Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F27467g84483243740.0
ADL080W86385316010.0
Kwal_23.578585686915900.0
YIL047C (SYG1)90290515510.0
Scas_700.25*93193314740.0
CAGL0L00737g91190514450.0
Scas_704.3991681314390.0
ADR289C8072931285e-07
KLLA0A02057g3842451203e-06
Kwal_23.61298162531213e-06
Scas_625.169322871152e-05
AAR127C3812561104e-05
Kwal_47.187213832561095e-05
Sklu_2440.133811831088e-05
YNR013C (PHO91)8942871052e-04
CAGL0I05632g8862821043e-04
AFR628C869971035e-04
YDR414C (ERD1)362183999e-04
CAGL0F02871g368178980.001
YCR037C (PHO87)923206990.001
Scas_570.8353173980.001
KLLA0C03454g90043940.004
Scas_689.169144930.006
Scas_634.15916103920.009
KLLA0F06160g859282870.036
CAGL0F02387g95243840.078
Kwal_33.1361889143820.13
YJL198W (PHO90)88134800.20
AGL020W84459750.77
Kwal_27.9804473150702.8
CAGL0G06952g71746703.6
CAGL0J07040g124522703.6
Sklu_2390.571049693.9
Sklu_2390.471049693.9
KLLA0E12133g84166694.1
Kwal_33.1538571369694.7
Scas_718.842374193669.4
Kwal_27.12751109340669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F27467g
         (832 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F27467g complement(2541110..2543644) similar to sp|P40528 S...  1689   0.0  
ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH] complement(...   621   0.0  
Kwal_23.5785                                                          617   0.0  
YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...   602   0.0  
Scas_700.25*                                                          572   0.0  
CAGL0L00737g complement(90349..93084) similar to sp|P40528 Sacch...   561   0.0  
Scas_704.39                                                           558   0.0  
ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH] (1193040.....    54   5e-07
KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA Kluy...    51   3e-06
Kwal_23.6129                                                           51   3e-06
Scas_625.16                                                            49   2e-05
AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH] (568957..570...    47   4e-05
Kwal_47.18721                                                          47   5e-05
Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement      46   8e-05
YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member o...    45   2e-04
CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces c...    45   3e-04
AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C ...    44   5e-04
YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein ...    43   9e-04
CAGL0F02871g complement(278122..279228) similar to sp|P16151 Sac...    42   0.001
YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of ...    43   0.001
Scas_570.8                                                             42   0.001
KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces c...    41   0.004
Scas_689.1                                                             40   0.006
Scas_634.15                                                            40   0.009
KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces c...    38   0.036
CAGL0F02387g complement(229207..232065) similar to sp|P25360 Sac...    37   0.078
Kwal_33.13618                                                          36   0.13 
YJL198W (PHO90) [2728] chr10 (60843..63488) Phosphate transporte...    35   0.20 
AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C (...    33   0.77 
Kwal_27.9804                                                           32   2.8  
CAGL0G06952g complement(663828..665981) similar to sp|P47075 Sac...    32   3.6  
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    32   3.6  
Sklu_2390.5 , Contig c2390 12646-14778                                 31   3.9  
Sklu_2390.4 YJL012C, Contig c2390 12646-14778                          31   3.9  
KLLA0E12133g 1076424..1078949 similar to sp|P43585 Saccharomyces...    31   4.1  
Kwal_33.15385                                                          31   4.7  
Scas_718.84                                                            30   9.4  
Kwal_27.12751                                                          30   9.9  

>KLLA0F27467g complement(2541110..2543644) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1 member of the
           major facilitator superfamily singleton, start by
           similarity
          Length = 844

 Score = 1689 bits (4374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 817/832 (98%), Positives = 817/832 (98%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQDVGSMDRTIVREFIDDWLVRD 60
           MKFAEHLRESVVPEWSDKYVNY               VQDVGSMDRTIVREFIDDWLVRD
Sbjct: 1   MKFAEHLRESVVPEWSDKYVNYKLGKKKIKQFQKLKKVQDVGSMDRTIVREFIDDWLVRD 60

Query: 61  QLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLDEYRIASLSRAPDSYGS 120
           QLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLDEYRIASLSRAPDSYGS
Sbjct: 61  QLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLDEYRIASLSRAPDSYGS 120

Query: 121 IFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMPVSWKNRDPLLAKKDRKRASRGQET 180
           IFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMPVSWKNRDPLLAKKDRKRASRGQET
Sbjct: 121 IFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMPVSWKNRDPLLAKKDRKRASRGQET 180

Query: 181 FQTETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKT 240
           FQTETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKT
Sbjct: 181 FQTETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKT 240

Query: 241 FMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNLFLGSDNDVDRLKKDPLTFWEQTAI 300
           FMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNLFLGSDNDVDRLKKDPLTFWEQTAI
Sbjct: 241 FMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNLFLGSDNDVDRLKKDPLTFWEQTAI 300

Query: 301 KWYTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIHRNNASMFQMFLGSAQLGISVTLVI 360
           KWYTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIHRNNASMFQMFLGSAQLGISVTLVI
Sbjct: 301 KWYTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIHRNNASMFQMFLGSAQLGISVTLVI 360

Query: 361 LMTIILAKNSSDEVRSALLPIWSSFHYLTFMGLLFIIDCFIWYKVKINYRFIMFGEIHSR 420
           LMTIILAKNSSDEVRSALLPIWSSFHYLTFMGLLFIIDCFIWYKVKINYRFIMFGEIHSR
Sbjct: 361 LMTIILAKNSSDEVRSALLPIWSSFHYLTFMGLLFIIDCFIWYKVKINYRFIMFGEIHSR 420

Query: 421 NGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFCSLMLEKLEPWMITWLCIAVALFFWK 480
           NGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFCSLMLEKLEPWMITWLCIAVALFFWK
Sbjct: 421 NGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFCSLMLEKLEPWMITWLCIAVALFFWK 480

Query: 481 FQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLG 540
           FQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLG
Sbjct: 481 FQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLG 540

Query: 541 CLTFNDSKEDKCRYEKLMWIGILSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGIS 600
           CLTFNDSKEDKCRYEKLMWIGILSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGIS
Sbjct: 541 CLTFNDSKEDKCRYEKLMWIGILSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGIS 600

Query: 601 FNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLC 660
           FNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLC
Sbjct: 601 FNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLC 660

Query: 661 GKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILR 720
           GKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILR
Sbjct: 661 GKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILR 720

Query: 721 RFVWVILRVENEHVANVHLFKVTDDNWQLPFPTIEDSELHMEEDYSAAAENMDNIAMLSV 780
           RFVWVILRVENEHVANVHLFKVTDDNWQLPFPTIEDSELHMEEDYSAAAENMDNIAMLSV
Sbjct: 721 RFVWVILRVENEHVANVHLFKVTDDNWQLPFPTIEDSELHMEEDYSAAAENMDNIAMLSV 780

Query: 781 MKSDLESQQQRPRSTSAVPKLNRKASVFEIIPWAHATDFQRPIETASVNSAA 832
           MKSDLESQQQRPRSTSAVPKLNRKASVFEIIPWAHATDFQRPIETASVNSAA
Sbjct: 781 MKSDLESQQQRPRSTSAVPKLNRKASVFEIIPWAHATDFQRPIETASVNSAA 832

>ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH]
           complement(542124..544715) [2592 bp, 863 aa]
          Length = 863

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/853 (39%), Positives = 491/853 (57%), Gaps = 68/853 (7%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQDVGSMDRT------------- 47
           MKFAE LRES +PEW DKY++Y                    S+  T             
Sbjct: 1   MKFAERLRESSIPEWRDKYLDYKLGKKKLKSYKEKLKASRALSVRPTQRSRARDEPYTMQ 60

Query: 48  ---IVREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKR------- 97
               V EF+  W++  +L  CDEFY+WQL +   KY  L++QI +Y L+ D+        
Sbjct: 61  QEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDENGAGLSYG 120

Query: 98  SRLDSLDEYRIASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMPV 157
           +  +  +E  +A+   A  S     P+ S     D  ++ +    KRWL   +L PS+P 
Sbjct: 121 ATYEGQEETGLAAQLSAGRS-----PSPSRAGRLDRAQEGV----KRWLQERDLMPSLPA 171

Query: 158 SW-KNRDPLLAKKDRKRASRGQETFQTETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRD 216
            W + + P   KK     S   ETF     P S  Q + QL  A+L++YL LQLLKNYRD
Sbjct: 172 RWSREQGPARVKK----YSANTETF-MHICP-SKRQAQLQLGHALLEYYLTLQLLKNYRD 225

