 IGKLVGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVN 411

Query: 402 KKIIVSASADKTVKVW 417
             +++SAS D +VK+W
Sbjct: 412 NDMLISASMDGSVKLW 427

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 9/86 (10%)

Query: 310 GHMDGVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKMI 366
           GH   +  L+FN   +LL + + D+T+ +W   +GN I    GHT  +  + + ++  +I
Sbjct: 357 GHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLI 416

Query: 367 TASLDKTIRVWN------YITGSCIS 386
           +AS+D ++++W+       ITG+ I+
Sbjct: 417 SASMDGSVKLWDCGKKLQEITGNLIA 442

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 11/87 (12%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKSIKVWDLQNGK 584
           L S + DNTI++W   +G  I   +GH + +  +   +N  ++S S D S+K+WD   GK
Sbjct: 374 LASAADDNTIRVWHGGNGNSIHCFYGHTQTIVSLKWVNNDMLISASMDGSVKLWDC--GK 431

Query: 585 CIQTFTGH--------KAPIVCVGIGD 603
            +Q  TG+          PI    I D
Sbjct: 432 KLQEITGNLIAETIVDGVPIFAGAISD 458

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/175 (18%), Positives = 69/175 (39%), Gaps = 21/175 (12%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITG 382
           + TG  +  + +W+ K G L      H   +  I+++  +   I+   D    +W+  +G
Sbjct: 237 IATGVENGELRLWN-KEGKLQNVFNFHKSPIIAIHWNSSNTHFISTDADNITILWDVNSG 295

Query: 383 SCISTYRGHQDS-----------VLSVDSY----KKIIVSASADKTVKVWHVESRTCYTL 427
             +  +    +            +  VD+      K ++       +     +SR    L
Sbjct: 296 VVLQHFESKANQINGNNNNNSNQMFGVDTVWVDTDKFVIPGPGGNLLVYTMSDSRPIGKL 355

Query: 428 RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPL 482
            GH   ++ ++ + ++    S++DD T+R+W     + I  F GH    Q ++ L
Sbjct: 356 VGHRGTISQLEFNSETKLLASAADDNTIRVWHGGNGNSIHCFYGH---TQTIVSL 407

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 91/198 (45%), Gaps = 13/198 (6%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGN-LIRRLTGHTDGVKGIYFD-- 361
           I+   GH+D V  L +N+ +L +GS D  +   D +  +     +  HT  V G+ ++  
Sbjct: 337 IRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVA 396

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVS---ASADKTVKV 416
           D K+ +   D  + V+   + S I T+  H+ +V  ++   +K+ +++    +AD+ +K+
Sbjct: 397 DNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKI 456

Query: 417 WHVESRTCYT-LRGHTEWVNCV-KLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVG 474
           W+V +    + +   ++  N V   +              L +WD  +   I + +GH  
Sbjct: 457 WNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSF 516

Query: 475 QVQKVIPLTIKDTENLVV 492
              +V+ LT+ +    VV
Sbjct: 517 ---RVLHLTLSNDGTTVV 531

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%)

Query: 524 THLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSI 575
           +HL     +  +++++V   +CIRT  GH++ V  ++ +N  + SGS D  I
Sbjct: 315 SHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRI 366

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 524 THLLSCSLDNTIKLWEVSSGRCIR---TQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDL 580
           T +L+ +L  +I L + ++G  +    T+  +    W  A  +  +  G  +  ++++D+
Sbjct: 274 TDVLAVALGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAV--GQANGLVEIYDV 331

Query: 581 QNGKCIQTFTGHKAPIVCVGIGDSSFVSG 609
              KCI+T +GH   + C+   +    SG
Sbjct: 332 MKRKCIRTLSGHIDRVACLSWNNHVLTSG 360

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 56/146 (38%), Gaps = 7/146 (4%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNY-ITGS 383
           L  G  +  V I+D      IR L+GH D V  + +++  + + S D  I   +  +   
Sbjct: 317 LAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDP 376

Query: 384 CISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLH 440
              T   H   V  L  +     + S   D  V V+   S++   T   H   V  +   
Sbjct: 377 FFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWS 436

Query: 441 PKS---FTCYSSSDDKTLRMWDIRTN 463
           P           + D+ L++W++ T+
Sbjct: 437 PHKRGVLATGGGTADRRLKIWNVNTS 462

>YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin
           interacting protein, contains eight WD (WD-40) repeats
           [1848 bp, 615 aa]
          Length = 615

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 13/131 (9%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-----DDQKMITASLDKTIRVW 377
             + T   D  ++ +D KSG  ++ +    + V+G  F     D QK  T   D TIRVW
Sbjct: 220 EFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVGADATIRVW 279

Query: 378 NYITGSCISTYR------GHQDSVLSVDSYKKIIVSASADKTVKVWHV-ESRTCYTLRGH 430
           +  T  C+  +       G+Q  V  V +    I+S S D T+  + +       T+ GH
Sbjct: 280 DVTTSKCVQKWTLDKQQLGNQQ-VGVVATGNGRIISLSLDGTLNFYELGHDEVLKTISGH 338

Query: 431 TEWVNCVKLHP 441
            + +  + ++P
Sbjct: 339 NKGITALTVNP 349

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 7/104 (6%)

Query: 504 LEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCI------RTQFGHVEGVW 557
           +E+D      GIF  +        +   D TI++W+V++ +C+      + Q G+ + V 
Sbjct: 245 IEDDQEPVQGGIFALSWLDSQKFATVGADATIRVWDVTTSKCVQKWTLDKQQLGN-QQVG 303

Query: 558 DIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
            +A  N RI+S S D ++  ++L + + ++T +GH   I  + +
Sbjct: 304 VVATGNGRIISLSLDGTLNFYELGHDEVLKTISGHNKGITALTV 347

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 4/69 (5%)

Query: 314 GVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITAS 369
           GV+S+ F+   RLL+    +   A+WD   G +I +L GH+D + G+    D   + T S
Sbjct: 395 GVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVATSPDGLAICTGS 454

Query: 370 LDKTIRVWN 378
            D T++VW+
Sbjct: 455 WDMTMKVWS 463

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 112/296 (37%), Gaps = 29/296 (9%)

Query: 311 HMDGVLSLKF--NHRLLFTGSYDSTVAIW-----DTKSGNLIRRLTGHTDGVKGIYF-DD 362
           H   VLS     N  L+ +   D+   I+     D    N++    GHT  +  I F DD
Sbjct: 168 HSQWVLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDD 227

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK-------KIIVSASADKTVK 415
             ++TAS D T  +W+      I+ +  H   VLS+ +          +  S  +D  + 
Sbjct: 228 NSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLY 287

Query: 416 VWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN------SCIKV 468
           +W     T   +       V+ VK      T  + SDD    ++D+R++      S  + 
Sbjct: 288 IWDKRVPTSVQSFFVSDSDVSKVKFFRNGNTIATGSDDGCTNLYDLRSDCRIANYSLSRS 347

Query: 469 FRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPEL---EEDFADDCTGIFDPNLKYPTH 525
             G     Q+   ++  D              +P +      F D+  G+   +      
Sbjct: 348 IHGATPVQQQTYIMSNMDYTAPSGTLARASPYSPAIGTVSSSFIDN-QGVISMDFSRSGR 406

Query: 526 LLSCSL-DNTIKLWEVSSGRCIRTQFGHVEGVWDIAA--DNFRIVSGSHDKSIKVW 578
           LL  S  +    +W++  G  I    GH + +  +A   D   I +GS D ++KVW
Sbjct: 407 LLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVATSPDGLAICTGSWDMTMKVW 462

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 68/154 (44%), Gaps = 14/154 (9%)

Query: 345 IRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLS--VDS 400
           +  L GH + V    +  D + +++AS D  + +W+  TG   +    H   VLS  +  
Sbjct: 120 VTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAICP 179

Query: 401 YKKIIVSASADKTVKVWHVESR------TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKT 454
              ++ SA  D    ++ V  +           +GHT +++ ++    + +  ++S D T
Sbjct: 180 NGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDN-SILTASGDMT 238

Query: 455 LRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTE 488
             +WDI  +  I  F  H+G    V+ L+   TE
Sbjct: 239 CALWDITKSKRINEFADHLGD---VLSLSAAPTE 269

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 72/189 (38%), Gaps = 21/189 (11%)

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQK 478
           V  +   TL+GH   V+  +    S T  S+S D  + +WD  T         H    Q 
Sbjct: 115 VNLKPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLH---SQW 171

Query: 479 VIPLTIKDTENLVVDEKIEK---VPNPELEEDFADDCTGIFDPNLKYPTH--------LL 527
           V+   I    NLV    ++    +     ++    +   IF  +  Y +         +L
Sbjct: 172 VLSCAICPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDNSIL 231

Query: 528 SCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-------DNFRIVSGSHDKSIKVWDL 580
           + S D T  LW+++  + I     H+  V  ++A       +     SG  D  + +WD 
Sbjct: 232 TASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDK 291

Query: 581 QNGKCIQTF 589
           +    +Q+F
Sbjct: 292 RVPTSVQSF 300

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 95/235 (40%), Gaps = 46/235 (19%)

Query: 298 WRNGRCRIQLFKGHMDGVLSLKFNHRLLFTGSYD--STVAIWDTKSGNLIRRL----TGH 351
           W      + +   H   ++S+K+N       S D  +   +W+  SG +++      TG 
Sbjct: 247 WNKTGALLNVLNFHRAPIVSVKWNKDGTHIISMDVENVTILWNVISGTVMQHFELKETGG 306

Query: 352 T---------DGVKGI---YFDDQKMITASLDKTIRVWNYITGSCISTYRGHQD--SVLS 397
           +         DG  G+   + DD K +       I V+     +      GH    SVL 
Sbjct: 307 SSINAENHSGDGSLGVDVEWVDDDKFVIPGPKGAIFVYQITEKTPTGKLIGHHGPISVLE 366

Query: 398 VDSYKKIIVSASADKTVKVWH---VESRTCYTLRGHTE------WVNCVKLHPKSFTCYS 448
            +   K+++SAS D T+++WH     S+ C+   GH++      WV       K  +C  
Sbjct: 367 FNDTNKLLLSASDDGTLRIWHGGNGNSQNCF--YGHSQSIVSASWVG----DDKVISC-- 418

Query: 449 SSDDKTLRMWDIRTNSC--------IKVFRGHVGQVQKVIPLTIKDTENLVVDEK 495
            S D ++R+W ++ N+         + +F G + Q  +   +   D +  V D K
Sbjct: 419 -SMDGSVRLWSLKQNTLLALSIVDGVPIFAGRISQDGQKYAVAFMDGQVNVYDLK 472

