Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27489g29729315420.0
Scas_715.4729729312771e-179
YER055C (HIS1)29729312441e-174
ADL081C29729311561e-161
CAGL0L00759g30630211011e-152
Kwal_23.577924824410631e-147
YKL001C (MET14)202102860.005
Scas_668.27202102760.090
ABR001W21597740.17
CAGL0L02321g207102633.8
KLLA0B05918g31182634.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27489g
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27489g 2544518..2545411 highly similar to sp|P00498 Saccha...   598   0.0  
Scas_715.47                                                           496   e-179
YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP phosph...   483   e-174
ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH] (540943..54...   449   e-161
CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomy...   428   e-152
Kwal_23.5779                                                          414   e-147
YKL001C (MET14) [3256] chr11 complement(438420..439028) Adenosin...    38   0.005
Scas_668.27                                                            34   0.090
ABR001W [592] [Homologous to ScYKL001C (MET14) - SH] complement(...    33   0.17 
CAGL0L02321g 266781..267404 highly similar to sp|Q02196 Saccharo...    29   3.8  
KLLA0B05918g complement(533071..534006) similar to sp|P05317 Sac...    29   4.8  

>KLLA0F27489g 2544518..2545411 highly similar to sp|P00498
           Saccharomyces cerevisiae YER055c HIS1 ATP
           phosphoribosyltransferase singleton, start by similarity
          Length = 297

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/293 (100%), Positives = 293/293 (100%)

Query: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60
           MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA
Sbjct: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK 120
           DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK 120

Query: 121 TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA 180
           TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA
Sbjct: 121 TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA 180

Query: 181 AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240
           AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL
Sbjct: 181 AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240

Query: 241 LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEIS 293
           LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEIS
Sbjct: 241 LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEIS 293

>Scas_715.47
          Length = 297

 Score =  496 bits (1277), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 236/293 (80%), Positives = 267/293 (91%)

Query: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60
           MDLVNHLND+LLFAIPKKGRLYEKSV+IL GSDIKFHRS RLDIA+ T +P+ALIFLPAA
Sbjct: 1   MDLVNHLNDRLLFAIPKKGRLYEKSVTILNGSDIKFHRSQRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK 120
           DIPMFVGEGRCDLGITGVDQVRE+++DV+LPIDL+FG+CKLQVQVPV G YT PEQLIGK
Sbjct: 61  DIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNGPYTKPEQLIGK 120

Query: 121 TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA 180
           TIVSSF NLT++YFA+LEGVP  +M T+VKYVGGSVEASCALGVADAIVDLVESGETMRA
Sbjct: 121 TIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIVDLVESGETMRA 180

Query: 181 AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240
           AGL  IATVL+TSAH+IESKNP+ D +L+ TIKSRIEGV+TAQ+YV C+YNAPE+KL +L
Sbjct: 181 AGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCNYNAPEDKLSQL 240

Query: 241 LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEIS 293
           L ITPGRR PTIS+I+  GWVAV+SMIER  KG+IMD+LKK GA DIMVFEIS
Sbjct: 241 LTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMVFEIS 293

>YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP
           phosphoribosyltransferase, first step in histidine
           biosynthesis pathway [894 bp, 297 aa]
          Length = 297

 Score =  483 bits (1244), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/293 (79%), Positives = 258/293 (88%)

Query: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60
           MDLVNHL D+LLFAIPKKGRLY KSVSIL G+DI FHRS RLDIA+ST++PVAL+FLPAA
Sbjct: 1   MDLVNHLTDRLLFAIPKKGRLYSKSVSILNGADITFHRSQRLDIALSTSLPVALVFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK 120
           DIP FVGEG+CDLGITGVDQVRES VDV+L IDLQFG CKLQVQVPV GEY  PEQLIGK
Sbjct: 61  DIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNGEYKKPEQLIGK 120

Query: 121 TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA 180
           TIV+SFV L +KYFA LEG    +M TR+K+V GSVEASCALG+ DAIVDLVESGETMRA
Sbjct: 121 TIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIVDLVESGETMRA 180

Query: 181 AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240
           AGL  IATVL TSA+LIESKNPK D  L+ TIKSRIEGVMTAQ++VSC YNAPE+KLPEL
Sbjct: 181 AGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCIYNAPEDKLPEL 240

Query: 241 LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEIS 293
           LK+TPGRRAPTIS+I+D GWVAVSSMIERK KG ++D+LK+ GA DIMVFEIS
Sbjct: 241 LKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMVFEIS 293

>ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH]
           (540943..541836) [894 bp, 297 aa]
          Length = 297

 Score =  449 bits (1156), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/293 (74%), Positives = 247/293 (84%)

Query: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60
           MDLV  LND+LLFA+PKKGRLYEKSV++L G+DI FHRS RLDIA+ST+ PVALIFLPAA
Sbjct: 1   MDLVRQLNDRLLFAVPKKGRLYEKSVALLNGADILFHRSHRLDIALSTSTPVALIFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAGEYTSPEQLIGK 120
           DIP FVGEGRCDLGITGVDQVRES V+V L  DL FG C+LQVQVP  G Y+ PEQLIGK
Sbjct: 61  DIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGPYSQPEQLIGK 120

Query: 121 TIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIVDLVESGETMRA 180
           TIV+SF  L ++YFA+LEGV E+ M TRVKYVGGSVEA+CALGVADAIVDLVESGETMRA
Sbjct: 121 TIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVDLVESGETMRA 180

Query: 181 AGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240
           AGLT I TVL TSAHLI S NPK  + LL T+++RIEGV+ AQ YV C+YNA  + LP L
Sbjct: 181 AGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTYNAHADALPAL 240

Query: 241 LKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFEIS 293
           L+ITPGRRAPTIS+++D  W AVSSMI R+ KG I+DDLK +GAEDIMVFEIS
Sbjct: 241 LRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVFEIS 293

>CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomyces
           cerevisiae YER055c HIS1, start by similarity
          Length = 306

 Score =  428 bits (1101), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 210/302 (69%), Positives = 252/302 (83%), Gaps = 9/302 (2%)

Query: 1   MDLVNHLNDKLLFAIPKKGRLYEKSVSILKGSDIKFHRSARLDIAISTNMPVALIFLPAA 60
           MD VNHLND+LLFA+PKKGRLYEK+  +L GSDIKF+RS RLDIA+ T +P+ALIFLPAA
Sbjct: 1   MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDIALCTTLPIALIFLPAA 60

Query: 61  DIPMFVGEGRCDLGITGVDQVRESEV-DVNLPIDLQFGTCKLQVQVPVAG-EYTSPEQLI 118
           DIP FVGEG+CDLGITG+DQV+ES + +++L +DL FG CKLQVQVP    +YT P+QL+
Sbjct: 61  DIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEKDRKYTDPKQLV 120

Query: 119 GKTIVSSFVNLTKKYFAQLE----GVPESEMVTRVKYVGGSVEASCALGVADAIVDLVES 174
           GKTIVSSFV L++ YF QLE    G P  ++ T++KYVGGSVEASCALGV DAIVDLVES
Sbjct: 121 GKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALGVGDAIVDLVES 180

Query: 175 GETMRAAGLTAIATVLDTSAHLIESKNPKGDV---ELLRTIKSRIEGVMTAQKYVSCSYN 231
           GETMRAAGL  IATVL+TSA+LI+++ P+ D    EL+  IKSRI+GV+TAQ+YV CSYN
Sbjct: 181 GETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVLTAQRYVCCSYN 240

Query: 232 APENKLPELLKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMVFE 291
            PE  L ELLK+TPGRRAPTIS+++D GWVAV+SMIERK K DIMD+LK+ GA DIMVFE
Sbjct: 241 TPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELKRKGASDIMVFE 300

Query: 292 IS 293
           IS
Sbjct: 301 IS 302

>Kwal_23.5779
          Length = 248

 Score =  414 bits (1063), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/244 (81%), Positives = 223/244 (91%)

Query: 50  MPVALIFLPAADIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAG 109
           MP+ALIFLPAADIPMFVGEG+CDLGITGVDQV+ES+VDV LP+DL FG+CKLQVQVP AG
Sbjct: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG 60

Query: 110 EYTSPEQLIGKTIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIV 169
            Y  PEQLIGKTIVSSF NLTK+YFA+LEGVP  ++ T+++YVGGSVEASCALG+ADAIV
Sbjct: 61  PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV 120

Query: 170 DLVESGETMRAAGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCS 229
           DLVESGETMRAAGL  IATVL+TSAHLIESKNPKGD ELL+TIKSRIEGVMTAQKYV+C+
Sbjct: 121 DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN 180

Query: 230 YNAPENKLPELLKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMV 289
           YNAP   L ++LKITPGRRAPTIS+I+D GWVAVS+MI+RK KG IMDDLKKNGA DIMV
Sbjct: 181 YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV 240