Query: 217 LNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNL 276
           LNV GFRKIVKKFDK    ++L  FM YA ++S +F    + L+L  ++ + +     +L
Sbjct: 226 LNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASN----SL 281

Query: 277 FLGSDNDVDRLKKDPLTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIH 336
              +       +KDP+T+WE    +WYT  LT S++ +KH+++++++LSLQYS+NEQ +H
Sbjct: 282 CQPAARMNSSPEKDPVTYWEDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVH 341

Query: 337 RNNASMFQMFLGSAQLGISVTLVILMTIILAKNSSDEVRSALL-PIWSSFHYLTFMGLLF 395
           RNN  + QMF   + LG++V LVI+  ++  +      R  +L P+W  ++ +  M LLF
Sbjct: 342 RNNTCVVQMFTAGSLLGVAVVLVIIALMLGIRADISSYRHLILFPVWGGWYLVLLMSLLF 401

Query: 396 IIDCFIWYKVKINYRFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFC 455
            +DC+IW++ K+NY+FIMFGEIHSR G  +FNNDF  T I    +  +        ++ C
Sbjct: 402 CLDCYIWFRGKVNYQFIMFGEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLC 461

Query: 456 SLMLEKLEPWMITWLC-IAVALFFWKFQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFP 514
           S++   L PW+  WLC +  AL F     I   PYW E  ++R+++  + IRLVFSG +P
Sbjct: 462 SMVRATLAPWL--WLCALLFALGFSMSSFI--LPYWRELRKTRQWLIVTAIRLVFSGAYP 517

Query: 515 VQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGILSCLPSYWRFVQ 574
           VQFGDFFLGDIVCSLTYSM+  A++ C+ F+  K + C    L+ +G+LSC+PSYWR +Q
Sbjct: 518 VQFGDFFLGDIVCSLTYSMADVASVFCV-FSGQKYNMCGSSNLISMGVLSCIPSYWRLMQ 576

Query: 575 CVRRYFDSYDWFPHLLNAFKYLLGISFNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSI 634
           C+RRY DS D FPHLLN  KY + I +NA L  Y+       ++   I  G +NS  +SI
Sbjct: 577 CLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRINKLHHSYRSWFIAAGIINSVFSSI 636

Query: 635 WDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVF 694
           WDL+MDWSL Q +S NFLLRDDLYL GK+NW++G+YS ++K +YY  M+ DV +R++W+ 
Sbjct: 637 WDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIV 696

Query: 695 YMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENEHVANVHLFKVTDDNWQLPFP-- 752
           Y +       +  + +  +  LE++RRF+W+I RVENEHVANVHLFK+T +   LP+P  
Sbjct: 697 YAIAPRV-IQQSAVTSFILGILEVVRRFIWIIFRVENEHVANVHLFKITGET-PLPYPIS 754

Query: 753 ---TIEDSELHMEEDYSAAAENMDNIAMLSVMKSDLESQQQRPRSTSAVPKLNRKASVFE 809
               +  S +H +    +   + +++ + + +           R    +   +R  S+  
Sbjct: 755 PSRALSTSTVHDKHALPSTKNSHEDLVLYASV-----------RHPEVLHMRHRAPSILS 803

Query: 810 IIPWAHATDFQRP 822
            IPWAHA DFQRP
Sbjct: 804 NIPWAHAKDFQRP 816

>Kwal_23.5785
          Length = 856

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/869 (39%), Positives = 500/869 (57%), Gaps = 65/869 (7%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQDV----------------GSM 44
           MKFAEHLRES VPEW DKY++Y                 +V                 SM
Sbjct: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60

Query: 45  DRTI-------------VREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYV 91
            R +             V+ F++ W++  +L+ C++FY W+L +   ++  LQ QI  + 
Sbjct: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120

Query: 92  LEADKRSRLDSLDEYRIASLSRAPDSYGSIFPN--FSPI-ALKDTVKKKIWYDLKRWLVT 148
            +  ++S  D+  +Y           YG++  +    PI A KD+  +  ++ + + L  
Sbjct: 121 ADQAQQSIADTDSKY-----------YGAVDRDETIQPITAGKDSTLRSRFFRVVQDL-- 167

Query: 149 HNLCPSMPVSWKNRDPL-LAKKDRKRASRGQETFQTETSPLSLSQIRQQLSDAILDFYLY 207
             L PS P     +  L  + +D   +    ETF   T  LS +QI+ +LSDA+++FYL 
Sbjct: 168 -ELVPSFPRMAPFKRLLDQSPEDNNLSVSHGETFAPTT--LSTNQIQHRLSDALIEFYLL 224

Query: 208 LQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVE 267
           LQL+K YR++NV GFRKIVKKFDK     +L  F+ YAK    +F   +   +++   + 
Sbjct: 225 LQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMH 284

Query: 268 HAEVINVNLFLGSDNDVDRLKKDPLTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQ 327
            + ++       ++ +V+    DPL  WEQ   KWYT  L+SSSKD+K    R+KNLSL+
Sbjct: 285 DSALLGERSSFATELNVE----DPLLSWEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLE 340

Query: 328 YSVNEQTIHRNNASMFQMFLGSAQLGISVTLV--ILMTIILAKNSSDEVRSALLPIWSSF 385
           YS+NEQ +HR N S+ QMF+    LG S+ LV   L    +A NSS E+ S LLP+W  +
Sbjct: 341 YSLNEQKVHRFNRSILQMFVSGVLLGGSLALVGYTLYRGFVASNSS-EIHSLLLPLWGGW 399

Query: 386 HYLTFMGLLFIIDCFIWYKVKINYRFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTF 445
           + +  +  LF+++CFIW++  INYRFIMFGE+HSR G VLFNNDF  T IP+ F+ A+  
Sbjct: 400 YMVFLITFLFLLNCFIWHRSNINYRFIMFGEMHSRRGAVLFNNDFSTTKIPILFYFASVL 459

Query: 446 LCICSILAFCSLMLEKLEPWMITWLCIAVALFFWKFQVIQPW---PYWYETFQSRKYIFT 502
               ++L+  S     L PW I W+ + V LFF       P    PYW +  +S ++I  
Sbjct: 460 AFPMALLSSISFNEVNLNPWAIIWIALVVVLFFSPVLGELPLLSIPYWNKLTKSVRWILV 519

Query: 503 SFIRLVFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGI 562
           SF+RL+FSGF+PVQFGDFFLGDI CSLTYS++  A   C+ ++ +   +C       +G 
Sbjct: 520 SFVRLIFSGFYPVQFGDFFLGDIFCSLTYSLADIAMFFCI-YSPTPNGRCGSSHSKAMGA 578

Query: 563 LSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGISFNASLYWYKSWPQMQKFKVLLI 622
           ++CLP++WRF+QC+RR+ DS DWFPHLLN  KY L + + ASL  Y+     +  + + I
Sbjct: 579 MTCLPNFWRFMQCLRRFSDSGDWFPHLLNGLKYSLSVVYYASLCAYRI-SHTRSRRNVFI 637

Query: 623 VFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIM 682
           +F  LN   TSIWD+IMDWSLLQ+ S+N+LLRDDLYL G+KNWK+G YS ++K +YY  M
Sbjct: 638 IFATLNGVCTSIWDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAM 697

Query: 683 VFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENEHVANVHLFKV 742
           ++DV +R++WV Y +   T   +  + +  +A LE+ RRFVW+I RVENEHVANVHLFKV
Sbjct: 698 IWDVAMRFQWVVYAIAPAT-IQQSAITSFILAALEVTRRFVWIIFRVENEHVANVHLFKV 756

Query: 743 TDDNWQLPFPTIEDSELHMEEDYSAAAENMDNIAMLSVMKSDLESQQQRPRSTSAVPKLN 802
           + +   LP+PT  + E   E   S+    M  ++  ++       + +  + ++    L 
Sbjct: 757 SGE-ISLPYPTTVNEESETEASVSSNHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLL 815

Query: 803 RKASVFEIIPWAHATDFQRPIETASVNSA 831
           R  S    IPWAHA DFQRP   A  ++A
Sbjct: 816 RTLS--SSIPWAHAQDFQRPTGCAGGDNA 842

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
           which truncation and overexpression can suppress
           lethality of Gpa1p deficiency, member of the divalent
           anion:Na+ (DASS) family of membrane transporters [2709
           bp, 902 aa]
          Length = 902

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/905 (38%), Positives = 504/905 (55%), Gaps = 108/905 (11%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQDVGSMD--------------- 45
           MKFA+HL ES +PEW DKY++Y                ++  S                 
Sbjct: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60