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKSIKVWDLQNGK 584
           LLS S D T+++W   +G      +GH + +   +   + +++S S D S+++W L+   
Sbjct: 374 LLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSMDGSVRLWSLKQNT 433

Query: 585 CIQTFTGHKAPIVC 598
            +        PI  
Sbjct: 434 LLALSIVDGVPIFA 447

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 563 NFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVG-IGDSSFVS 608
           N  ++S S D ++++W   NG     F GH   IV    +GD   +S
Sbjct: 371 NKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVIS 417

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 67/156 (42%), Gaps = 26/156 (16%)

Query: 326 FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITG- 382
             GS +  +++ + +SG   +    H   V GI  D  ++KM++  LD  +  +++    
Sbjct: 478 LVGSSNGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKST 537

Query: 383 --------SCISTYRGHQDS---VLSVDSYKKIIVSASADKTVK-VWHVESRTCYTLRGH 430
                   S I++   H+ S    L++D    ++V +   K V+ +W           GH
Sbjct: 538 FLGKLKLDSPITSMVYHRSSDLFALALDDLSIVVVDSVTQKVVRQLW-----------GH 586

Query: 431 TEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCI 466
           +  ++     P      SSS D T+R WD+ T  CI
Sbjct: 587 SNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCI 622

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 16/141 (11%)

Query: 462 TNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEE--DFADDCTGIFDPN 519
           +N  I V     GQ +KV  L  K    + +D    K+ +  L+    F D     F   
Sbjct: 482 SNGGISVHNLQSGQKRKVYRLHKKAVTGIAMDGMNRKMVSCGLDGIVGFYDFSKSTFLGK 541

Query: 520 LKY-----------PTHLLSCSLDN-TIKLWEVSSGRCIRTQFGHVEGV--WDIAADNFR 565
           LK             + L + +LD+ +I + +  + + +R  +GH   +  +D + D   
Sbjct: 542 LKLDSPITSMVYHRSSDLFALALDDLSIVVVDSVTQKVVRQLWGHSNRISSFDFSPDGRW 601

Query: 566 IVSGSHDKSIKVWDLQNGKCI 586
           IVS S D +I+ WDL  G CI
Sbjct: 602 IVSSSLDSTIRTWDLPTGGCI 622

>Kwal_55.21144
          Length = 570

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 121/313 (38%), Gaps = 67/313 (21%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDG-VKGIYF--DD 362
           +GH D +L+L    + + + TG  D  + IW T+S   ++ + T    G V  + F  + 
Sbjct: 230 EGHYDEILTLAASPDGKYVITGGRDRKLIIWSTESLAPVKVIPTKDRRGEVLSLVFRKNS 289

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDS--YKKIIVSASADKTVKVWHVE 420
            ++  A  D  IR ++    S +    GHQD V+ + +   ++ +   S D+T  +W + 
Sbjct: 290 DQLYAACADYKIRTYSINQFSQLEILYGHQDLVVGISALGMERCVTVGSRDRTAMLWKIA 349

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480
             T  T RG                      ++ L+ W I+ N+                
Sbjct: 350 DETRLTFRG------------------GDDPERLLKRW-IKQNT---------------- 374

Query: 481 PLTIKDT-ENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWE 539
             T  DT E++  DE       P    + + DC  + D      +H ++ S +  I LW 
Sbjct: 375 --TKSDTGEDITPDES----ERPFFYGEGSIDCVTMID-----DSHFITGSDNGNISLWS 423

Query: 540 VSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTF---TGHKAPI 596
           +S  + + T+     GV    A     +S   D+  +   LQN K  Q +     H  P 
Sbjct: 424 LSKKKPLYTER-TAHGV--APAPTSTQISAEADEQKRNLQLQNQKIAQPYWITALHAIPY 480

Query: 597 VCVGIGDSSFVSG 609
             V      FVSG
Sbjct: 481 SNV------FVSG 487

>Kwal_56.24399
          Length = 369

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 83/208 (39%), Gaps = 35/208 (16%)

Query: 305 IQLFKGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY--- 359
           ++L  GH   VL+ KF  +  L  +   D  + IWD KSG+    + GH           
Sbjct: 69  LELAGGHTRPVLACKFVKSGTLALSAGLDPHLCIWDLKSGH--NHVLGHCHRRSAAITTF 126

Query: 360 --FDDQKMITASLDKTIRVWNYITGSCISTYRGH-----QDSVLSVDSYKKIIVSASADK 412
              DD + +T S D  + + +  TG  +  + GH     Q   L+ D +     S S D 
Sbjct: 127 DTLDDTRAVTGSSDTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTDRF----ASVSDDG 182

Query: 413 TVKVWHVESRT----------CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRT 462
            +K+W   +++           +TL   +   +   L       Y+S  D  +R +D+R 
Sbjct: 183 ALKIWDAHTKSPVWQISSEFPLFTLTSSSSSSDDNIL-------YTSGLDPVIRAYDLRQ 235

Query: 463 NSCIKVFRGHVGQVQKVIPLTIKDTENL 490
           N+  ++F         V  + I  + NL
Sbjct: 236 NNGQELFNWSTPHTDSVTSIHINASRNL 263

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 17/83 (20%)

Query: 520 LKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEG----------VWDIAADNFRIVSG 569
           +K  T  LS  LD  + +W++ SG        HV G           +D   D+ R V+G
Sbjct: 85  VKSGTLALSAGLDPHLCIWDLKSGH------NHVLGHCHRRSAAITTFD-TLDDTRAVTG 137

Query: 570 SHDKSIKVWDLQNGKCIQTFTGH 592
           S D  + + DL  G+ ++ F GH
Sbjct: 138 SSDTRLALVDLHTGRKLRNFAGH 160

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 524 THLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADNF-RIVSGSHDKSIKVWD 579
           T  ++ S D  + L ++ +GR +R   GH   V  + A N  R  S S D ++K+WD
Sbjct: 132 TRAVTGSSDTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTDRFASVSDDGALKIWD 188

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 2/76 (2%)

Query: 387 TYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFT 445
           T+  H D +L +D S    I++ S DK+ K+WH    T      H+++V  V+ HP+   
Sbjct: 258 TFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHSDFVTAVRFHPEDDR 317

Query: 446 CY-SSSDDKTLRMWDI 460
            + S+  D+  R+W I
Sbjct: 318 FFLSACLDQKCRLWSI 333

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 308 FKGHMDGVLSLKFN-HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF---DDQ 363
           F  H D +L + ++ +  + TGS D +  +W       ++    H+D V  + F   DD+
Sbjct: 259 FHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFV-HSDFVTAVRFHPEDDR 317

Query: 364 KMITASLDKTIRVWNYITGSCISTY 388
             ++A LD+  R+W+ +    I  Y
Sbjct: 318 FFLSACLDQKCRLWSILEKQVIFEY 342

>Kwal_47.17465
          Length = 800

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 21/128 (16%)

Query: 311 HMDGVLSLKF--NHRLLFTGSYDSTVAIW---------------DTKSGNLIRRLTGHTD 353
           H   V  ++F  +   L +GS D  + IW               D +  N+ RRL  H +
Sbjct: 21  HTGSVTVVRFSPDGNFLASGSDDRILLIWEKDEDQKQPIFGAENDKEHWNVRRRLVAHDN 80

Query: 354 GVKGIYF--DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVSAS 409
            ++ I +  D   ++T  LD+++ VWN  T   I  +  HQ  V  V  D   K   +AS
Sbjct: 81  DIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKIKRFDVHQSLVKGVIFDPANKYFATAS 140

Query: 410 ADKTVKVW 417
            D+TV+++
Sbjct: 141 DDRTVRIF 148

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 63/153 (41%), Gaps = 26/153 (16%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNY-- 379
           +L T   D +V +W+  +   I+R   H   VKG+ FD  ++   TAS D+T+R++ Y  
Sbjct: 93  ILVTVGLDRSVIVWNGSTFEKIKRFDVHQSLVKGVIFDPANKYFATASDDRTVRIFRYHK 152

Query: 380 ---------------ITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESR-- 422
                            GS I+TY   +    S D  + I    + +  V    + +R  
Sbjct: 153 AGDMSFSIEHVVSEPFKGSPITTY--FRRLSWSPDG-QHIAAPNATNGPVSSVSIIARGS 209

Query: 423 --TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
             T  TL GH      V+ +P+ F       +K
Sbjct: 210 WDTSVTLIGHDSPTEVVRFNPRLFQVLEKKTEK 242

>Kwal_47.17555
          Length = 417

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 22/139 (15%)

Query: 349 TGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK--KIIV 406
           TG   G+  IY D Q  +T +L+                  GH   +  V  +   ++++
Sbjct: 124 TGDQGGIISIY-DSQAEVTRTLE------------------GHYAEITDVKFFPSGEVLL 164

Query: 407 SASADKTVKVWH-VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC 465
           S SAD  +KVW  ++     TL+GHT  V  + +  +     SSS D +L++W+  +   
Sbjct: 165 SGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGET 224

Query: 466 IKVFRGHVGQVQKVIPLTI 484
           I  F     Q   V  + I
Sbjct: 225 IHSFARKTDQSDPVNDMLI 243

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 54/166 (32%), Gaps = 47/166 (28%)

Query: 383 SCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPK 442
           +CI  Y    D + +      II          ++  ++    TL GH   +  VK  P 
Sbjct: 109 TCIDQYESDGDYLYATGDQGGII---------SIYDSQAEVTRTLEGHYAEITDVKFFPS 159

Query: 443 SFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNP 502
                S S D  L++W     S  +  +GH   V  +                       
Sbjct: 160 GEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTAL----------------------- 196

Query: 503 ELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRT 548
                      GI D       +++S S D ++KLWE  SG  I +
Sbjct: 197 -----------GIIDRG----RNVMSSSKDGSLKLWECGSGETIHS 227

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAA-DNFR-IVSGSHDKSIKVWDLQNG 583
           LLS S D  +K+W    G   RT  GH   V  +   D  R ++S S D S+K+W+  +G
Sbjct: 163 LLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSG 222

Query: 584 KCIQTFT 590
           + I +F 
Sbjct: 223 ETIHSFA 229

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 2/65 (3%)

Query: 541 SSGRCIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVC 598
           S     RT  GH   + D+        ++SGS D  +KVW   +G   +T  GH + +  
Sbjct: 136 SQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTA 195

