Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F25410g48748024240.0
Kwal_26.81504624475691e-67
CAGL0K03245g4764203672e-38
CAGL0L10252g84576683.4
Kwal_33.15561129728657.0
KLLA0F12232g68078657.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F25410g
         (480 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F25410g 2363911..2365374 no similarity, hypothetical start       938   0.0  
Kwal_26.8150                                                          223   1e-67
CAGL0K03245g complement(297387..298817) weakly similar to KLLA0F...   145   2e-38
CAGL0L10252g complement(1100014..1102551) similar to sp|P50275 S...    31   3.4  
Kwal_33.15561                                                          30   7.0  
KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to ...    30   7.1  

>KLLA0F25410g 2363911..2365374 no similarity, hypothetical start
          Length = 487

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/480 (95%), Positives = 457/480 (95%)

Query: 1   MQKEVFGLFVKPLSRYCSFQRGYGRWDELAAKYYYKRPEVEREIAPAKLPLLTVPNVKDA 60
           MQKEVFGLFVKPLSRYCSFQRGYGRWDELAAKYYYKRPEVEREIAPAKLPLLTVPNVKDA
Sbjct: 1   MQKEVFGLFVKPLSRYCSFQRGYGRWDELAAKYYYKRPEVEREIAPAKLPLLTVPNVKDA 60

Query: 61  RIRCGFRGSEVGKLLDVLLMDVYSTDKSWMEQWLQRDRSKTSLVRHGDEFRVDSVSGLDN 120
           RIRCGFRGSEVGKLLDVLLMDVYSTDKSWMEQWLQRDRSKTSLVRHGDEFRVDSVSGLDN
Sbjct: 61  RIRCGFRGSEVGKLLDVLLMDVYSTDKSWMEQWLQRDRSKTSLVRHGDEFRVDSVSGLDN 120

Query: 121 TVTYYLPSPWLAEAECEILEISDESKQTLNQGADQCHLYVEKQTFPEPIWPSFMVVPRSG 180
           TVTYYLPSPWLAEAECEILEISDESKQTLNQGADQCHLYVEKQTFPEPIWPSFMVVPRSG
Sbjct: 121 TVTYYLPSPWLAEAECEILEISDESKQTLNQGADQCHLYVEKQTFPEPIWPSFMVVPRSG 180

Query: 181 TASHFXXXXXXXXXXXLHGHEIDPVAAFDVSLQFAKDKSLVSKYLECLDSTNILNISKQL 240
           TASHF           LHGHEIDPVAAFDVSLQFAKDKSLVSKYLECLDSTNILNISKQL
Sbjct: 181 TASHFVDSTDSSSVSSLHGHEIDPVAAFDVSLQFAKDKSLVSKYLECLDSTNILNISKQL 240

Query: 241 KIRLQGKEQIFCDLERAVLREIFKEDNSVEKYEKLKNSKASVNGTIEEWSREAHKELQTS 300
           KIRLQGKEQIFCDLERAVLREIFKEDNSVEKYEKLKNSKASVNGTIEEWSREAHKELQTS
Sbjct: 241 KIRLQGKEQIFCDLERAVLREIFKEDNSVEKYEKLKNSKASVNGTIEEWSREAHKELQTS 300

Query: 301 IEPLLSDFASKQLSLWKVYTYXXXXXXXXXXXXCNITNDLQMVQNLSHIYGSLGIPQDKL 360
           IEPLLSDFASKQLSLWKVYTY            CNITNDLQMVQNLSHIYGSLGIPQDKL
Sbjct: 301 IEPLLSDFASKQLSLWKVYTYSESKLSLKLHELCNITNDLQMVQNLSHIYGSLGIPQDKL 360

Query: 361 SIIDPDYARNKVPVLHKEINKAVYLNFLQLQFPLIAVSIGGFVTELCTAYSMGALSSLGI 420
           SIIDPDYARNKVPVLHKEINKAVYLNFLQLQFPLIAVSIGGFVTELCTAYSMGALSSLGI
Sbjct: 361 SIIDPDYARNKVPVLHKEINKAVYLNFLQLQFPLIAVSIGGFVTELCTAYSMGALSSLGI 420

Query: 421 VLGLKRVKDTWYSMLKQFQLQIREECRIGIESNKQLLLHNWEISYAEREADLKGKVALLK 480
           VLGLKRVKDTWYSMLKQFQLQIREECRIGIESNKQLLLHNWEISYAEREADLKGKVALLK
Sbjct: 421 VLGLKRVKDTWYSMLKQFQLQIREECRIGIESNKQLLLHNWEISYAEREADLKGKVALLK 480