Query: 46  ------------------------RTIVREF----IDDWLVRDQLKNCDEFYEWQLSKYR 77
                                     + REF    I+DWL+  QL  C+EFY W L +  
Sbjct: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120

Query: 78  AKYHKLQRQIHLYVLEAD--------KRSRLDSLDEYRIASLSRAPDS------------ 117
            K+  LQ Q+H Y L+ +          S +D       A L+   DS            
Sbjct: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV 180

Query: 118 -YGSIFPNFSPIALKDTVKKK--IWYDLKRWLVTHNLCPSMPVSWKNRDPLLAKKDRKRA 174
            YGS+         K+  K +  +    ++ L  + L PS P   K    LL    +  +
Sbjct: 181 MYGSM------PCTKEAKKPRLSLLAYCQKVLKDNRLLPSWP---KRGFSLLQDLRQDAS 231

Query: 175 SRGQETFQTETS---PLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDK 231
           SRG+ETF    S    ++ +Q R  LS+AI+++YLYLQL+K++RD+NV GFRK+VKKFDK
Sbjct: 232 SRGRETFAFGASFLETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDK 291

Query: 232 VLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNLFLGSDNDVDRLKKDP 291
             H  +L TFM YA+ +  +F   D  ++L+   ++  ++ +      S+    +  K+P
Sbjct: 292 TCHTRELTTFMSYARTHYTLFKHADANVQLVAQKMQ--QITSSQPTPTSELSSAQRDKEP 349

Query: 292 LTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIHRNNASMFQMFLGSAQ 351
           +T+ E    +W+T  LT+S KD+KHN  ++K L++QYS++EQ +HRNN S+ QM +    
Sbjct: 350 ITWLETQITEWFTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLG 409

Query: 352 LGISVTLVILMTIILAKNSSDE--VRSALLPIWSSFHYLTFMGLLFIIDCFIWYKVKINY 409
           +G+S+TL I  T+ L  +S +       L P+W  ++ +  +  LF+++CFIW++  INY
Sbjct: 410 IGVSMTL-ITYTLYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINY 468

Query: 410 RFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFCSLMLEKLEPWMITW 469
           RFIM GEI S+NG   FNNDF  + IPL+ +  T F+  C++ +  S  LEKL P    +
Sbjct: 469 RFIMLGEIQSKNGTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLY 528

Query: 470 LCIAVALFFWKFQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFPVQFGDFFLGDIVCSL 529
           + I   LF     +I   PYW +   +RK++  + IRL+ SGFFPV+FGDFFLGDI+CSL
Sbjct: 529 IGIVSFLFLCPSGLI---PYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSL 585

Query: 530 TYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGILSCLPSYWRFVQCVRRYFDSYDWFPHL 589
           TYS++  A   C+ ++ +  + C       +G+LSCLPSYWRF+QC+RR+ DS DWFPHL
Sbjct: 586 TYSIADIAMFFCV-YSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHL 644

Query: 590 LNAFKYLLGISFNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQ-TKS 648
           LNA KY LGI++NA+L  Y+   + ++ +   IV   LNS LTS WDL+MDWS    T S
Sbjct: 645 LNAAKYTLGIAYNATLCAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTS 704

Query: 649 KNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPL 708
            N+LLRDDLYL GKKNW++G YS  +K +YYF M++D+++R+EW+ Y +   T   +  +
Sbjct: 705 YNWLLRDDLYLAGKKNWENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQT-IQQSAV 763

Query: 709 IALAMATLEILRRFVWVILRVENEHVANVHLFKVTDDNWQLPFP--TIEDSELHMEEDYS 766
            +  +A LE+LRRFVW+I RVENEHVANVHLF+VT D   LP+P   + D  +   +  S
Sbjct: 764 TSFILALLEVLRRFVWIIFRVENEHVANVHLFRVTGDA-PLPYPIAQVGDDSMDSSDLGS 822

Query: 767 AAAENMDNIAMLSVMKSDLESQQQRPRS-TSAVPK----LNRKASVFE----IIPWAHAT 817
            A  ++++I +         S    P S    +P       R++SVFE     IPWAHAT
Sbjct: 823 KAFSSLNDIPI-------TPSHDNNPHSFAEPMPAYRGTFRRRSSVFENISRSIPWAHAT 875

Query: 818 DFQRP 822
           DFQRP
Sbjct: 876 DFQRP 880

>Scas_700.25*
          Length = 931

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/933 (37%), Positives = 497/933 (53%), Gaps = 125/933 (13%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQDV----------GSMDRTIVR 50
           MKF +HL ES++PEW DKYV Y                 D+           S+  +I  
Sbjct: 1   MKFGDHLNESMIPEWKDKYVEYKVGKKKLKTFKQKLQ-NDIDETTTDSLLNASVSDSIES 59

Query: 51  EFID--------------------------------DWLVRDQLKNCDEFYEWQLSKYRA 78
            +ID                                DWL+ +QL  C++FYE  ++  R 
Sbjct: 60  TYIDQENSTPVTPSHVYSIQKDYSPVKKKIVQEFVKDWLIGEQLNKCNDFYEELINDCRK 119

Query: 79  KYHKLQRQIHLYVLEA----DKRSR-------LDSLDEYRIASLSRAPDSYGSIFPNFSP 127
           KY+ L+ QI  Y ++     +K++R        +S+D       S     Y    PN   
Sbjct: 120 KYNILENQIRFYNIQRHSIDNKKTRNLLIVSSSESVDVENTPIDSTIQHPYA---PNRGR 176

Query: 128 I-----------ALKDTVKKKIWYD-LKRWLVTHNLCPSMPVSWKNRDPLLAKKDRKRAS 175
           +           A K+     +++  LK  L  +N+ PS+P     +          R S
Sbjct: 177 VITLNGQQNVANANKNFASHFLYFQKLKTILKNNNVLPSLPA----KGITSYFHQNGRGS 232

Query: 176 RGQETFQTET----SPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDK 231
           +G+           S +++ + ++ L++AIL+FYL+LQL+K YRDLN+ GFRKI KKFDK
Sbjct: 233 QGEGNINASENDMLSEITVEKAQKLLTEAILEFYLFLQLVKTYRDLNLTGFRKIAKKFDK 292

Query: 232 VLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNLF--LGSDNDVDRLKK 289
                +   FM YAK+   +FS  D  + L+ D ++        +F  +  +N+ D    
Sbjct: 293 TCETKECLKFMNYAKENYTIFSHIDPNIALMTDRMKKTSTYQPLVFEDITPENESD---- 348

Query: 290 DPLTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQYSVNEQTIHRNNASMFQMFLGS 349
           DPL +WE     WY   LT+S  + K N ++++   +QYS+NE+ IHR N S+ QM +  
Sbjct: 349 DPLLWWESKVRGWYIKDLTNSLTEMKRNNDKLRKFGIQYSLNERIIHRINISILQMTISG 408

Query: 350 AQLGISVTLVI-LMTIILAKNSSDEVRSALLPIWSSFHYLTFMGLLFIIDCFIWYKVKIN 408
             +G + +L+I  + +I   +    +   L P+W  ++ +  +  LFI +CFIW++  IN
Sbjct: 409 FFIGAAFSLIIYTLYLIFTSDDKAYIHRILFPLWGGWYMVLLISFLFIGNCFIWHRSGIN 468

Query: 409 YRFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTFLCICSILAFCSLMLEKLEPWMIT 468
           YRFIMFGEI +R+G   FNNDF  T I L+++  + F+  CSILA  S  LEKL P    
Sbjct: 469 YRFIMFGEIQARSGTQFFNNDFATTKISLKYYFISLFILACSILAIISFQLEKLTPLGFI 528

Query: 469 WLCIAVALFFWKFQVIQPWPYWYETFQSRKYIFTSFIRLVFSGFFPVQFGDFFLGDIVCS 528
           +  I + LF     +I   P+W +  ++RK++F S IRL+FSGF+PV+FGDFFLGDIVCS
Sbjct: 529 FPGIVITLFLAPSWMI---PFWDKLVETRKWLFCSGIRLIFSGFYPVEFGDFFLGDIVCS 585

Query: 529 LTYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGILSCLPSYWRFVQCVRRYFDSYDWFPH 588
           LTYS+S  A   C+ +  S    C    L  +G+L CLPS+WRF+QC+RR+ DS DWFPH
Sbjct: 586 LTYSISDLAMFFCV-YVRSDNATCSSSHLRSMGVLGCLPSFWRFMQCLRRFADSGDWFPH 644

Query: 589 LLNAFKYLLGISFNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQTKS 648
           LLNA KY LG+++NA+L  Y+  P+    + + IVF  LN+T TSIWDL+MDWSLLQ   
Sbjct: 645 LLNAAKYTLGVAYNATLCVYRISPKSFHSRQIFIVFATLNATYTSIWDLVMDWSLLQPSQ 704

Query: 649 KNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPL 708
            N  LRDDLYL GKKNWK+GKYS+K+K IYYF M+++V+VR+EW+ Y +   T   +   
Sbjct: 705 NNTFLRDDLYLAGKKNWKTGKYSNKRKSIYYFAMIWNVIVRFEWIVYAIAPQT-IQQSAD 763

Query: 709 IALAMATLEILRRFVWVILRVENEHVANVHLFKVTDDNWQLPFPTIEDSELHMEEDYSAA 768
            +  +AT E+LRRFVW+I RVENEHVANV+LF+V+     LP+P    S   +    S  
Sbjct: 764 TSFILATAEVLRRFVWIIFRVENEHVANVNLFRVS-GTAPLPYPINITSITPLGSSDSDE 822

Query: 769 AENMDNIAMLSVMKSDLESQQQRPRSTS----------AVPK------------------ 800
           A N+  I + S   +D  S    P+ TS          AVP                   
Sbjct: 823 ATNI--IVLESNSGNDNLSVTNEPQQTSNRINRFDTVGAVPNVDITRETRIEEPMPAYHP 880

Query: 801 -LNRKASVF----EIIPWAHATDFQRPIETASV 828
            L R+ + F    + IPWAH +DFQRP   A+ 
Sbjct: 881 PLERRTTTFGSISKSIPWAHTSDFQRPSIVATT 913

>CAGL0L00737g complement(90349..93084) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1, start by
           similarity
          Length = 911

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/905 (36%), Positives = 499/905 (55%), Gaps = 83/905 (9%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQDVGSMDRT------------- 47
           MKFA+HLRES + EW  KY++Y                 ++ ++                
Sbjct: 1   MKFADHLRESTISEWKGKYIDYKYGKKKLKKYKANTAKLNIPAVGYVSGRGTPKKKYNDF 60

Query: 48  ---IVREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLD 104
               + +FI+DWL+ +QL  C+EFY W LS+ + KY  L +Q+  Y     +   + S  
Sbjct: 61  QVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKEFREISSRV 120

Query: 105 EYRIASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYD------LKRWLVTHNLCPSMPVS 158
            Y+ +S S    +YGSI         +D       +D      LK +L  H+L PS P  
Sbjct: 121 TYQTSSTS-VLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHDLMPSWPKM 179

Query: 159 WKNRDPLLAKKDRKRASRGQETFQ----------------------TETSPLSLSQIRQQ 196
           +    P  A K +   ++ +ETF                        +     L   R  
Sbjct: 180 FIETIP-EALKPKSINTKLKETFAYSNKLNLNLNLMRNKDEHGNKILKNPHKELKHARAL 238

Query: 197 LSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQ-- 254
           LSDA+L+FYL+LQL+K+YRD+NV GFRKIVKKFDK     +L  FM + +    +F    
Sbjct: 239 LSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKHDA 298

Query: 255 --YDEYLKLIKDNVEHAEVINVNLFLGSDNDVDRLKK--DPLTFWEQTAIKWYTMTLTSS 310
              +  +K  K      + I  +    +D +V       DPL  WE    KWYT+ + +S
Sbjct: 299 VSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVVNS 358

Query: 311 SKDKKHNLERIKNLSLQYSVNEQTIHRNNASMFQMFLGSAQLGISVTLVILMTIILAKNS 370
             +KK +LE++K +S+QYS+NEQ IHRNN ++ QM +     GI+VTL I  T+ LA  S
Sbjct: 359 LSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTL-IAYTLYLAFLS 417

Query: 371 --SDEVRSALLPIWSSFHYLTFMGLLFIIDCFIWYKVKINYRFIMFGEIHSRNGPVLFNN 428
             + +    L PIW  ++ +  + L F+IDCFIW++  INYRFIMFGE+ +++G   FNN
Sbjct: 418 PLNTKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFNN 477

Query: 429 DFGMTHIPLQFFHATTFLCICSILAFCSLMLEKLEPWMITWLCIAVALFFWKFQVIQPWP 488
           DF  T IPL+ +    F+  C+I++  S   + L P+   +  +   LF   + +I   P
Sbjct: 478 DFATTGIPLRLYFLAFFIISCAIISALSFHFDHLTPYGYIYFIVVGLLFITPYDLI---P 534

Query: 489 YWYETFQSRKYIFTSFIRLVFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSK 548
           YW +  ++RK++ T+ IRLV SG +PV+F DFFLGDI+CSLTY++S  A   C     ++
Sbjct: 535 YWDKLVETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFACYYAPKTR 594

Query: 549 EDK---CRYEKLMWIGILSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGISFNASL 605
           +D    C       +G+LSCLPS+WRF+QCVRR+FDS DWFPHL NA KYLLG+++NA+L
Sbjct: 595 KDPLGMCGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNATL 654

Query: 606 YWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQTK--SKNFLLRDDLYLCGKK 663
             Y+        +   I+F  LNS  TSIWDL+MDWS+LQ+   ++N  LR DLYL GK+
Sbjct: 655 CAYRLSNHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLAGKR 714

Query: 664 NWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILRRFV 723
           NW++GKY   +K +YY  MV DVV+R++W+ Y V   T   +  + + A+A  E+ RRF+
Sbjct: 715 NWETGKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQT-IQQSAVTSFALAVTEVCRRFI 773

Query: 724 WVILRVENEHVANVHLFKVTDDNWQLPFPTIE--------DSELHMEEDYSAAAENMD-- 773
           WVI RVENEHVANVHLF+VT +   LP+P  +         ++L+ ++ +    ++++  
Sbjct: 774 WVIFRVENEHVANVHLFRVTGEAL-LPYPNQDVVDFSGKATTDLYDDQHFQQGRDSIESS 832

Query: 774 ---NIAMLSVMKSDLESQQQRPRSTSAVPKLNRKASVFE----IIPWAHATDFQRPIETA 826
              ++  L +  SD+ ++ + P +T     + R+ ++F+     IPWAHA DFQRP+   
Sbjct: 833 RPSHLHDLDLSLSDINNKFEEPTATYH-SIVRRRTAIFDNISRSIPWAHAKDFQRPLTQH 891

Query: 827 SVNSA 831
           +  S+
Sbjct: 892 NGESS 896

>Scas_704.39
          Length = 916

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/813 (40%), Positives = 473/813 (58%), Gaps = 52/813 (6%)

Query: 48  IVREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLDEYR 107
           I+ EF+++W++  QL  C+EFY W L+  R K+  LQ Q+HL+ ++  KR   D+ +   
Sbjct: 105 IIHEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQ--KRLFNDAANS-- 160

Query: 108 IASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMP----------- 156
           I+S      SYGS+  +    A  D+V   +   +K  L  H L PS P           
Sbjct: 161 ISS------SYGSLMTS----ATSDSVTTSLIQSIKDTLHAHRLLPSYPQYSLKQLIFNN 210

Query: 157 -VSWKNRDPLLAKK--DRKRASRGQETFQTETSPLSLSQIRQQLSDAILDFYLYLQLLKN 213
             S     PL+ ++  + +          T ++  SL +  + LSDAIL+FYL+LQL+K+
Sbjct: 211 TTSDTESQPLMERETFNPEDQLLNNLNNNTSSAKSSLDKSAKLLSDAILEFYLFLQLIKS 270

Query: 214 YRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVIN 273
           YRDLNV GFRKIVKKFDK    ++L  FM +AK+   +F   D  +KL+ + ++      
Sbjct: 271 YRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKHIDPNIKLMTNKMKQISSYQ 330

Query: 274 VNLF--LGSDNDVDRLKKDPLTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQYSVN 331
             +F  L   N++D    DP+ +WE     WY   LT+S K  K N +++K L +QYS+N
Sbjct: 331 PIIFDELIPSNEID----DPILWWESKVKDWYVNQLTNSPKSMKKNNKKLKKLIIQYSLN 386

Query: 332 EQTIHRNNASMFQMFLGSAQLGISVTLVILMTIILA--KNSSDEVRSALLPIWSSFHYLT 389
           EQ +HRNN ++ QM + +  LGIS T  I  TI L+     +      L PIW  ++ + 
Sbjct: 387 EQMVHRNNRAIIQMTIAAWILGISST-SIANTIYLSFMSGYTSYTHKILFPIWGGWYMVL 445