Query: 599 VGIGD 603
           +GI D
Sbjct: 196 LGIID 200

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/290 (20%), Positives = 111/290 (38%), Gaps = 57/290 (19%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITG 382
           L TG  +  + +W  + G L      H   V  I +  D   ++T+ +D    VWN +TG
Sbjct: 222 LITGVENGELRMWSFR-GILQNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTG 280

Query: 383 SCISTY-----RGHQDSVLSVD--SYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVN 435
           + +  +      G++   + V+     K ++       +     ES+    L GHT+ + 
Sbjct: 281 TALQHFDLKDTTGNESLGIDVEWIETDKFVIPGLQGSILVFSIGESKPIGKLVGHTKTLT 340

Query: 436 CVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEK 495
            +  +  +    S+SDDKTLR W     +    F GH   +                   
Sbjct: 341 VLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYA---------------- 384

Query: 496 IEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEG 555
                      D+ DD              L+S S+D ++++W V     +      V+G
Sbjct: 385 -----------DWLDD------------DRLISTSMDGSVRVWSVKQNALVGLSV--VDG 419

Query: 556 V----WDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           V      +++D  +  +G+ D  + V++++  K ++     + PI  V I
Sbjct: 420 VPIFCGTLSSDKQKFATGTLDGEVSVYNVK--KLLEVLDADEKPIGPVRI 467

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 9/118 (7%)

Query: 310 GHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVK-GIYFDDQKMI 366
           GH   +  L +N  ++LL + S D T+  W   + N      GHT  +    + DD ++I
Sbjct: 334 GHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADWLDDDRLI 393

Query: 367 TASLDKTIRVW----NYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           + S+D ++RVW    N + G  +S   G      ++ S K+   + + D  V V++V+
Sbjct: 394 STSMDGSVRVWSVKQNALVG--LSVVDGVPIFCGTLSSDKQKFATGTLDGEVSVYNVK 449

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 67/174 (38%), Gaps = 13/174 (7%)

Query: 434 VNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV------IPLTIKDT 487
           V C+   P   +  +  ++  LRMW  R      VF  H   V  +        +   D 
Sbjct: 210 VTCLSWSPSGESLITGVENGELRMWSFR-GILQNVFNFHRSPVVSIEWNADSTHVLTSDV 268

Query: 488 ENLVVDEKI---EKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGR 544
           +N+ +         + + +L++   ++  GI D         +   L  +I ++ +   +
Sbjct: 269 DNITIVWNALTGTALQHFDLKDTTGNESLGI-DVEWIETDKFVIPGLQGSILVFSIGESK 327

Query: 545 CIRTQFGHVEGVWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPI 596
            I    GH + +  +   +DN  ++S S DK+++ W   N      F GH   I
Sbjct: 328 PIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSI 381

>KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1
           Kluyveromyces lactis heterotrimeric G protein beta
           subunit, start by similarity
          Length = 436

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/267 (20%), Positives = 106/267 (39%), Gaps = 32/267 (11%)

Query: 343 NLIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-- 399
           N+I    GHT  +    F D++ ++TAS D T  +W+      ++ +  H   VL++D  
Sbjct: 166 NVISIFKGHTCYISATEFLDERTILTASGDMTCAMWDIPKSKRVTEFIDHLGDVLTMDLP 225

Query: 400 -----SYKKIIVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
                 Y    ++  +D    +W V +  +  +       V+ +K      +  + SDD 
Sbjct: 226 PANTGRYGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFNNGESFMAGSDDG 285

Query: 454 TLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLV-VDEKIEK-------------- 498
           + R++D+R++  I  +    G +Q+                 +I+K              
Sbjct: 286 SARLFDLRSDCQISTYSFSDGLLQQHQLQQQHHPHPHSHAYSRIQKNRYGSSSSSTSSYP 345

Query: 499 -VPNPELEEDFADDCT---GIFDPNLKYPTHLL-SCSLDNTIKLWEVSSGRCIRTQFGHV 553
            V  P+   +F + C    G+   +      L+ +C  D    +W++  G  I    GH 
Sbjct: 346 IVKTPQ-SLNFKESCIEDQGVISIDFSSSGRLMYACYADYGCAVWDIIKGEMIGKVDGHR 404

Query: 554 EGVWDI--AADNFRIVSGSHDKSIKVW 578
             +  +  + D   +VS S D ++KVW
Sbjct: 405 NRINAVKTSPDGMAVVSSSWDMTLKVW 431

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 4/68 (5%)

Query: 314 GVLSLKFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITAS 369
           GV+S+ F+   RL++    D   A+WD   G +I ++ GH + +  +    D   ++++S
Sbjct: 364 GVISIDFSSSGRLMYACYADYGCAVWDIIKGEMIGKVDGHRNRINAVKTSPDGMAVVSSS 423

Query: 370 LDKTIRVW 377
            D T++VW
Sbjct: 424 WDMTLKVW 431

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 83/211 (39%), Gaps = 29/211 (13%)

Query: 426 TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTN---SCIKVFRGHVGQVQKVIPL 482
           TL+GH   ++ VK    S +  SSS D  + +WD  T    S I +        Q V+  
Sbjct: 81  TLKGHNNKISDVKWSQDSASVLSSSQDGFIIIWDPFTGLKKSAIPLLS------QWVLSS 134

Query: 483 TIKDTENLVVDEKIE---KVPNPELEEDFADDCTGIFDPNLKYPTH--------LLSCSL 531
            I  + NLV    ++    V     +     +   IF  +  Y +         +L+ S 
Sbjct: 135 AISPSGNLVASAGLDNHCSVYRVSRDNRIQQNVISIFKGHTCYISATEFLDERTILTASG 194

Query: 532 DNTIKLWEVSSGRCIRTQFGHVEGV--WDIAADN-----FRIVSGSHDKSIKVWDLQNGK 584
           D T  +W++   + +     H+  V   D+   N        ++G  D    +WD++   
Sbjct: 195 DMTCAMWDIPKSKRVTEFIDHLGDVLTMDLPPANTGRYGHNFITGGSDGYAYLWDVRQPN 254

Query: 585 CIQTFTGHKAPIVCVGIGDS--SFVSGDELG 613
             Q+F    + +  +   ++  SF++G + G
Sbjct: 255 SAQSFFISDSDVSAIKFFNNGESFMAGSDDG 285

>Scas_659.9
          Length = 475

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 127/315 (40%), Gaps = 48/315 (15%)

Query: 306 QLFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI---- 358
           QL  GH DGV  +  N++    L TGS D  V  W+  +   +     H   + G+    
Sbjct: 61  QLGYGHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTP 120

Query: 359 -YFDDQK----MITASLDKTIRVW--------NYITGSCISTYRGHQDSVLS------VD 399
            +   QK    M++ S DKT+++W        N      I+T  G   +  S      +D
Sbjct: 121 EHLSKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGID 180

Query: 400 SYKKIIVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCYSSS-DDKTLRM 457
            ++      +    +++W    S+    L    + ++ VK +       +S+  D +L +
Sbjct: 181 HHRSKSNFVTGGAKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVL 240

Query: 458 WDIRTNSCIKVFRGHVGQVQKVIPLTIKDTE--NLVVDEKIEKVPNPELEED------FA 509
           +D+RTNS  +     + Q  +   +     E  N VV  +       ++         F 
Sbjct: 241 YDLRTNSPTQ----KIVQTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFK 296

Query: 510 DDCTGIFDPNLKYPT--HLLSCSLDNTIKLWEVSSGRCIR----TQFGHVEGVWDIAADN 563
           D  + + D +   PT   +++ S D TI+++  + G         +  HV  V   + D 
Sbjct: 297 DHVSAVMDVDFS-PTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHVFQV-KFSMDA 354

Query: 564 FRIVSGSHDKSIKVW 578
             IVSGS D ++++W
Sbjct: 355 KYIVSGSDDGNVRLW 369

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 25/124 (20%)

Query: 261 NPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKF 320
           NP  + N  VA    N+ YY                + RN    + +FK H+  V+ + F
Sbjct: 264 NPMEAFNFVVANEDHNAYYY----------------DMRNMSRALNVFKDHVSAVMDVDF 307

Query: 321 NHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY-----FDDQKMITASLDKT 373
           +     + TGSYD T+ I++T  G+   R   HT  ++ ++      D + +++ S D  
Sbjct: 308 SPTGDEIVTGSYDKTIRIFNTTHGH--SREIYHTKRMQHVFQVKFSMDAKYIVSGSDDGN 365

Query: 374 IRVW 377
           +R+W
Sbjct: 366 VRLW 369

>Kwal_27.10385
          Length = 536

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 10/124 (8%)

Query: 346 RRLTGHTDGVKGIY-----FDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV-- 398
           R  +  T G   IY      DD  ++T S+D ++R++    G+C++    H   V  V  
Sbjct: 127 RLRSSSTAGSSEIYDLAWSPDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVW 186

Query: 399 DSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMW 458
           D   + I S SAD++V V+ +E     ++ G  +  N  K+      C  S D   L + 
Sbjct: 187 DPQNEFIFSQSADRSVHVYRIEKTPSGSISG-LKLTN--KITRGDLPCRKSKDSTELELD 243

Query: 459 DIRT 462
           ++++
Sbjct: 244 NVKS 247

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 86/192 (44%), Gaps = 32/192 (16%)

Query: 405 IVSASADKTVKVWHV------ESRT-----CYTLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
           +V+A  D  ++VW +      E++        +L  H + VN ++ + ++    ++ DD 
Sbjct: 34  LVTAGGDNKIRVWQLNFEEQNENKVDTIDFLSSLTQHEQAVNVIRFNSRNDVLATAGDDG 93

Query: 454 TLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCT 513
            L +W  R +S  K F     +  +         E+  V +++         E +  D  
Sbjct: 94  QLLLWK-RNDSISKEFGVDEEEFAEF-------KESWYVWKRLRSSSTAGSSEIY--DLA 143

Query: 514 GIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGH---VEG-VWDIAADNFRIVSG 569
              D N     ++++ S+DN+++++EV  G C+     H   V+G VWD    N  I S 
Sbjct: 144 WSPDDN-----YIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWD--PQNEFIFSQ 196

Query: 570 SHDKSIKVWDLQ 581
           S D+S+ V+ ++
Sbjct: 197 SADRSVHVYRIE 208

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK--MITASLDKTIRVW 377
           + TGS D+++ I++ + G  +     H   V+G+ +D Q   + + S D+++ V+
Sbjct: 151 IVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWDPQNEFIFSQSADRSVHVY 205