>Kwal_26.8150
          Length = 462

 Score =  223 bits (569), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 155/447 (34%), Positives = 227/447 (50%), Gaps = 37/447 (8%)

Query: 46  PAKLPLLTVPNVKDAR-IRCG-----FRGSEVGKLLDVLLMDVYSTDKSWMEQWLQRDRS 99
           P KLPLL     KD R IRCG      R       L  LL DVYS+D+ W E++  R  S
Sbjct: 33  PDKLPLL---EYKDNRAIRCGVVIGSLRSQRDCAFLSALLADVYSSDQYWFEKFKGRFLS 89

Query: 100 -KTSLVRHGDEFRVDSVSGLDNTVTYYLPSPWLAEAECEILEISDESKQTLNQGADQCHL 158
            KT L+R+G    V  V   ++ + + LPSPWL     E+LE SD+  QT   G D CH+
Sbjct: 90  PKTRLIRYGPSLEVQDVG--ESKMVFTLPSPWLQSHGVELLE-SDQVNQT---GDDGCHV 143

Query: 159 Y--VEKQTFPEPIWPSFMVVPRSGTASHFXXXXXXXXXXXLHGHEIDPVAAFDVSLQFAK 216
           Y  V         WPSF +     ++              L   E++   A     +   
Sbjct: 144 YLGVNALNLSTSPWPSFSINDSDNSSP-------------LGTREVNSALALAGVEKLIN 190

Query: 217 DKSLVSKYLECLDSTNILNISKQLKIRLQGKEQIFCDLERAVLREIFKEDNSVEKYEKLK 276
            K+  S+Y+  ++++N  NISKQL  ++  +E +   L  AV++ I++ D S+ K  +L 
Sbjct: 191 SKANASEYVRDMENSNFTNISKQLTQQICNREVVLQLLSGAVIKNIYETDTSLAKRSELL 250

Query: 277 NSKASVNGTIEEWSREAHKELQTSIEPLLSDFASKQLSLWKVYTYXXXXXXXXXXXXCNI 336
             KA +   IEEW+ +AH   Q+S++P L  F  +QLS++++ TY            C+ 
Sbjct: 251 TEKAKLERKIEEWAFDAHSFTQSSLKPQLDGFVKRQLSVFRLLTYSESRLELKLRELCDR 310

Query: 337 TNDLQMVQNLSHIYGSLGI---PQDKLSIIDPDYARNKVPVLHKEINKAVYLNFLQLQFP 393
             D  +   +  I G L I   PQ + +    D    KV  LH+ INK +Y  F +LQ P
Sbjct: 311 AIDSSISDRVQFIRGQLNIKLVPQKQAA---RDSCYLKVAQLHRTINKFIYQQFFKLQLP 367

Query: 394 LIAVSIGGFVTELCTAYSMGALSSLGIVLGLKRVKDTWYSMLKQFQLQIREECRIGIESN 453
           LI  S  G ++   +AYSMG+L++LGIVLGL RV   W  MLKQF+ ++ E  R+ IE+ 
Sbjct: 368 LIVCSFVGTLSGQFSAYSMGSLAALGIVLGLSRVMHRWSEMLKQFEAEVLEGKRLEIEAE 427

Query: 454 KQLLLHNWEISYAEREADLKGKVALLK 480
           K+ L    EI Y+ + + L+ K  LL+
Sbjct: 428 KKALRQEIEIEYSAKSSLLEKKTGLLE 454

>CAGL0K03245g complement(297387..298817) weakly similar to
           KLLA0F25410g Kluyveromyces lactis, hypothetical start
          Length = 476

 Score =  145 bits (367), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 113/420 (26%), Positives = 198/420 (47%), Gaps = 43/420 (10%)

Query: 43  EIAPAKLPLLTVPNVKDARIRCG-FRGSEVGKLLDVLLMDVYSTDKSW----MEQWLQRD 97
           E+A +KL LL     ++  IRCG    +  G      + D  +   SW    + +W+  D
Sbjct: 28  EVAISKLRLLQ----ENTAIRCGVLMNTRQGSFGSAFVTDKEALGSSWVPTLINRWVNED 83

Query: 98  RSKTSLVRHGDEFRVDSVSGLDNTVTYYLPSPWLAEAECEILEI--SDESK-QTLNQGAD 154
           ++   L+++GD+FR   ++G     T+ +PS +L E   EILEI   D+SK + L    D
Sbjct: 84  KTPV-LMKYGDQFR--EING--EVRTFEIPSSFLKETNAEILEIPEQDQSKDKRLPHVHD 138