Query: 390 FMGLLFIIDCFIWYKVKINYRFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTFLCIC 449
            + LL I +CFIW+K +INYRFIMFGEI +R+G   +NNDF  T I L  +  + F+   
Sbjct: 446 LISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQFYNNDFATTRISLNLYFLSFFILPL 505

Query: 450 SILAFCSLMLEKLEPWMITWLCIAVALFFWKFQVIQPW--PYWYETFQSRKYIFTSFIRL 507
           SI A  S   E L P+ I +  IA +LF    + I  +  PYW +  + R +I T+FIRL
Sbjct: 506 SICALLSFHNENLFPYAIIYPLIATSLFIAP-KAISKYILPYWNKLKEIRVWILTTFIRL 564

Query: 508 VFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGILSCLP 567
             SG +PV+FGDFFLGDI+CSLTYSMS  A   C+ F+D     C     + +GILSCLP
Sbjct: 565 SLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSITMGILSCLP 624

Query: 568 SYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGISFNASLYWYK-SWPQMQKFKVLLIVFGC 626
           +YWR +QC RR+ DS DWFPHLLNA KY LG+++N +L  Y+ S  +    +   I+   
Sbjct: 625 NYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFIIVAA 684

Query: 627 LNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIMVFDV 686
           LN+ +TS+WDL +DWSLLQ  S N+LLR+DLYL GKK+W++G+YS  +K  YY  MV+DV
Sbjct: 685 LNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRARKSFYYIAMVWDV 744

Query: 687 VVRYEWVFYMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENEHVANVHLFKVTDDN 746
           ++R++W+ Y +   T   ++ + +  +AT EI+RR +WVI+RVENEHVANVHLF+VT  N
Sbjct: 745 LIRFQWIVYAIAPQT-IQQNAITSFILATTEIIRRCIWVIIRVENEHVANVHLFRVT-GN 802

Query: 747 WQLPFP------TIEDSELHMEEDYSAAAENMDNIAM--LSVMKSDLESQQQRPRSTSAV 798
             LP+P       +      + E+    AEN+D  A+  LS   S  E+    P  T A 
Sbjct: 803 APLPYPVNVQTIALTKPTFQIGEE-ERMAENLDQQALGNLSFNVSYDENAMWPPYRTLAR 861

Query: 799 PKLNRKASVFEIIPWAHATDFQRPIETASVNSA 831
            +    A + + IPW HATDFQRP    S N +
Sbjct: 862 RRTTTFAEISKSIPWVHATDFQRPTTLLSSNES 894

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 20/22 (90%)

Query: 1  MKFAEHLRESVVPEWSDKYVNY 22
          MKF +HLRES++PEW DKY++Y
Sbjct: 1  MKFGDHLRESIIPEWKDKYIDY 22

>ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH]
           (1193040..1195463) [2424 bp, 807 aa]
          Length = 807

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 120/293 (40%), Gaps = 47/293 (16%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQ-DVGSMDR---TIVREFIDDW 56
           MKF+  L+ + VPEWS KY+ Y                Q +  + D     + + +I+ +
Sbjct: 1   MKFSHSLQFNAVPEWSSKYIAYSQLKKLVYTLQKDKLYQHETFAQDPERVPLAQSYIERF 60

Query: 57  LVR--DQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLDEYRIASLSRA 114
           +     +L+  D+FY  Q +   A + +L+  +     E   + R +  +EY    L+R 
Sbjct: 61  IAALDKELRRIDKFYVSQETGILANFQELKDDVEDLQREGLTKPRHEG-EEYGAGGLNRR 119

Query: 115 PDSYGSIFPNFSP----IALKDTVKKKIWYDLKRWLVTHNLCPSMPVSWKNRDPLLAKKD 170
                +   N  P    +++   +     YD+                    +PLL    
Sbjct: 120 QSLSSASVANSEPEEEDLSMSHGLAGTPDYDV--------------------EPLL---- 155

Query: 171 RKRASRGQETFQTETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFD 230
            +R+S   + F  +   L     +++L  A    Y  L  LK+Y +LN  GF KI KKFD
Sbjct: 156 -RRSSGADDRFLQQGILL-----KKRLVMA----YTRLAELKSYFELNHTGFSKICKKFD 205

Query: 231 KVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVINVNLFLGSDND 283
           K L  +    +M    K + MFSQ    ++ I   ++   ++  +L  G ++D
Sbjct: 206 KSLETNIRGNYMQSLPKKTHMFSQ--GRIEYISTCIQETIMMYASLIHGVNHD 256

>KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA
           Kluyveromyces lactis ERD1 PROTEIN, start by similarity
          Length = 384

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 95/245 (38%), Gaps = 48/245 (19%)

Query: 522 LGDIVCSLTYSMSQFATLGCLTFNDSKEDKC---RYEKLMWIGI---LSCLPSYWRFVQC 575
           + D + S +  +   A      F+D    KC   RYE  + + I   +  LPS  R +Q 
Sbjct: 154 ISDTLTSYSKPLVDLAIYATFLFHDPTNVKCQVERYENAISLNIDVLVGVLPSLVRMIQS 213

Query: 576 VRRYFDSYDW---FPHLLNAFKYLLGISFN--------------ASLYWYKSWPQMQKFK 618
           +R +            L NAFKY   I                   +YW+  W       
Sbjct: 214 LREFTRGRSQKKDGSQLFNAFKYAGNIPIMLVTVYTRYYNLGPLGMMYWFMFW------- 266

Query: 619 VLLIVFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKS-GKYSS----K 673
                    NS  +  WD+ MDW L   +  +F+  D        + K+ G   S    +
Sbjct: 267 ---------NSAYSFWWDVTMDWKL---ELFDFVNGDTSVNNNNSSNKADGLLRSILLYR 314

Query: 674 KKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENEH 733
           K   YY  M  D ++R+ W +  +  ++ +    L    +  LEI+RR++W+  +VE E+
Sbjct: 315 KNAWYYSAMALDFILRFVWFWEYISGHSVFYGE-LNIFWLQILEIIRRWIWLFFKVEVEY 373

Query: 734 VANVH 738
           +A   
Sbjct: 374 IATTE 378

>Kwal_23.6129
          Length = 816

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 98/253 (38%), Gaps = 45/253 (17%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQ------DVGSMDRTIVREFID 54
           MKF+  L+ + VPEWS +Y+ Y                Q      ++  +  + V++F++
Sbjct: 1   MKFSHSLQFNAVPEWSSRYLAYSQLKRLIYTLQKEKLYQNSVTDPELAPLQNSYVQKFVE 60

Query: 55  DWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLDEY--RIASLS 112
              +  +L   D+FY  Q ++    YH+L+  +  +  +         L E+  R +S S
Sbjct: 61  A--LDKELYKIDKFYAQQEARIFDTYHELKEDVTEFKTQ-------QPLQEFVSRRSSAS 111

Query: 113 RAPDSYGSIFPNFSPIA-LKDTVKKKIWYDLKRWLVTHNLCP--SMPVSWKNRDPLLAKK 169
              D  GS  P     A   D    +I    +    T ++ P  S    +   DPL+   
Sbjct: 112 MGTDVSGSSRPPLRAAASFSDDDDAEIEASHRLGTSTGDMIPLVSRSTHYAGLDPLV--- 168

Query: 170 DRKRASRGQETFQTETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKF 229
                                 + R  L   ++  Y  L  LK++ +LN  GF KI KKF
Sbjct: 169 ----------------------EDRINLKKRLVVAYTQLSELKSFIELNQTGFSKICKKF 206

Query: 230 DKVLHQDQLKTFM 242
           DK L  +    +M
Sbjct: 207 DKSLDANIKSEYM 219

>Scas_625.16
          Length = 932

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 117/287 (40%), Gaps = 45/287 (15%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXXXXXXVQD--------------VGSMDR 46
           MKF+  L+ + VPEWS KY+ Y                                V S D 
Sbjct: 82  MKFSHSLQFNAVPEWSSKYIAYSHLKKLIYSLQKEKLYSSSSSHLQLDEECRPLVASTDG 141

Query: 47  TI------VREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRL 100
            +      V  F++   +  +LK  D+FY  Q +   A Y++L+  +        K    
Sbjct: 142 NLYTNDIYVSRFVEA--LDHELKKIDKFYISQETGLVANYNELKDDV--------KEFET 191

Query: 101 DSLDEYRIASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMPVSWK 160
           D L+  R+ S+S A          FS I+  D+      + ++         P+M  +  
Sbjct: 192 DLLNN-RLPSISDALPRQAMRRRRFSSISSADSNASDAQFSIES-------APAMEDTLN 243