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 556 VWDIA--ADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           ++D+A   D+  IV+GS D S+++++++ G C+     H
Sbjct: 139 IYDLAWSPDDNYIVTGSMDNSLRIFEVEEGTCVANAADH 177

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 11/135 (8%)

Query: 347 RLTGHTDGVKGIYF-----DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY 401
           +L GH D +K + F      D  + + S D+ IR+W   T   I T     +  L++ S 
Sbjct: 196 KLEGHEDWIKSLVFRETVPGDYLLASGSQDRYIRLWRIRTNEKIDTSE-EDEKKLTLLSN 254

Query: 402 KKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR 461
           K      SAD      HV       + GH +W++ ++ H       +S+ D  + +W+  
Sbjct: 255 KIYKFDISADV-----HVAINFEALIMGHDDWISSLQWHKTKLQLLTSTADTAVMVWEPD 309

Query: 462 TNSCIKVFRGHVGQV 476
           T S I +    +G++
Sbjct: 310 TISGIWICSSRLGEL 324

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 13/98 (13%)

Query: 333 TVAIW---DTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYI------- 380
           T+A+W   DT    + + L GHT  V  + F      M++AS D  +RVWN+        
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHM 93

Query: 381 -TGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW 417
               CI   + H+ ++      K ++V   AD ++ VW
Sbjct: 94  DEVECIQVIKHHKHTITVFAVLKNLLVVGCADGSISVW 131

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 9/77 (11%)

Query: 405 IVSASADKTVKVWHVESRTCY----TLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           +V+  A KT+ +W     + +    TL+GHT  V CV+    +    S+S+D  +R+W+ 
Sbjct: 26  VVAYGAGKTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNF 85

Query: 461 RTNSCIKVFRGHVGQVQ 477
                 K+  GH+ +V+
Sbjct: 86  P-----KLREGHMDEVE 97

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 67/323 (20%), Positives = 134/323 (41%), Gaps = 58/323 (17%)

Query: 306 QLFKGHMDGVLSLKFNH---RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI---- 358
           QL  GH DGV ++  N+     L TGS D  +  W+  +         H   V G+    
Sbjct: 61  QLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQ 120

Query: 359 -YFDDQK--------MITASLDKTIRVW---------------NYITGS--CISTYRGHQ 392
             F D+K        M++ S DKT+++W               + +T     I T+ G +
Sbjct: 121 PRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDG-E 179

Query: 393 DSVLSVDSYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSS- 450
            +   +DS+++    A+    + +W V   +    L    + +  +K +       +S+ 
Sbjct: 180 SAFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTG 239

Query: 451 DDKTLRMWDIRTNS----CIKVFRGHV---GQVQKVIPLTIKDTENLVVDE--KIEKVPN 501
            D ++ ++D+RTNS     ++  R +      ++    +T  +  N    +   + +  N
Sbjct: 240 SDNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLN 299

Query: 502 PELEEDFADDCTGIFDPNLKYPT--HLLSCSLDNTIKLWEVSSGRCIR----TQFGHVEG 555
                 F D  + + D +   PT   +++ S D +I++++ + G         +  HV  
Sbjct: 300 V-----FKDHVSAVMDVDFS-PTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQ 353

Query: 556 VWDIAADNFRIVSGSHDKSIKVW 578
           V   + D+  I+SGS D ++++W
Sbjct: 354 V-KYSMDSKYIISGSDDGNVRLW 375

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 25/124 (20%)

Query: 261 NPGNSPNQTVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKF 320
           NP  + N   A    N+ YY                + RN    + +FK H+  V+ + F
Sbjct: 270 NPMEAFNFVTANEDHNAYYY----------------DMRNLSRSLNVFKDHVSAVMDVDF 313

Query: 321 NHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY-----FDDQKMITASLDKT 373
           +     + TGSYD ++ I+ T  G+   R   HT  ++ ++      D + +I+ S D  
Sbjct: 314 SPTGDEIVTGSYDKSIRIYKTNHGH--SREIYHTKRMQHVFQVKYSMDSKYIISGSDDGN 371

Query: 374 IRVW 377
           +R+W
Sbjct: 372 VRLW 375

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 100/258 (38%), Gaps = 28/258 (10%)

Query: 344 LIRRLTGHTDGVKGIYF-DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD--- 399
           ++    GHT  V  + F +++ ++TAS D T  +W+      +S Y  H   VL++    
Sbjct: 169 IVSIFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPP 228

Query: 400 ----SYKKIIVSASADKTVKVWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKT 454
               SY  +  S  +D  V +W   S  +          ++ V+      +  + SDD  
Sbjct: 229 AGTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGI 288

Query: 455 LRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIE----------KVPNPEL 504
            R++D+R++  +  +       QKV    +K      +   +E            P  E 
Sbjct: 289 ARLFDLRSDCELSSY----SLSQKVQQQQMKLKNRSYLSSTMEYSNSSAAATPYSPAAET 344

Query: 505 EEDFADDCTGIFDPNLKYPTHLL-SCSLDNTIKLWEVSSGRCIRTQFGH---VEGVWDIA 560
                 D  GI   +      LL +C  +    +W+   G  +    GH   + GV   +
Sbjct: 345 IRSSYLDNQGIVSLDFSISGRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISGV-RTS 403

Query: 561 ADNFRIVSGSHDKSIKVW 578
            D   + +GS D ++K+W
Sbjct: 404 PDGMCVCTGSWDSTMKLW 421

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 314 GVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKM--ITAS 369
           G++SL F+   RLL+    +    +WDT  G ++ RL GH+  + G+      M   T S
Sbjct: 354 GIVSLDFSISGRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISGVRTSPDGMCVCTGS 413

Query: 370 LDKTIRVW 377
            D T+++W
Sbjct: 414 WDSTMKLW 421

>CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces
           cerevisiae YMR092c AIP1, hypothetical start
          Length = 610

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 12/123 (9%)

Query: 331 DSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-----DDQKMITASLDKTIRVWNYITGSCI 385
           D  +A +D KSG  ++ +    + + G  F     D+ + +TAS D+ +RVW+     C+
Sbjct: 228 DRKIACFDGKSGEFVKYIEDADEPITGGLFAVSWLDETRFVTASADQKVRVWDVRESKCL 287

Query: 386 STYRGHQDSVLS------VDSYKKIIVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVK 438
            ++   + + L       V +    I+S S D T+    + E +   T+ GH + +  + 
Sbjct: 288 HSWTIGEPNTLQQQQIGVVAAKDDQIISLSLDGTLNFLKIGEDKPVRTMHGHNKSITALA 347

Query: 439 LHP 441
           ++P
Sbjct: 348 VNP 350

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 118/292 (40%), Gaps = 65/292 (22%)

Query: 337 WDTKSGNLIRRLTGHTDGVKGIYFDDQKM---ITASLDKTIRVWNYITGSCISTYRGHQD 393
           WDT  GN +  +T H+  V  ++    +    IT   D T+  +       +S+ R H D
Sbjct: 147 WDT--GNSLGEVTAHSSRVNAVHIKQSRPMRCITVGDDGTVVFYQGPPFKFVSSDRTHHD 204

Query: 394 S---VLSVDSYK---KIIVSASADKTVK---------VWHVESRTCYTLRG--HTEWVNC 436
               V  V+  K   +  V+  +D+ +          V ++E        G     W++ 
Sbjct: 205 KGKFVRDVEFSKGAGEFAVTVGSDRKIACFDGKSGEFVKYIEDADEPITGGLFAVSWLDE 264

Query: 437 VKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKI 496
            +         ++S D+ +R+WD+R + C+  +   +G+     P T++  +  VV  K 
Sbjct: 265 TRF-------VTASADQKVRVWDVRESKCLHSWT--IGE-----PNTLQQQQIGVVAAK- 309

Query: 497 EKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV 556
                        DD              ++S SLD T+   ++   + +RT  GH + +
Sbjct: 310 -------------DD-------------QIISLSLDGTLNFLKIGEDKPVRTMHGHNKSI 343

Query: 557 WDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVS 608
             +A +   +V+GS+D  I  W  +     +  TGH   +V +G  +S + S
Sbjct: 344 TALAVNP--LVTGSYDGRIMQWVPEKICDSKMQTGHTNLVVSIGSKESGYSS 393

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 113/294 (38%), Gaps = 40/294 (13%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK 364
           ++   GH   + +L  N   L TGSYD  +  W  +     +  TGHT+ V  I   +  
Sbjct: 333 VRTMHGHNKSITALAVNP--LVTGSYDGRIMQWVPEKICDSKMQTGHTNLVVSIGSKESG 390

Query: 365 MITASLDKTIRVWNYIT------GSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWH 418
             + + D T+RV N +         C S     + +V++ +    ++ S++ +K V+   
Sbjct: 391 YSSVAWDDTLRVNNEVKYKFESQPKCASMDPAGKIAVVTTEDKLLVLDSSTGEKLVETAL 450

Query: 419 VESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTL-RMWDI--RTNSCIKVFRGH--- 472
               +   L G  + V        + + Y+S D   L ++ D    T SCI +   H   
Sbjct: 451 DVPASAVHLSG--DLVAIGSEQTNTVSVYNSGDLSLLYKLPDPLRATPSCISIAPSHKLL 508

Query: 473 -VGQVQKVIPL------TIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTH 525
            VG V   I L      T+K +       KI  +     EED     TG  D      TH
Sbjct: 509 AVGDVMGKIILYDLETKTVKTSRWAFHTSKINAISWRPEEEDLV--ATGSLD------TH 560

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIA-ADNFRIVSGSHDKSIKVW 578
           ++  S+   +        R ++    H +GV  +   D   IVS   D  I  W
Sbjct: 561 IIVYSVSKPM--------RTVKVLNAHKDGVNAVQWKDRDHIVSAGADACIHTW 606

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 8/93 (8%)

Query: 333 TVAIWDTKSGN---LIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGS---C 384
           T+A+WD    N   +   L GH   V  + F  D   M++AS D  +++W +   S   C
Sbjct: 37  TIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQC 96

Query: 385 ISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW 417
           I T + +  +++++ +   +I    AD T+ +W
Sbjct: 97  IQTIQHYSKTIVALSALPSLISVGCADGTISIW 129

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 380 ITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVW---HVESRTCY-TLRGHTEWVN 435
           IT   I      Q  V  +   KKI V+  A KT+ +W      ++  Y TL+GH   V 
Sbjct: 5   ITPEAIFIGANKQTQVSDIHKVKKI-VAFGAGKTIALWDPIEPNNKGVYATLKGHEAEVT 63