Query: 155 QCHLYVEKQ---TFPEPIWPSFMVVPRSGTASHFXXXXXXXXXXXLHGHEIDPVAAFDVS 211
            CH+Y++ +   T  +P WP+  +                     L  ++ID   A +  
Sbjct: 139 GCHVYLDIRGDPTVSQPTWPTIEI------------EDVLSKGKLLLTNQIDSQMALESL 186

Query: 212 LQFAKDKSLVSKYLECLDSTNILNISKQLKIRLQGKEQIFCDLERAVLREIFKEDNSVEK 271
           L++  + S +S+YL   +++N   I  +L  +L+    I  +L+ ++ R +   D  +  
Sbjct: 187 LKY--NNSTISEYLNKQNASNFDRIRAKLVDKLKDGNLIRTELKSSIRRYLQSTDRDISN 244

Query: 272 YEKLKNSKASVNGTIEEWSREAHKELQTSIEPLLSDFASKQLSLWKVYTYXXXXXXXXXX 331
            ++L   +   N  I++W+  +HK L+  I P    FA   LSLWK+YTY          
Sbjct: 245 EKRLIGKRDLTNEEIDKWAECSHKTLRDEIVPSFLSFARAHLSLWKLYTYSPAKLKLNFM 304

Query: 332 XXC--------NITNDLQMVQ-NLSHIYGSLGIPQDKLSIIDPDYARNKVPVLHKEINKA 382
             C         I N  ++++ N+   +    +    ++ I P     K+  +  EINKA
Sbjct: 305 EYCMIPLYKVHEIENSAKVLEANMFREFDLETVSAQVMTPILPTTEIQKIGRIQTEINKA 364

Query: 383 VYLNFLQLQFPLIAVSIGGFVTELCTAYSMGALSSLGIVLGLKRVKDTWYSMLKQFQLQI 442
           +Y  F  +Q P++  ++ G V+E  +AY MG+L++LGIVLG  R    W  +L  +  ++
Sbjct: 365 IYKQFFTIQLPMVLCALLGVVSEQFSAYYMGSLAALGIVLGFWRCMKQWQYILNGYTRKV 424

>CAGL0L10252g complement(1100014..1102551) similar to sp|P50275
           Saccharomyces cerevisiae YOR058c ASE1
           microtubule-associated protein, start by similarity
          Length = 845

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

Query: 303 PLLSDFASKQLSLWKVYTYXXXXXXXXXXXXCNITNDLQMVQNLSHIYGSL--GIPQDKL 360
           P L+ F  K L L  +                NI N+L    NL  IY  L  G P++K+
Sbjct: 217 PELTKFLEKCLDLQHLTNAIGMDLKDISEEEKNILNNLNESDNLEQIYEYLTNGSPKNKI 276

Query: 361 SIIDPDYARNKVPVLH 376
           S+I     +NK  +L+
Sbjct: 277 SLISEVIKKNKAELLN 292

>Kwal_33.15561
          Length = 1297

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 268 SVEKYEKLKNSKASVNGTIEEWSREAHK 295
           +VEKY K++NS+ SV   I  WS  A K
Sbjct: 200 NVEKYGKIENSETSVAADIMAWSLNAAK 227

>KLLA0F12232g join(1129199..1129312,1129409..1131337) similar to
           sp|P53541 Saccharomyces cerevisiae YNL012w SPO1
           transcriptional regulator involved in sporulation, start
           by similarity
          Length = 680

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 17/78 (21%)

Query: 357 QDKLSIIDPDYARNKVPVLHKEINKAVY------LNFLQLQFPLIAVSI--GGFVTELCT 408
            +KLS ++ DY   +  V+  +  K         +N   LQFP IAV+I  GGF + L +
Sbjct: 39  NEKLSALEFDYLSKRTEVIKGKFEKFYEDLAIPGINVDSLQFPRIAVAISGGGFRSMLIS 98

Query: 409 AYSMGALSSLGIVLGLKR 426
           +         G VLG+++
Sbjct: 99  S---------GFVLGMQQ 107

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,848,065
Number of extensions: 611965
Number of successful extensions: 1796
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1813
Number of HSP's successfully gapped: 9
Length of query: 480
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 375
Effective length of database: 12,961,219
Effective search space: 4860457125
Effective search space used: 4860457125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)