Query: 161 NRDPLLAKKDRKRASRGQETFQTE-TSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNV 219
           +   +L  ++   AS+ + T  ++  SPL   Q +  L   ++  Y  L  LK + +LN 
Sbjct: 244 SG--VLDSENEIYASQSRTTGVSQYISPLL--QHKVTLKKRLVAIYTQLSELKEFIELNQ 299

Query: 220 NGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNV 266
            GF KI KKFDK L+     +++   KK S +F    E LK + + +
Sbjct: 300 TGFSKICKKFDKSLNTSIKSSYLETIKKKSSVFKP--ETLKKVTETI 344

>AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH]
           (568957..570102) [1146 bp, 381 aa]
          Length = 381

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 106/256 (41%), Gaps = 29/256 (11%)

Query: 494 FQSRKYIFTSFIRLVFSGFF---PVQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSKED 550
            +S + +     R++  G     P++     L D + S    +  F     L F     D
Sbjct: 132 LRSSRMVRRCVARMLLGGGIEGKPLRTNYILLADTLTSYGKPLMDFTAYLVLLFRTPLAD 191

Query: 551 KCRYEKLMWIG------ILSCLPSYWRFVQCVRRYFDSYD-WFPH---LLNAFKY--LLG 598
                 L          ++  +PS  R VQC+R Y    D W      L NA KY   L 
Sbjct: 192 PLAVRDLPSNAALHIDLVVGAIPSVIRLVQCLREYRRKEDAWAARRASLFNALKYSSQLP 251

Query: 599 ISFNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSL-LQTKSKNFLLRDDL 657
           I  +A L    +    Q++    ++   LNS  +  WD+ MDW L L   S   + RD++
Sbjct: 252 ILVHALLSRSGAAHGGQRWVRWAML---LNSVYSFWWDVTMDWKLGLFNFSSAGMERDEV 308

Query: 658 YLCGKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLE 717
                +   S KY       YY  +++D V+++ W++ +      + R  L  + +  LE
Sbjct: 309 --LRHRRLYSVKY-------YYGAVLYDFVMKFMWLWELHVGRALF-RRDLNPVWLHLLE 358

Query: 718 ILRRFVWVILRVENEH 733
           ++RR++W   ++E E+
Sbjct: 359 VIRRWIWTFFKIEAEY 374

>Kwal_47.18721
          Length = 383

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 114/256 (44%), Gaps = 26/256 (10%)

Query: 494 FQSRKYIFTSFIRLVFSGFF---PVQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSKED 550
           F S K +   F +++  G     P++     + D + S +  +  F    C    D   +
Sbjct: 131 FSSSKMVSRCFRKILALGNIEPKPLRNNYILISDSLTSYSKPLIDFGFYLCHLVVDPISE 190

Query: 551 KCRYEKLMWIG-------ILSCLPSYWRFVQCVRRYFDSY---DWFPHLLNAFKYLLGIS 600
            C   +   +G       ++   P   R +QC+R +  S    D    + NA KY L + 
Sbjct: 191 NCIISRTA-MGSAINLDLMIGTAPVIIRLLQCLREWRRSRTLGDARSSIFNALKYSLHLP 249

Query: 601 FNASLYWYKSWPQMQKFKVLLIVFGCLNSTLTSIWDLIMDWSL-LQTKSKNFLLRDDLYL 659
                 + +S+P ++    +   F  LNS  +  WDL MDW+L +    ++ + R+++ L
Sbjct: 250 IVMCAVYSRSFPDVKPGNYVYW-FMLLNSFYSFWWDLTMDWNLGVFNFGRSGMGRNEV-L 307

Query: 660 CGKKNWKSGKYSSKKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEIL 719
             ++++ S         +Y+  M  D  +R+ W++ ++   + +     I   +  LEIL
Sbjct: 308 RARRHFPS--------YMYFLAMSADFTLRFMWLWELLAGRSAFEGEANI-FFLQILEIL 358

Query: 720 RRFVWVILRVENEHVA 735
           RR++W+ ++++ E ++
Sbjct: 359 RRWIWIFVKLDAEAIS 374

>Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement
          Length = 381

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 81/183 (44%), Gaps = 25/183 (13%)

Query: 562 ILSCLPSYWRFVQCVRRY---FDSYDWFPHLLNAFKYLLGISFNASLY------WYKSWP 612
           ++   P+  R +QC+R Y     S D    L NA KY     F   +Y      +    P
Sbjct: 204 MIGITPATIRLIQCLREYKRSTSSADARAALFNALKY--SCQFPILVYTVVTRAYPGETP 261

Query: 613 QMQKFKVLLIVFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSS 672
               + +LL     LNS  T  WDL MDW         F    +  +   +  ++ ++ S
Sbjct: 262 SANIYWLLL-----LNSMYTFWWDLTMDWKF------GFFNFTNSGMKLNEVSRAQRHFS 310

Query: 673 KKKCIYYFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENE 732
            K C  Y  +  D ++R+ W++ +V   + + +  +    +  LEI+RR++W+  +VE E
Sbjct: 311 IKTC--YCAIFVDFILRFAWLWELVSGVSVF-KGEMNVFWLQFLEIVRRWIWIFFKVEAE 367

Query: 733 HVA 735
            ++
Sbjct: 368 FLS 370

>YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member of
           the phosphate permease family of membrane transporters,
           has similarity to Pho87p and Pho90p [2685 bp, 894 aa]
          Length = 894

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 110/287 (38%), Gaps = 55/287 (19%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXX---------------------XXXXXXXXVQ 39
           MKF+  L+ + VPEWS KY+ Y                                    + 
Sbjct: 1   MKFSHSLQFNSVPEWSTKYLAYSQLKKLIYSLQKDKLYSNNKHHVVEPHDANDENLPLLA 60

Query: 40  DVGSMDRTIVREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSR 99
           D    D+  + +F+    +  +LK  D+FY  Q +   A Y++L+  +    LE   ++ 
Sbjct: 61  DASPDDQFYISKFVAA--LNQELKKIDKFYISQETGLIANYNELKDDV--MELENTNKAT 116

Query: 100 LDSLDEYRIASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLKRW--LVTHNLCPSMPV 157
                + +    S A +                  K K     +R+  + + +  PS+  
Sbjct: 117 QLFNQQQQHQLQSVARNR-----------------KSKSQQRQRRFSSVSSTDSNPSLTD 159

Query: 158 SWKNRDPLLAKKDRKRASRGQETFQTETSPLSLS-----------QIRQQLSDAILDFYL 206
              +  P++  +     + G       ++ +SLS           Q R  L   ++  Y 
Sbjct: 160 MSIDSAPVIHTQVSNTTNNGNSMQNLASASVSLSNSNPVYLSPFTQHRLSLKKRLISIYT 219

Query: 207 YLQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFS 253
            L  LK++ +LN  GF KI KKFDK L+ +  + ++ Y K +S +F+
Sbjct: 220 QLSELKDFIELNQTGFSKICKKFDKSLNTNLKQNYLNYIKFHSHVFN 266

>CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 886

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 105/282 (37%), Gaps = 55/282 (19%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXX-------------------XXXXXXXXXXXXVQDV 41
           MKF+  L+ + VPEWS KY+ Y                                  + DV
Sbjct: 1   MKFSHSLQFNSVPEWSSKYIAYSQLKKLIYSLQKEKLYSSTPDLSTAASESSELQPLLDV 60

Query: 42  GS-MDRTIVREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRL 100
               + + VR F+    +  ++K  ++FY  Q +   A Y++L+  +H Y  E    + L
Sbjct: 61  PEDENSSYVRRFVQA--LDHEVKKIEKFYLSQETGLIANYNELKDDVHEYEQELTSANFL 118

Query: 101 DSLDEYRIASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMPVSWK 160
                Y   SL+ A  + G+              KK     L       +    +P+S  
Sbjct: 119 -----YPSQSLTGAVPTGGN-------------AKKLRRRRLSSTSSMESNNSGLPLSVD 160

Query: 161 NRDPLLAKKDRKRASRGQETFQTET-----------SPLSLS-QIRQQLSDAILDFYLYL 208
           +    +   +  R S   +  ++ T            PL+   Q +  L   ++  Y  L
Sbjct: 161 SAPGAIVPPEHHRPSIEAQKSRSSTVNNNSLNLSNFEPLNPQLQHKVTLKKRLVMVYTQL 220

Query: 209 QLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSI 250
             LK++ DLN  GF KI KKFDK L     K   PY K+  +
Sbjct: 221 SELKDFIDLNKTGFTKICKKFDKSLDTAIKK---PYLKQLEL 259

>AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C
           (PHO87) - SH] (1576713..1579322) [2610 bp, 869 aa]
          Length = 869