Query: 436 CVKLHPKSFTCYSSSDDKTLRMW 458
           CV+  P S    S+S+D  +++W
Sbjct: 64  CVRFVPDSDFMVSASEDHHVKIW 86

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 72/323 (22%), Positives = 131/323 (40%), Gaps = 66/323 (20%)

Query: 302 RCRIQL-FKGHMDGVLSLKFNHR------LLFTGSYDSTVAIWDTKSGNLI-------RR 347
           +CR+    +GH D V SL F H+      LL +GS D  + +W  +  +LI       ++
Sbjct: 191 KCRVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDDSEEDSKK 250

Query: 348 LTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--II 405
           LT  ++       DD+  +  + +  I               GH D + S+  ++    +
Sbjct: 251 LTLLSNKQYKFQIDDELRVGINFEALI--------------MGHDDWISSLQWHESRLQL 296

Query: 406 VSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR--TN 463
           ++A+AD ++ VW  +  +         WV  ++L   S    S++   +   W     T+
Sbjct: 297 LAATADTSLMVWEPDETSGI-------WVCSLRLGEMSSKGASTATGSSGGFWSCLWFTH 349

Query: 464 SCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYP 523
             +  F  + G+         KD  N++ D+++      +   D A      + P+ +Y 
Sbjct: 350 ERMDFFLTN-GKTGSWRMWATKD--NIICDQRLGISGATKDVTDIA------WSPSGEY- 399

Query: 524 THLLSCSLDNTIKLWEV----SSGR---------CIRTQFGHVEGVWDIAADNFRIVSGS 570
             LL+ SLD T +L+      +SGR           R Q    + +      + R VSG 
Sbjct: 400 --LLATSLDQTTRLFAPWIYDASGRKREIATWHEFSRPQIHGYDMICVETVTDTRFVSGG 457

Query: 571 HDKSIKVWDLQNGKC--IQTFTG 591
            +K ++ +DL  G    +Q F G
Sbjct: 458 DEKILRSFDLPKGVAGMLQKFVG 480

>Scas_465.4
          Length = 1002

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 525 HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDIAADN--FRIVSGSHDKSIKVWDL 580
           ++ SCS D +IKLW + +G  + T +GH   +W++   N   +++S S D + +VWD+
Sbjct: 193 YITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 374 IRVWNYITGSCISTYRGHQDSVL--SVDSYKKIIVSASADKTVKVWHVES--RTCYTLRG 429
           + +W+    + +    GH+ S+   ++    + I S S D+++K+W++++    C T  G
Sbjct: 161 VLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELC-TGWG 219

Query: 430 HTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           HT  +  +K         S S+D T R+WDI
Sbjct: 220 HTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 4/96 (4%)

Query: 328 GSYDSTVAIWDTKSGNLIRRLTGHTDGV-KGIYFDDQKMITA-SLDKTIRVWNYITGSCI 385
           G+    V IWD      +  L GH   +      D+ + IT+ S D++I++WN  TG  +
Sbjct: 155 GTVMGGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEEL 214

Query: 386 STYRGHQDSVLSVDSYKK--IIVSASADKTVKVWHV 419
            T  GH   + ++  +     ++S S D T +VW +
Sbjct: 215 CTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 535 IKLWEVSSGRCIRTQFGHVEGV-WDIAADNFR-IVSGSHDKSIKVWDLQNGKCIQTFTGH 592
           + +W++     +    GH   + +   +DN R I S S D+SIK+W+LQ G+ + T  GH
Sbjct: 161 VLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGH 220

Query: 593 KAPI 596
            A I
Sbjct: 221 TARI 224

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 390 GHQDSVLSVDSYK--KIIVSASADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFTC 446
           GH   + S+  +   K+++SAS D  +K+W     T   TL GHT  +    L  +    
Sbjct: 144 GHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNV 203

Query: 447 YSSSDDKTLRMWDIRTNSCIKVF 469
            SSS D ++R+W+  + S ++ F
Sbjct: 204 LSSSKDGSVRLWECGSGSMLRAF 226

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVW--DIAADNFRIVSGSHDKSIKVWDLQNG 583
           LLS S+D  +K+W  + G   RT FGH   +    +      ++S S D S+++W+  +G
Sbjct: 161 LLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRLWECGSG 220

Query: 584 KCIQTF 589
             ++ F
Sbjct: 221 SMLRAF 226

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 310 GHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD--QKM 365
           GH   + SL +  + ++L + S D  + IW    G   R L GHT  + G    +  + +
Sbjct: 144 GHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNV 203

Query: 366 ITASLDKTIRVWNYITGSCISTY 388
           +++S D ++R+W   +GS +  +
Sbjct: 204 LSSSKDGSVRLWECGSGSMLRAF 226

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 534 TIKLWEVSSGRCIRTQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHK 593
           T+   E S  R +    GH+  +    +    ++S S D  +K+W   +G   +T  GH 
Sbjct: 130 TLHNAEFSDCRSLDGHSGHITSLHYFPSGKV-LLSASIDMQLKIWSAADGTNPRTLFGHT 188

Query: 594 APIVCVGI 601
           API   G+
Sbjct: 189 APITGCGL 196

>KLLA0E19613g complement(1733708..1735426) similar to sp|P21304
           Saccharomyces cerevisiae YLR196w PWP1 singleton, start
           by similarity
          Length = 572

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 104/263 (39%), Gaps = 55/263 (20%)

Query: 311 HMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMIT 367
           H D +LSL  N +   +L + S D TV +WD  +    R L                 I 
Sbjct: 287 HTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTATAARSLIN---------------IH 331

Query: 368 ASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTL 427
           ++ + +   W+   GS + T      + LS      + +    D + K W+V S      
Sbjct: 332 SNTNVSASQWHPSNGSVLLTAGYDSRAALS-----DVRIENDNDMS-KYWNVSS------ 379

Query: 428 RGHTEWVNCVKLHPKS-FTCYSSSDDKTLRMWDIRTNSCIK---VFRGHVGQVQKV---- 479
               E + CV+   ++ F C   +D+  +  +DIR  +  K     + H   V  V    
Sbjct: 380 ---GEEIECVRFADENIFIC--GTDNGNVYSFDIRNGAESKPVWTLKAHDAGVSSVEINR 434

Query: 480 -IP---LTIKDTENLV------VDEKIEKVPNPELEEDFA--DDCTGIFDPNLKYPTHLL 527
            IP   LT    E  V      +D K  K P+  L  DF   +  T  F P+++   +++
Sbjct: 435 HIPNMLLTSAMGEKPVKLWKCPLDAKPGKGPSMVLSRDFGVGNVLTTSFAPDIEIAGNMV 494

Query: 528 SCSLDNTIKLWEVSSGRCIRTQF 550
              +   +KLW+V + R +R  F
Sbjct: 495 VGGVSPGLKLWDVFTNRSVRKSF 517

>Scas_702.16
          Length = 816

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 97/249 (38%), Gaps = 63/249 (25%)

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVE 420
           D +++ T  LD  IR+W                   SVDS K+I+   S    V +    
Sbjct: 28  DGKRVATGGLDGKIRIW-------------------SVDSIKQIVKILSLKDEVPIDKEL 68

Query: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVI 480
            +   ++  HT  V C+K  P      S SDD+ L +W +     I+   G  G+ +K  
Sbjct: 69  KKPLASMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFG--GESEK-- 124

Query: 481 PLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKYPTHLLSCSLDNTIKLWEV 540
                  E   V +++    N     D  D C   + P+    + L+S  LD  + +W  
Sbjct: 125 -------ERWAVRKRLVAHDN-----DIQDIC---WAPD---SSLLVSVGLDRAVIIWNG 166

Query: 541 SSGRCIR---TQFGHVEGVWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIV 597
            +   ++       HV+GV    A+ +   + S D+++K+           F  HK    
Sbjct: 167 ITFEKLKRFDVHQSHVKGVIFDPANKY-FATASDDRTMKI-----------FRYHK---- 210

Query: 598 CVGIGDSSF 606
              IGD+SF
Sbjct: 211 ---IGDASF 216

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 324 LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNY 379
           LL +   D  V IW+  +   ++R   H   VKG+ FD  ++   TAS D+T++++ Y
Sbjct: 151 LLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIFDPANKYFATASDDRTMKIFRY 208

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 14/126 (11%)

Query: 264 NSPNQTVAARARNSRYYTRP-----WKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSL 318
           NSP Q V  R R +     P     + +   +      + RN    + +FK H+  V+ +
Sbjct: 249 NSPTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDV 308

Query: 319 KFNH--RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIY-----FDDQKMITASLD 371
            F+     + TGSYD T+ I++ K G+   R   HT  ++ ++      D + +++ S D
Sbjct: 309 DFSPTGEEIVTGSYDKTIRIFNLKHGH--SREVYHTKRMQHVFQVKFTMDSKYIVSGSDD 366

Query: 372 KTIRVW 377
             +R+W
Sbjct: 367 GNVRLW 372

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 67/319 (21%), Positives = 128/319 (40%), Gaps = 53/319 (16%)

Query: 306 QLFKGHMDGVLSLKFNHRLL---FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           QL  GH DG   L  N+ +L    +GS D  V  W+  +   +     H   V G+    
Sbjct: 61  QLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTP 120

Query: 361 -------DDQKMITASLDKTIRVWNYIT------------------GSCISTYRGHQDSV 395
                   D  M++   DKTI++W+  +                  G+ + T+ G + + 
Sbjct: 121 THLSPTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYG-EHAF 179

Query: 396 LSVDSYKKIIVSASADKTVKVWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCYSSS-DDK 453
            S+D +++     +    +++W V  +   + L    + V+ V+ +       +S+  D 
Sbjct: 180 QSIDHHRRNPNFVTGGAQIQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDN 239

Query: 454 TLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTE--NLVVDEKIEKVPNPELE------ 505
           ++ ++D+RTNS  +     V Q  +   L     E  N  +  +       ++       
Sbjct: 240 SIVLYDLRTNSPTQ----KVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRAL 295

Query: 506 EDFADDCTGIFDPNLKYPT--HLLSCSLDNTIKLWEVSSGRCIRT----QFGHVEGVWDI 559
             F D  + + D +   PT   +++ S D TI+++ +  G         +  HV  V   
Sbjct: 296 HVFKDHVSAVMDVDFS-PTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQHVFQV-KF 353