Query: 290 FEIS 293
           FEIS
Sbjct: 241 FEIS 244

>YKL001C (MET14) [3256] chr11 complement(438420..439028)
           Adenosine-5'-phosphosulfate 3'-phosphotransferase
           (adenylylsulfate kinase), part of the sulfate
           assimilation pathway [609 bp, 202 aa]
          Length = 202

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 12/102 (11%)

Query: 143 SEMVTRVKYVGGSVEASCALGVADAI----VDLVESGETMRAAGLTAIATVLDTSAHLIE 198
           +E + R+  V      SCA+ +   I    VD   + E  + AGL  I   +D    + E
Sbjct: 79  NENIRRISEVSKLFADSCAISITSFISPYRVDRDRARELHKEAGLKFIEIFVDVPLEVAE 138

Query: 199 SKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240
            ++PKG  +  R      EGV+     +S  Y AP  K PEL
Sbjct: 139 QRDPKGLYKKAR------EGVIKEFTGISAPYEAP--KAPEL 172

>Scas_668.27
          Length = 202

 Score = 33.9 bits (76), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 143 SEMVTRVKYVGGSVEASCALGVADAI----VDLVESGETMRAAGLTAIATVLDTSAHLIE 198
           +E + R+  V      SC + +   I     D   + E  + AGL  I   +D    + E
Sbjct: 79  NENIRRISEVSKLFADSCTISLTSFISPYRADRDRARELHKEAGLKFIEVFVDVPLDVAE 138

Query: 199 SKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240
            ++PKG  +  R      EGV+     +S  Y APE+  PEL
Sbjct: 139 QRDPKGLYKKAR------EGVIKDFTGISAPYEAPES--PEL 172

>ABR001W [592] [Homologous to ScYKL001C (MET14) - SH]
           complement(399488..399600,399659..400193) [648 bp, 215
           aa]
          Length = 215

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 10/97 (10%)

Query: 143 SEMVTRVKYVGGSVEASCALGVADAI----VDLVESGETMRAAGLTAIATVLDTSAHLIE 198
           +E + R+  V      SC + +A  I     D  ++ E  + AGL  I   +D    + E
Sbjct: 79  NENIRRIAEVAKLFADSCTVAIAAFISPYKADREKARELHKDAGLDFIEVFIDVPIEVAE 138

Query: 199 SKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPEN 235
           +++PK   EL +  ++   G++     +S  Y APEN
Sbjct: 139 NRDPK---ELYKKARA---GIIKDFTGISAPYEAPEN 169

>CAGL0L02321g 266781..267404 highly similar to sp|Q02196
           Saccharomyces cerevisiae YKL001c MET14 ATP adenosine-5
           -phosphosulfate 3 -phosphotransferase, hypothetical
           start
          Length = 207

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 43/102 (42%), Gaps = 12/102 (11%)

Query: 143 SEMVTRVKYVGGSVEASCALGVADAI----VDLVESGETMRAAGLTAIATVLDTSAHLIE 198
           +E + R+  V      SC + +   I     D  ++ E  + AGL  I   +D    + E
Sbjct: 83  NENIRRISEVSKLFADSCTISITSFISPYRTDRDKARELHKEAGLRFIEVFVDVPLEVAE 142

Query: 199 SKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPEL 240
            ++PKG  +  R      +G++     +S  Y  P +  PEL
Sbjct: 143 QRDPKGLYKKAR------QGIIKDFTGISAPYEEPAS--PEL 176

>KLLA0B05918g complement(533071..534006) similar to sp|P05317
           Saccharomyces cerevisiae YLR340w RPLA0 acidic ribosomal
           protein L10.e singleton, start by similarity
          Length = 311

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 15/82 (18%)

Query: 197 IESKNPKGDVELLRTIKSRIEGVMTAQKYVSCSYNAPENKLPELLKITPGRRAPTISQIN 256
           + +K  +G +E++  +K     V+ A K V  S    E  L  LL I+P     T+ Q+ 
Sbjct: 141 VPTKIARGTIEIVSDVK-----VVDAGKRVGAS----EASLLNLLNISPFTYGLTVVQVY 191

Query: 257 DSGWVAVSSMIERKNKGDIMDD 278
           D+G V  +S++      DI DD
Sbjct: 192 DNGQVFPASIL------DITDD 207

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,919,454
Number of extensions: 356248
Number of successful extensions: 846
Number of sequences better than 10.0: 13
Number of HSP's gapped: 842
Number of HSP's successfully gapped: 13
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)