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 11/97 (11%)

Query: 191 SQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVL----HQDQLKTFMPYAK 246
           SQ R  L   I+D Y+ L  LK+Y +LN  GF KI KKFDK L      D +++   + +
Sbjct: 227 SQKRSILKKKIIDLYVELSQLKSYIELNRIGFFKITKKFDKTLSCTVRSDLIESGELFKE 286

Query: 247 KYSIMFSQYDEYLKLIKDNVEHAEVINVNLFLGSDND 283
            Y    S +D     I   VE   VI       +DND
Sbjct: 287 TYVFQPSTFDNLDNNISQLVEFYAVI-------TDND 316

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 1  MKFAEHLRESVVPEWSDKYVNY 22
          MKF+  L+ + VPEW D Y+NY
Sbjct: 1  MKFSHSLKYNAVPEWQDHYLNY 22

>YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein
           required for retention of luminal ER proteins [1089 bp,
           362 aa]
          Length = 362

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 86/183 (46%), Gaps = 32/183 (17%)

Query: 563 LSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKY-----LLGISFNASLYWYKSWPQMQKF 617
           ++ LP   R +QC+R Y   ++    L NA KY     +L  ++ + +Y  +     ++ 
Sbjct: 193 VALLPVLVRLLQCLREYRLLHE-ATLLFNALKYSCNLPILFCTWRSRVY--EGSINEERL 249

Query: 618 KVLLIVFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCI 677
             +   F  +NS+ T  WD+ MDWSL    S    LR           +S    + KK +
Sbjct: 250 HHVQRWFMLINSSYTLFWDVRMDWSLDSLTS----LRS----------RSKSAVTLKKKM 295

Query: 678 YYFIMVFDVVVRYEWVFY-------MVKNNTDYVRHPLIALAMATLEILRRFVWVILRVE 730
           Y+  ++ D ++R+ W++        +V  ++DY+        M   E++RR +WV+ +++
Sbjct: 296 YHSAILVDFLLRFWWLWVYLSQNLKLVAADSDYI---FFQGEMQYFEVIRRGIWVVFKLD 352

Query: 731 NEH 733
            E+
Sbjct: 353 AEY 355

>CAGL0F02871g complement(278122..279228) similar to sp|P16151
           Saccharomyces cerevisiae YDR414c ERD1 required for
           retention of luminal ER proteins, hypothetical start
          Length = 368

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 79/178 (44%), Gaps = 24/178 (13%)

Query: 563 LSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGISFNASLYWYKSWP----QMQKFK 618
           L+ +P   R  QC++ Y  + + F  L NA KY   +     L++ + +      ++ + 
Sbjct: 193 LAVIPPLIRLCQCLKEYKTTKE-FTLLANALKYSCHLPVVLCLWYSRVYGDDSLTIRDYN 251

Query: 619 VLLIVFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCIY 678
           +L ++   + ST + IWD+  DW++    S  +     L+                K  Y
Sbjct: 252 ILKVMMF-IQSTYSYIWDVRKDWTITSISSIRYQKSRVLF---------------PKFYY 295

Query: 679 YFIMVFDVVVRYEWVFYMVKNNTDYVRHPLIAL---AMATLEILRRFVWVILRVENEH 733
           +  +V D ++RY W++ ++    D    P           +E++RR  WV+ ++E+E+
Sbjct: 296 HIAIVMDGIMRYWWLWIIILAPYDVSGKPTALFFEKEAQFIELIRRAGWVVFKLESEY 353

>YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of the
           phosphate permease family of membrane transporters,
           appears to play a supporting role in phosphate uptake
           under high phosphate growth conditions [2772 bp, 923 aa]
          Length = 923

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 93/206 (45%), Gaps = 25/206 (12%)

Query: 191 SQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSI 250
           SQ +  L   I++ Y+ L  LK++ +LN  GF KI KK DKVLH +  +  +   + +  
Sbjct: 282 SQKKSLLKQTIINLYIDLCQLKSFIELNRMGFSKITKKSDKVLHMNTRQELIESEEFFKD 341

Query: 251 MFSQYDEYLKLIKDNVEHAEVINV-NLFLGSDNDVDRLKKDPLTF------WEQTAIKWY 303
            +    E L  +  N + A++I    + +G   +VD  K++  ++      WE++   W 
Sbjct: 342 TYIFQHETLSSL--NSKIAQLIEFYAVLMGQPGNVDSCKQELKSYLHDHIVWERSN-TWK 398

Query: 304 TMTLTSSS-------KDKKHNLERIKNLSLQY-------SVNEQTIHRNNASMFQMFLGS 349
            M   SS        +D+   L + K L ++Y        +N +     N ++ ++F G 
Sbjct: 399 DMLGLSSQNNDIITIEDEAEKLMQEK-LQIEYFKYPLPKPINLKFTKIENLAVPKLFFGK 457

Query: 350 AQLGISVTLVILMTIILAKNSSDEVR 375
             + I   +++   ++  K  +D V 
Sbjct: 458 RAMKIGFIIIVTGVLLGVKTFNDPVE 483

>Scas_570.8
          Length = 353

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 18/173 (10%)

Query: 563 LSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGISFNASLYWYKSWPQMQKF-KVLL 621
           ++ LP   R  QC++ Y    D    L N  KY   +   A +++ +      ++ + L 
Sbjct: 192 VASLPVLIRIFQCLKEYRAVGD-KSMLGNTVKYCSNLPILACVWYSRVHGGSSEWNQTLT 250

Query: 622 IVFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFI 681
           +     +S+ +  WD+ MDW  +   S+                +S K +     IYY  
Sbjct: 251 MWLRLFHSSYSLFWDVKMDW-FIDISSRRL--------------RSTKLA-LPTTIYYVG 294

Query: 682 MVFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENEHV 734
           ++ D ++RY WV+      + Y         +  LE+ RR +WV+ ++E+E+V
Sbjct: 295 ILIDFIIRYWWVWVQWYGASSYFNFIFFDSELQYLEVFRRAIWVVFKLESEYV 347

>KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces
           cerevisiae YCR037c PHO87 member of the phosphate
           permease family, start by similarity
          Length = 900

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%)

Query: 191 SQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVL 233
           SQ R  L   ++D Y+ L  LK++ +LN  GF KI KKFDKVL
Sbjct: 257 SQKRSILKKNVIDLYVDLAQLKSFIELNRIGFSKISKKFDKVL 299

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (72%)

Query: 1  MKFAEHLRESVVPEWSDKYVNY 22
          MKF+  L+ + VPEW D Y++Y
Sbjct: 1  MKFSHSLKYNAVPEWQDYYIDY 22

>Scas_689.1
          Length = 691

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (65%)

Query: 191 SQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLH 234
           SQ +  L  +I++ ++ L  LK++ +LN  GF KI KK DKVLH
Sbjct: 39  SQKKSLLKQSIVNLFIDLSQLKSFIELNKMGFSKITKKGDKVLH 82

>Scas_634.15
          Length = 916

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 50/103 (48%), Gaps = 7/103 (6%)

Query: 191 SQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLH---QDQLKTFMPYAKK 247
           SQ    L  +I + Y+ L  LK++ +LN  GF KI KK DKVLH   +D++     + K 
Sbjct: 271 SQKTSLLKQSITNLYIDLCQLKSFIELNRLGFNKITKKCDKVLHLNIRDEMIQTEEFFKD 330

Query: 248 YSIMFSQYDEYLKLIKDNVEHAEVINVNLFLGSDNDVDRLKKD 290
             I   Q D  LKL K   +  E   +    G   +++  KK+
Sbjct: 331 TYIF--QKDTTLKLSKKITQLVEFYAI--ITGQQTNIENCKKE 369

>KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 859

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 108/282 (38%), Gaps = 40/282 (14%)

Query: 1   MKFAEHLRESVVPEWSDKYVNYXXXXXXXXXXX------XXXXVQDVGSMDRTIV----- 49
           MKF+  L+ + VPEW+ KY+ Y                       D+ S   T       
Sbjct: 1   MKFSHSLQFNAVPEWTTKYIGYSQLKKLIYTLQKEKLYRSTSESSDLESTPLTTAVTRDS 60

Query: 50  --REFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLDEYR 107
             + FID   +  +L   D FY  Q +   A Y ++   +  +  E   R    S+    
Sbjct: 61  YEQRFIDA--LDKELDKIDSFYTMQETSILANYSEVYEDVTTFQNELMNR----SIHNTS 114