Query: 560 AADNFRIVSGSHDKSIKVW 578
             D+  IVSGS D ++++W
Sbjct: 354 TMDSKYIVSGSDDGNVRLW 372

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 9/78 (11%)

Query: 351 HTDGVKGIYFDD--QKMITASLDKTIRVWNYITGSCISTYRGHQ-----DSVLSVDSYKK 403
           H   V  + F    ++++T S DKTIR++N   G     Y   +         ++DS  K
Sbjct: 301 HVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQHVFQVKFTMDS--K 358

Query: 404 IIVSASADKTVKVWHVES 421
            IVS S D  V++W  ++
Sbjct: 359 YIVSGSDDGNVRLWRAKA 376

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 74/166 (44%), Gaps = 18/166 (10%)

Query: 272 ARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKF--NHRLLFTGS 329
           AR +  +Y     K I   +F+ E+          + +GH D +L++    + + + +G 
Sbjct: 202 ARPKKVKYVKGGRKYIPEGKFEYEN----------VTEGHYDEILTVAASPDGKYVVSGG 251

Query: 330 YDSTVAIWDTKSGNLIRRL-TGHTDG-VKGIYF--DDQKMITASLDKTIRVWNYITGSCI 385
            D  + +W T+S   ++ + T    G V G+ F  +  ++  A  D  IR +     S +
Sbjct: 252 RDRKLIVWSTESLAPVKIIPTKDRRGEVLGLAFKKNSDQLFAACADYKIRTYAINQFSQL 311

Query: 386 STYRGHQDSVLSVDS--YKKIIVSASADKTVKVWHVESRTCYTLRG 429
               GHQD V+ + +   ++ +   S D+T  +W +   +  T RG
Sbjct: 312 EILYGHQDLVIDISALNMERCVTVGSRDRTAMLWKIADESRLTFRG 357

>Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement
          Length = 569

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 89/225 (39%), Gaps = 43/225 (19%)

Query: 418 HVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQ 477
           ++E    +    HT  VN ++L+ K     S   DK +  WD+ T  C+  F+G V Q+ 
Sbjct: 263 YMEGSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKGSVAQLS 322

Query: 478 KVI--PL-TIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFDPNLKY------------ 522
            +   PL +  D ++LV  E  +K    + ++D  D   G  D   K             
Sbjct: 323 SLEFRPLFSTVDIDSLVEKEPFQKQEQIQQKDDDMDSLFGDEDEEEKRMDLDTQSDDRNR 382

Query: 523 -------------------PTHLLSCSLDNTIKLWE--VSSGRCIRTQFGHVEGVWDIAA 561
                               +  L+ S++ +I +W+    +   +  Q G     W ++A
Sbjct: 383 QEKQSMQEISKNTLKTSCDESIFLTSSINGSIHVWDRRTPAKPVVGLQRGPQVPPWCMSA 442

Query: 562 ----DNFRIVSGSHDKSIKVWDLQNG-KCIQT--FTGHKAPIVCV 599
               D  RI +G  +  ++ +DL+ G K  +T  F     P+ CV
Sbjct: 443 CWSMDGDRIYAGRRNAVVEEFDLKMGVKPSKTLKFPSISGPVSCV 487

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 342 GNLIRRLTGHTDGVKGIYFDDQ--KMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD 399
           G++    + HT  V  +  +D+  K I+   DK I  W+  TG C++ ++G    + S++
Sbjct: 266 GSISHYFSKHTSVVNQLRLNDKEDKFISGGWDKQILEWDLNTGDCVNEFKGSVAQLSSLE 325

Query: 400 SYKKIIVSASADKTVK 415
            ++ +  +   D  V+
Sbjct: 326 -FRPLFSTVDIDSLVE 340

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 345 IRRLTGHTDGVKGIYFD--DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYK 402
           + RL GHT  +  + F+  ++ +++AS D TI+VW     S  + +  H  ++ S     
Sbjct: 333 LGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHWIN 392

Query: 403 -KIIVSASADKTVKVWHV 419
             +I+S + D TVKVW +
Sbjct: 393 DDLIISTAYDGTVKVWSI 410

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 69/165 (41%), Gaps = 12/165 (7%)

Query: 323 RLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYI 380
            L+ TG+    + +W+ K G L   L  H   +  + +  D   ++T  +   + +W+ +
Sbjct: 222 ELVLTGTTSGELRLWN-KQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTL 280

Query: 381 TGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYT---------LRGHT 431
           TG+ +  +   +  + + DS    +     DK V      S   YT         L GHT
Sbjct: 281 TGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHT 340

Query: 432 EWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQV 476
             +  ++ +  + +  S+SDD T+++W    +S    F  H   +
Sbjct: 341 STITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTI 385

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 310 GHMDGVLSLKFN--HRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKMI 366
           GH   + +L+FN  ++ L + S D+T+ +W   + +     T HT  +    + +D  +I
Sbjct: 338 GHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHWINDDLII 397

Query: 367 TASLDKTIRVWNYITGSCIS 386
           + + D T++VW+    S ++
Sbjct: 398 STAYDGTVKVWSISKNSIVA 417

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 7/75 (9%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFGHVEGV----WDIAADNFRIVSGSHDKSIKVWDLQ 581
           LLS S DNTIK+W   +         H + +    W    ++  I+S ++D ++KVW + 
Sbjct: 355 LLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHW---INDDLIISTAYDGTVKVWSIS 411

Query: 582 NGKCIQTFTGHKAPI 596
               +   +    PI
Sbjct: 412 KNSIVAEASLDSEPI 426

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 12/140 (8%)

Query: 343 NLIRRLTGHTDGVKGIYFDDQK------MITASLDKTIRVWNYITGSCISTYRGHQDSVL 396
           NL   L GH D VK I F  Q+      + + S D+ IR+W   T   I       ++ L
Sbjct: 195 NLAAELEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLIDDSE-DDETKL 253

Query: 397 SVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLR 456
           ++ S K+     S D  + + + E+     + GH +WV+ ++ H       +S+ D  + 
Sbjct: 254 TLLSSKQHKFHISEDLRIGI-NFEA----LIIGHDDWVSSLQWHESKLQLLASTADTAVM 308

Query: 457 MWDIRTNSCIKVFRGHVGQV 476
           +W+   +S + V    +G++
Sbjct: 309 IWEPDESSGVWVCSSRLGEM 328

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 400 SYKKI--IVSASADKTVKVWH---VESRTCY-TLRGHTEWVNCVKLHPKSFTCYSSSDDK 453
           SY K   +++  A K + +W+    + R  Y TL+GH   V CVK  P +    S+S+D 
Sbjct: 21  SYNKARNVLAFGAGKNIALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDH 80

Query: 454 TLRMWDIRT 462
            +++W  + 
Sbjct: 81  HVKLWKYKA 89

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query: 334 VAIW---DTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIRVWNYITGS----- 383
           +A+W   D     +   L GH   V  + F      +++AS D  +++W Y         
Sbjct: 37  IALWNPLDADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEELE 96

Query: 384 CISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESR 422
           CI T   +  +++S+++   +IV  SA   V +W  E+ 
Sbjct: 97  CIQTITHYSHTIVSIETLAGLIVIGSAGGLVSIWVPETE 135

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 15/118 (12%)

Query: 308 FKGHMDGVLSLKFNHR------LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD 361
            +GH D V S++F H+      LL +GS D  + IW  ++ +LI       D    +   
Sbjct: 200 LEGHEDWVKSIQFRHQETPGDYLLCSGSQDRYIRIWRIRTNDLI---DDSEDDETKLTLL 256

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSY--KKIIVSASADKTVKVW 417
             K     + + +R+        I    GH D V S+  +  K  +++++AD  V +W
Sbjct: 257 SSKQHKFHISEDLRIGINFEALII----GHDDWVSSLQWHESKLQLLASTADTAVMIW 310

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/320 (19%), Positives = 127/320 (39%), Gaps = 55/320 (17%)

Query: 306 QLFKGHMDGVLSLKFNHRLL---FTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           Q+  GH DGV  L  ++  L    +GS D  +  WD  S   I     H   + G+    
Sbjct: 61  QMGHGHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITP 120

Query: 361 ----------DDQKMITASLDKTIRVWNY---------------ITGSCISTYRGHQDSV 395
                     +   ++++S DKT+++W+                     I  Y G + + 
Sbjct: 121 KVNIDSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYG-EHAF 179

Query: 396 LSVDSYKKIIVSASADKTVKVWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCY-SSSDDK 453
             +D  +      +    + +W +  S+    L    + +N VK +        S+  D 
Sbjct: 180 QGLDHSRMTSNFVTGGPRINLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDN 239

Query: 454 TLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTE--NLVVDEKIEKVPNPELEED---- 507
           ++ ++D+RTNS  +     + Q  +V  +     E  N VV  +       ++       
Sbjct: 240 SIVLYDLRTNSATQ----KIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRAL 295

Query: 508 --FADDCTGIFDPNLKYPT--HLLSCSLDNTIKLWEVSSGRCIRTQFGHVEGVWDI---- 559
             F D  + + D ++  PT   +++ S D TI+++ ++ G     +  H + +  +    
Sbjct: 296 NVFKDHVSAVMDVDIS-PTGEEVVTASYDKTIRIFPINKGHS--REIYHTKRMQHVFQAK 352

Query: 560 -AADNFRIVSGSHDKSIKVW 578
            + D+  ++SGS D ++++W
Sbjct: 353 FSMDSKYVMSGSDDGNVRLW 372

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 551 GHVEGVWDIAA---DNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGI 601
           GH +GV+ +A    D  +I SGS D  IK WD+ + + I +F  H   I  + I
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCI 118

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 14/107 (13%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDD-----QKMITASLDKTIRVWNY 379
               S D     +D +  N+ R L    D V  +   D     ++++TAS DKTIR++  
Sbjct: 274 FVVASEDHNAYYYDMR--NMSRALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPI 331

Query: 380 ITGSCISTYRGHQ-----DSVLSVDSYKKIIVSASADKTVKVWHVES 421
             G     Y   +      +  S+DS  K ++S S D  V++W  ++
Sbjct: 332 NKGHSREIYHTKRMQHVFQAKFSMDS--KYVMSGSDDGNVRLWRAKA 376

>CAGL0D04884g 475678..477369 highly similar to tr|Q06506
           Saccharomyces cerevisiae YPR137w RRP9, start by
           similarity
          Length = 563

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 60/131 (45%), Gaps = 12/131 (9%)