Query: 108 IASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMPVSWKNRDPLLA 167
              L+R      S    ++     D   ++   D +      N   S     +N+  + A
Sbjct: 115 TGDLNRQGTRRSSSISEYNSQPEMDLYSEE--DDDEDGFSIGNQEQS---DGQNKQ-IQA 168

Query: 168 KKDRKR--ASRGQETFQTETSPLSLSQI----------RQQ--LSDAILDFYLYLQLLKN 213
           ++ R     SR   +  +E  P +LS++           QQ  L   I+  +  L  LK+
Sbjct: 169 RRARTGSVGSRLMHSITSEILP-TLSRVTDFTTTDPIMEQQITLKKRIVACFTQLSELKS 227

Query: 214 YRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQY 255
           + +LN  GF KI KKFDK L  +    ++    K S +F+++
Sbjct: 228 FIELNQTGFAKICKKFDKSLDSNIKTDYLKSLSKKSHVFNEH 269

>CAGL0F02387g complement(229207..232065) similar to sp|P25360
           Saccharomyces cerevisiae YCR037c PHO87 or sp|P39535
           Saccharomyces cerevisiae YJL198w, start by similarity
          Length = 952

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 28/43 (65%)

Query: 191 SQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVL 233
           SQ +  L  +I++ Y+ L  LK++ +LN  GF KI KK DKVL
Sbjct: 304 SQRKSILKQSIINLYVDLCQLKSFIELNRMGFSKITKKSDKVL 346

>Kwal_33.13618
          Length = 891

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%)

Query: 191 SQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVL 233
           SQ +  +   ++D Y+ L  LK++ +LN  GF KI KKFDK L
Sbjct: 249 SQKKAIVKKNLVDLYVDLAQLKSFIELNRIGFLKITKKFDKTL 291

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (72%)

Query: 1  MKFAEHLRESVVPEWSDKYVNY 22
          MKF+  L+ + VPEW + Y+NY
Sbjct: 1  MKFSHSLKYNAVPEWQEHYLNY 22

>YJL198W (PHO90) [2728] chr10 (60843..63488) Phosphate transporter,
           low affinity, has strong similarity to Pho87p and
           Ynr013p, member of the phosphate permease family of
           membrane transporters [2646 bp, 881 aa]
          Length = 881

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 201 ILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLH 234
           I++ Y+ L  LK++ +LN  GF KI KK DKVLH
Sbjct: 246 IVNLYIDLCQLKSFIELNRIGFAKITKKSDKVLH 279

>AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C
           (VTC3) - SH] complement(682963..685497) [2535 bp, 844
           aa]
          Length = 844

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 9/59 (15%)

Query: 177 GQETFQTETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLHQ 235
           G +  Q+    L L  IR++L  A+ +     Q L  +  LN  GF KIVKK DK LH+
Sbjct: 99  GADALQS----LDLGHIREELEQALTE----AQELDRFSRLNFTGFIKIVKKHDK-LHE 148

>Kwal_27.9804
          Length = 473

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 63/150 (42%), Gaps = 17/150 (11%)

Query: 85  RQIHLYVLEADKRSRL-DSLDEYRIASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLK 143
           +++   V E D R +L D + E   +S+ +A D  GS+   FS    K   KK+ +  LK
Sbjct: 13  KELSASVPELDSRYKLLDKIGEGTFSSVYKAEDLTGSVTSAFSSHFWKSAGKKR-YVALK 71

Query: 144 RWLVTHNLCPSMPVSWKNRDPLLAKKDRKRASRGQETFQTETSPLSLSQIRQQLSDAILD 203
           R  VT     S P    N   LL                T  +PL  +   Q    A+L 
Sbjct: 72  RIYVT-----SSPQRIYNELNLLY----------MLCGSTRVAPLCDALRHQDQVIAVLP 116

Query: 204 FYLYLQLLKNYRDLNVNGFRKIVKKFDKVL 233
           +Y + +    YRDL + G +K + +  + L
Sbjct: 117 WYPHEEFRNFYRDLPIKGIKKYMSELLQAL 146

>CAGL0G06952g complement(663828..665981) similar to sp|P47075
           Saccharomyces cerevisiae YJL012c VTC4, start by
           similarity
          Length = 717

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 186 SPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDK 231
           S L    + ++LSD I D    +  L  +  LN  GF+KI+KK DK
Sbjct: 95  SELDFEILEEELSDVIAD----VHDLAKFSRLNYTGFQKIIKKHDK 136

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 17/22 (77%)

Query: 211 LKNYRDLNVNGFRKIVKKFDKV 232
           LKNY +LN   F KI+KKFDK+
Sbjct: 171 LKNYSELNKRAFVKILKKFDKI 192

>Sklu_2390.5 , Contig c2390 12646-14778
          Length = 710

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 183 TETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDK 231
           T  + L    + ++LSD I D    +  L  +  LN  GF+KI+KK DK
Sbjct: 92  TPATELDFEILEEELSDIIAD----VHDLAKFARLNYTGFQKIIKKHDK 136

>Sklu_2390.4 YJL012C, Contig c2390 12646-14778
          Length = 710

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 183 TETSPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDK 231
           T  + L    + ++LSD I D    +  L  +  LN  GF+KI+KK DK
Sbjct: 92  TPATELDFEILEEELSDIIAD----VHDLAKFARLNYTGFQKIIKKHDK 136

>KLLA0E12133g 1076424..1078949 similar to sp|P43585 Saccharomyces
           cerevisiae YFL004w VTC2 putative polyphosphate
           synthetase, start by similarity
          Length = 841

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 9/66 (13%)

Query: 209 QLLKNYRDLNVNGFRKIVKKFDKV---------LHQDQLKTFMPYAKKYSIMFSQYDEYL 259
           Q L N++ LN  GF KIVKK DK+         L Q +LK+   ++++YS +  +     
Sbjct: 129 QELDNFQRLNFTGFTKIVKKHDKLHPGYPSVKSLLQVRLKSLPFHSEEYSPLLYKISYLY 188

Query: 260 KLIKDN 265
            ++++N
Sbjct: 189 NILRNN 194

>Kwal_33.15385
          Length = 713

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 13/69 (18%)

Query: 172 KRASRGQETFQTET---------SPLSLSQIRQQLSDAILDFYLYLQLLKNYRDLNVNGF 222
           +R    QE   T           S L    + ++LSD I D +     L  +  LN  GF
Sbjct: 72  RRVKEAQEQVHTTVRALGSNVPPSELDFEILEEELSDIIADVHD----LAKFSRLNYTGF 127

Query: 223 RKIVKKFDK 231
           +KI+KK DK
Sbjct: 128 QKIIKKHDK 136

>Scas_718.84
          Length = 2374

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 81/193 (41%), Gaps = 26/193 (13%)

Query: 174  ASRGQETFQTETSPLSLSQI-RQQLSDAILDFYLYLQLLKNYRDLN----VNGFRKIVKK 228
            A R  ET   E S L L Q  RQ+  + I+D  L   L + Y ++     ++G  K    
Sbjct: 1408 AQRSLETNSFERSALYLEQCYRQERVNQIVDIGLLKNLQRTYEEIGDIDSIDGMLKTFST 1467

Query: 229  FDKVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVI----NVNLFLGSDNDV 284
             + +   ++L+    Y+K + +    +        DN+   + +    N  L+    N++
Sbjct: 1468 GNLISKIEELQ----YSKSWKMAQDCFTALSGFSHDNINTTKKLKSLYNRQLYSHVLNNL 1523

Query: 285  DRLKKDPLTFWEQTAIKWYTMTLTSSSKDKKH--------NLERIKN-----LSLQYSVN 331
              + KDP    +    +WY M + S+  +  +        N+E +K+     L LQY+V+
Sbjct: 1524 SFITKDPPMELDTNISEWYRMGIESAILEGGYNQLEEWVTNIETLKHVNDPELVLQYNVS 1583

Query: 332  EQTIHRNNASMFQ 344
            +  +   N +  Q
Sbjct: 1584 KALLFVKNKNFKQ 1596

>Kwal_27.12751
          Length = 1093

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 195 QQLSDAILDFYLYLQLLKNYRDLNVNGFRKIVKKFDKVLH 234
           + L D I  F   L  L+ + +LN  GF K++KK+DK  H
Sbjct: 118 RPLRDGIKKFERDLAHLEQFVELNRTGFSKVLKKWDKRSH 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.138    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,814,460
Number of extensions: 1249759
Number of successful extensions: 4759
Number of sequences better than 10.0: 66
Number of HSP's gapped: 4842
Number of HSP's successfully gapped: 81
Length of query: 832
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 722
Effective length of database: 12,788,129
Effective search space: 9233029138
Effective search space used: 9233029138
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)