Query: 309 KGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF------ 360
           +GH D +L++  + +  ++ TG  D  + +W T+S   I+ +   T   KG         
Sbjct: 224 EGHYDEILTVAASPKGDVVVTGGRDRKLIVWSTESLAPIKVIP--TKDRKGQILSLTFRR 281

Query: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSV--LSVDSYKKIIVSASADKTVKVWH 418
           +  ++  A  D  IR ++    + + T  GH D V  +S  S ++ +   S D+T  +W 
Sbjct: 282 NSDQLYVACADYKIRTYSISQFAQLETLYGHHDIVADISALSMERCVTVGSRDRTAMLWK 341

Query: 419 VESRTCYTLRG 429
           +   T  T RG
Sbjct: 342 IPDETRLTFRG 352

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 66/133 (49%), Gaps = 12/133 (9%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF------DDQKMITASLDKTIRVWN 378
           + +G  D+TV ++D  SG   +++  H D VK + F      + + ++T S DKTI+ W+
Sbjct: 94  IASGGCDNTVKLYDVASGQS-QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWD 152

Query: 379 YITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVK 438
                 I+T     + V ++D+ ++++V  +A++ + + ++ + T       +     +K
Sbjct: 153 TRQPQPITTI-AMPERVYTMDNKQQLLVVGTAERHIAIINLANPTTIFKSSQSP----LK 207

Query: 439 LHPKSFTCYSSSD 451
              +   CY+  D
Sbjct: 208 WQTRVVACYNEGD 220

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 63/157 (40%), Gaps = 16/157 (10%)

Query: 318 LKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQK---MITASLDKTI 374
           + F  R    G+  STV   +    N I       D +  I F  Q       +S D  +
Sbjct: 1   MSFFQRNSAAGNTTSTVMATEKDLQNEIVINNPADDSISDIAFSPQHDFLFSVSSWDGKV 60

Query: 375 RVWNYITG--SCISTYRGHQDSVL----SVDSYKKIIVSASADKTVKVWHVESRTCYTLR 428
           R+W+   G     + Y  H   VL    S+D  +  I S   D TVK++ V S     + 
Sbjct: 61  RIWDAQNGVPQGKAQYE-HNGPVLCTRWSLDGAR--IASGGCDNTVKLYDVASGQSQQIG 117

Query: 429 GHTEWVNCVKL---HPKSFTCY-SSSDDKTLRMWDIR 461
            H + V  ++     P +  C  + S DKT++ WD R
Sbjct: 118 SHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTR 154

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 9/72 (12%)

Query: 526 LLSCSLDNTIKLWEVSSGRCIRTQFG-HVEGVWDI------AADNFRIVSGSHDKSIKVW 578
           + S   DNT+KL++V+SG+    Q G H + V  +        +   +V+GS DK+IK W
Sbjct: 94  IASGGCDNTVKLYDVASGQS--QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFW 151

Query: 579 DLQNGKCIQTFT 590
           D +  + I T  
Sbjct: 152 DTRQPQPITTIA 163

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 306 QLFKGHMDGVLSLKF------NHRLLFTGSYDSTVAIWDTK 340
           Q    H D V SL+F      N   L TGS+D T+  WDT+
Sbjct: 114 QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTR 154

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 50/112 (44%), Gaps = 11/112 (9%)

Query: 316 LSLKFNHRLLFT-GSYDSTVAIWDTKSGNLIRRLTGHTDG---VKGIYFDDQKMITASLD 371
           ++    H  LF+  S+D  V IWD ++G    +     +G         D  ++ +   D
Sbjct: 41  IAFSPQHDFLFSVSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASGGCD 100

Query: 372 KTIRVWNYITGSCISTYRGHQDSVLSV------DSYKKIIVSASADKTVKVW 417
            T+++++  +G        H D+V S+       +  + +V+ S DKT+K W
Sbjct: 101 NTVKLYDVASGQS-QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFW 151

>Scas_718.6*
          Length = 546

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFD--DQKMITAS-LDKTIRVWNYIT 381
           L     + ++ ++       I +L GH   +  I F+   + ++T+S  D +IR+W+   
Sbjct: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401

Query: 382 GSCISTYRGHQDSVLSVDSYK-KIIVSASADKTVKVWHV 419
            +C + + GH  S++S+      +++SAS D +V++W V
Sbjct: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 310 GHMDGVLSLKFN--HRLLFTGS-YDSTVAIWDTKSGNLIRRLTGHTDGVKGI-YFDDQKM 365
           GH   +  ++FN   RLL T S  D ++ IW  +  N      GH+  +  + + +D  +
Sbjct: 367 GHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLV 426

Query: 366 ITASLDKTIRVWNYI 380
           I+AS+D ++R+W+ +
Sbjct: 427 ISASMDGSVRIWSVV 441

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 61/129 (47%), Gaps = 8/129 (6%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDG-VKGIYF--DD 362
           +GH D +L++    + + + TG  D  + +W T+S + ++ + T    G V  + F  + 
Sbjct: 235 EGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKNS 294

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD--SYKKIIVSASADKTVKVWHVE 420
            ++  +  D  +R +     S +    GHQD V+ +   S ++ +   S D+T  +W + 
Sbjct: 295 DQLFASCADYKVRTYAINQFSQLEVLYGHQDLVVDISALSMERCVTVGSRDRTAMLWKIA 354

Query: 421 SRTCYTLRG 429
             T  T RG
Sbjct: 355 DETRLTFRG 363

>Kwal_56.24661
          Length = 561

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 100/258 (38%), Gaps = 48/258 (18%)

Query: 311 HMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMIT 367
           H D VLSL  + +   +L + S D TV +WD  +G   R                   I 
Sbjct: 274 HTDAVLSLSHSKQFRAVLASTSADHTVKLWDLNAGIAARSFAS---------------IH 318

Query: 368 ASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTL 427
           ++ + +   W+  +GS + T  G  DS +++   +     A   +  K W V S      
Sbjct: 319 SNKNVSSSQWHSTSGSVLLT--GGYDSRIALTDVRI----ADDSQMSKYWSVMS------ 366

Query: 428 RGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIK---VFRGHVGQVQ--KVIPL 482
               E V CV+   ++ T    +D   +  +DIR     K       H   +    V P 
Sbjct: 367 ---GEEVECVQFADEN-TIMCGTDSGNVYSYDIRQGEGSKPLWTLNAHDAGISTLNVNPF 422

Query: 483 TIKDTENLVVDEKIEKV-------PNPELEEDFA--DDCTGIFDPNLKYPTHLLSCSLDN 533
                    + EK  K+       P+  L  DF   +  +  F P+L+   +++   ++ 
Sbjct: 423 IPNLLATGAMGEKTVKLWKCSESGPSMVLSRDFGVGNVLSTSFAPDLEVAGNIIIGGVNK 482

Query: 534 TIKLWEVSSGRCIRTQFG 551
            +KLW+V + R IR  FG
Sbjct: 483 GLKLWDVFTNRSIRKNFG 500

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 17/162 (10%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKM-ITAS----L 370
           LS K +   L +G  D+T+ IWDT++         H+  VK + +      + AS     
Sbjct: 383 LSYKADGLQLASGGNDNTMMIWDTRTSMPQFVKKDHSAAVKALAWSPTNAGLLASGGGQT 442

Query: 371 DKTIRVWNYITGSCISTYR-GHQDSVL----SVDS-----YKKIIVSASADKTVKVWHVE 420
           D+ I  WN  TG+ + T   G Q S L    S D+      + +    S D ++ +++ E
Sbjct: 443 DQQIHFWNSTTGAKLHTINTGSQVSSLHWGQSYDTKGNMNVEIVATGGSPDNSISIYNYE 502

Query: 421 SR--TCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           +R      +  H   + C KL P      +   D+ L+ + I
Sbjct: 503 TRYKVAEVVHAHDARICCSKLSPDGTVLATIGGDENLKFYKI 544

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 77/174 (44%), Gaps = 18/174 (10%)

Query: 305 IQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-- 360
           +  ++ H   V  +KF      L +G  D+TV IWDT+    +     H   VK I +  
Sbjct: 340 VSTWEKHTSEVCGIKFRQDGLQLASGGNDNTVMIWDTRQDEPLWVKRNHNAAVKAITWHP 399

Query: 361 DDQKMIT---ASLDKTIRVWNYITGSCI-STYRGHQDSVLS-----VDSY--KKIIVS-A 408
           D   ++     SLD+ I  WN  TG+ I S   G Q S L       DS+  ++I+ +  
Sbjct: 400 DVVNLLATGGGSLDRHIHFWNTTTGARIGSINTGSQVSSLHWGQSYEDSHMNREIVATGG 459

Query: 409 SADKTVKVWHVES--RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
           S D ++ +++ +S  +     + H   +   +L P   T  +   D+ L+ + +
Sbjct: 460 SPDNSISIYNYDSKVKVAEITQAHESRIVSSQLSPDGTTIATVGGDENLKFYRV 513

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/167 (19%), Positives = 66/167 (39%), Gaps = 5/167 (2%)

Query: 318 LKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--DDQKMITASLDKTIR 375
           L ++ + +   + D ++ +W+ ++G +       T+ +  + +  DD  +     D    
Sbjct: 229 LSWSKKNVLAIALDQSIYLWNGETGEVSLLTEFETETITSVVWSNDDCHISIGKDDGNTE 288

Query: 376 VWNYITGSCISTYRGHQDSVLSVDSYKKIIV---SASADKTVKVWHVESRTCYTLRGHTE 432
           +W+  T S + T R      +    +   +V   + S +  V    V+     T   HT 
Sbjct: 289 IWDVETMSHVRTMRSSLGVRICSQDWLDTVVCIGAKSGEIQVNDVRVKDHIVSTWEKHTS 348

Query: 433 WVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSCIKVFRGHVGQVQKV 479
            V  +K         S  +D T+ +WD R +  + V R H   V+ +
Sbjct: 349 EVCGIKFRQDGLQLASGGNDNTVMIWDTRQDEPLWVKRNHNAAVKAI 395

>Scas_652.16
          Length = 345

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 40/84 (47%), Gaps = 20/84 (23%)

Query: 349 TGHTDGVKGIYFD-----------DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLS 397
           +GH D +  + +D           DQ +    LDK    W         +++ H  S++S
Sbjct: 9   SGHEDLIHDVVYDFYGRHVATCSSDQHIKVFKLDKETSEWE-----LSDSWKAHDSSIVS 63

Query: 398 VD----SYKKIIVSASADKTVKVW 417
           VD     Y +IIVSAS DKTVK+W
Sbjct: 64  VDWASPEYGRIIVSASYDKTVKLW 87

>KLLA0F10791g complement(991642..993279) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 545

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 72/177 (40%), Gaps = 21/177 (11%)

Query: 305 IQLFKGHMDGVLSLKFNHR--LLFTGSYDSTVAIWDTKSGN-LIRRLTGHTDGVKGIYFD 361
           +Q ++ H   V  L F      L +G+ D+TV IWDT+  N  I     H   VK I + 
Sbjct: 326 VQTWERHQGEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDPIWTKRNHKAAVKAISWH 385

Query: 362 DQ-----KMITASLDKTIRVWNYITGSCISTY-RGHQDSVLS-VDSYKK---------II 405
            +          SLDK I  WN  TG+ + T   G Q S L    SY K         + 
Sbjct: 386 PEITNLLATGGGSLDKHIHFWNTTTGNRLGTIDTGSQVSSLHWGQSYSKHSGCMDTEIVA 445

Query: 406 VSASADKTVKVWHVES--RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDI 460
              + +  + +++ E+  +     + H   +   +L P   T  S   D+ L+ + +
Sbjct: 446 TGGTPNNCITIYNYETKFKVAEIQQAHDSRIVSSQLSPDGTTIASVGGDENLKFYRV 502

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 69/169 (40%), Gaps = 9/169 (5%)

Query: 318 LKFNHRLLFTGSYDSTVAIWDTKSG--NLIRRLTGHTDGVKGIYFDDQKMIT-ASLDKTI 374
           L ++ + +   + D+++ +WD +SG  NL+  L      +   + DD   I+    D  +
Sbjct: 216 LSWSKKNVLAIALDNSIYLWDGESGDVNLLVELKATCTSL--TWSDDSCHISIGKNDGNV 273

Query: 375 RVWNYITGSCISTYRGHQDSVLSVDSYKKIIV---SASADKTVKVWHVESRTCYTLRGHT 431
            +W+  T + + T R      +   S+   +    S S +  +    +++    T   H 
Sbjct: 274 EIWDAETMTHVRTMRSGLGVRIGSQSWLDTLCVTGSKSGEIQINDVRIKNHVVQTWERHQ 333

Query: 432 EWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNS-CIKVFRGHVGQVQKV 479
             V  +          S ++D T+ +WD R N+  I   R H   V+ +
Sbjct: 334 GEVCGLSFREDGIQLASGANDNTVMIWDTRQNNDPIWTKRNHKAAVKAI 382

>Scas_705.2
          Length = 571

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 61/129 (47%), Gaps = 8/129 (6%)

Query: 309 KGHMDGVLSLKF--NHRLLFTGSYDSTVAIWDTKSGNLIRRL-TGHTDG-VKGIYF--DD 362
           +GH D +L++    + + + TG  D  + +W T+S   I+ + T    G V  + F  + 
Sbjct: 231 EGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLAPIKVIPTKDRRGEVLSLVFRKNS 290

Query: 363 QKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD--SYKKIIVSASADKTVKVWHVE 420
            ++  +  D  IR ++    S + T  GH D V+ +   S ++ +   + D+T  +W + 
Sbjct: 291 DELYASCADYKIRTYSIKQFSQLETLYGHHDIVVDISALSMERCVTVGARDRTAMLWKIP 350

Query: 421 SRTCYTLRG 429
             T  T RG
Sbjct: 351 DETRLTFRG 359

>CAGL0B03575g complement(357525..358784) similar to sp|P39984
           Saccharomyces cerevisiae YEL056w HAT2, hypothetical
           start
          Length = 419

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 110/266 (41%), Gaps = 50/266 (18%)

Query: 299 RNG-RCRIQLFKGHMDGVLSLKFNHR---LLFTGSYDSTVAIWDTKS--GNLIRRLT--- 349
           +NG    +   + H +    L FN      L +GS DS +A+WD  +   N+   +T   
Sbjct: 165 KNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFED 224

Query: 350 GHTDGVKGI-YFDDQKMITASL--DKTIRVWNYITGSC---ISTYRGHQDSVLSVDSYKK 403
            HTD +  + +   +  I  S+  D T+++++  +      I+T + +     S  S   
Sbjct: 225 AHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFS-SN 283

Query: 404 IIVSASADKTVKVWHVE--SRTCYTLRGHTEWVNCVKLHPKS-FTCYSSSDDKTLRMWDI 460
           +  +A  D  V ++ +   S   Y + GH + V  ++  P +    YSS  D+   +WD+
Sbjct: 284 LFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDL 343

Query: 461 RTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDEKIEKVPNPELEEDFADDCTGIFD--- 517
           +           +G  Q                ++IE  P PE+    A   T I D   
Sbjct: 344 Q----------EIGAEQ--------------TQDEIEDGP-PEVLMIHAGHKTSINDIAV 378

Query: 518 -PNLKYPTHLLSCSLDNTIKLWEVSS 542
            PN+ +   + S   DN +++W+ SS
Sbjct: 379 NPNINW--LVASAEEDNIVQIWKCSS 402

>YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anaphase
           promoting complex (APC), required for microtubule
           function at mitosis and for exit from anaphase, contains
           WD (WD-40) repeats [1833 bp, 610 aa]
          Length = 610

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 70/169 (41%), Gaps = 19/169 (11%)

Query: 316 LSLKFNHRLLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF-DDQKMITAS----L 370
           LS K +   L +G  D+TV IWDT++         HT  VK + +      I AS     
Sbjct: 391 LSYKSDGLQLASGGNDNTVMIWDTRTSLPQFSKKTHTAAVKALSWCPYSPNILASGGGQT 450

Query: 371 DKTIRVWNYITGSCI-STYRGHQDSVL-----------SVDSYKKIIVSASADKTVKVWH 418
           DK I  WN ITG+ + S   G Q S L            + + + +    + +  + V++
Sbjct: 451 DKHIHFWNSITGARVGSINTGSQVSSLHWGQSHTSTNGGMMNKEIVATGGNPENAISVYN 510

Query: 419 VES--RTCYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIRTNSC 465
            E+  +    +  H   + C +L P   T  +   D+ L+ + I    C
Sbjct: 511 YETKFKVAEVVHAHEARICCSQLSPDGTTLATVGGDENLKFYKIFDPRC 559

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 12/142 (8%)

Query: 328 GSYDSTVAIWDTKSGNLIRRL-TGHTDGVKGIYFDDQKMITASLDKTIRVWNY-ITGSCI 385
           G  D    IWD ++ +LIR + +G    +  + + D  + T S    I++ +  I    +
Sbjct: 319 GKEDGNTEIWDVETMSLIRTMRSGLGVRIGSLSWLDTLIATGSRSGEIQINDVRIKQHIV 378

Query: 386 STYRGHQDSV--LSVDSYKKIIVSASADKTVKVWHVESRTC---YTLRGHTEWVNCVKLH 440
           ST+  H   V  LS  S    + S   D TV +W  ++RT    ++ + HT  V  +   
Sbjct: 379 STWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIW--DTRTSLPQFSKKTHTAAVKALSWC 436

Query: 441 PKSFTCYSSSD---DKTLRMWD 459
           P S    +S     DK +  W+
Sbjct: 437 PYSPNILASGGGQTDKHIHFWN 458

>Kwal_26.7738
          Length = 611

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 65/150 (43%), Gaps = 22/150 (14%)

Query: 331 DSTVAIWDTKSGNLIRRLTGHTDGVKGIYF---------DDQKMITASLDKTIRVWNYIT 381
           D  +  +D KSG  I+ +    + V+G  F         + +K +TAS D  IR+W+  +
Sbjct: 222 DRKIVCFDGKSGEFIKYVEDPQEPVEGGLFALDWVDEGENSKKFVTASADAAIRLWDVES 281

Query: 382 GSCI------STYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRT-CYTLRGHTEWV 434
           G+C+      +T    Q  V ++   +   VS S D  + ++ V  ++    + GH + +
Sbjct: 282 GACLEKWSLEATLPNQQVGVAAISDTE--FVSVSLDGCLNIFKVGQKSPSRRIEGHNKAI 339

Query: 435 NCVKLHPKSFTCYSSSDDKTLRMWDIRTNS 464
             +   P      S S D  +  W   +NS
Sbjct: 340 TALAAGP----LVSGSYDGRVVKWGEGSNS 365

 Score = 36.2 bits (82), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 50/120 (41%), Gaps = 10/120 (8%)

Query: 321 NHRLLFTGSYDSTVAIWDTKSGNLIRR------LTGHTDGVKGIYFDDQKMITASLDKTI 374
           N +   T S D+ + +WD +SG  + +      L     GV  I   D + ++ SLD  +
Sbjct: 261 NSKKFVTASADAAIRLWDVESGACLEKWSLEATLPNQQVGVAAI--SDTEFVSVSLDGCL 318

Query: 375 RVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWV 434
            ++     S      GH  ++ ++ +    +VS S D  V  W   S +   L  HT  V
Sbjct: 319 NIFKVGQKSPSRRIEGHNKAITALAAGP--LVSGSYDGRVVKWGEGSNSGAVLNFHTNTV 376

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 565 RIVSGSHDKSIKVWDLQNGKCIQTF----TGHKAPIVCVGIGDSSFVS 608
           + V+ S D +I++WD+++G C++ +    T     +    I D+ FVS
Sbjct: 264 KFVTASADAAIRLWDVESGACLEKWSLEATLPNQQVGVAAISDTEFVS 311

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 66/125 (52%), Gaps = 8/125 (6%)

Query: 305 IQLFKGHMDGVLSLKFNHRLLFTGSYDSTVAIWDTKSGN-LIRRLTGHTDGVKGIYF--D 361
           I+   GH+D V  L +N+ +L +GS D T+   D +  +    ++  H   + G+ +  +
Sbjct: 411 IRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFEKIETHEQEICGLKWNTN 470

Query: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSV--DSYKKIIVS---ASADKTVKV 416
           D K+ +   D  + V++  + +   +   H+ +V ++    +K+ I++    +AD+T+K+
Sbjct: 471 DNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKM 530

Query: 417 WHVES 421
           W+V +
Sbjct: 531 WNVNT 535

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 103/266 (38%), Gaps = 48/266 (18%)

Query: 325 LFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNY-ITGS 383
           L  G  +  V I+D      IR L+GH D V  + +++  + + S D+TI   +  +   
Sbjct: 391 LAIGQGNGIVEIY