Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F25388g40539918490.0
Kwal_26.81523734105422e-65
CAGL0K03267g4872774578e-52
Scas_709.573942664395e-50
ABR048W3571574025e-45
YHL020C (OPI1)4041753339e-35
CAGL0F02079g122373760.28
CAGL0M08052g131087720.74
Scas_97.1*26124681.8
Sklu_1989.2110424682.4
AFL029W66741663.9
CAGL0L06622g113725655.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F25388g
         (399 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F25388g complement(2362150..2363367) some similarities with...   716   0.0  
Kwal_26.8152                                                          213   2e-65
CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces...   180   8e-52
Scas_709.57                                                           173   5e-50
ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH] complement(4...   159   5e-45
YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative reg...   132   9e-35
CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces c...    34   0.28 
CAGL0M08052g 801812..805744 similar to sp|P39993 Saccharomyces c...    32   0.74 
Scas_97.1*                                                             31   1.8  
Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement         31   2.4  
AFL029W [3164] [Homologous to ScYBR238C - SH; ScYGL107C - SH] co...    30   3.9  
CAGL0L06622g complement(743602..747015) similar to sp|P17442 Sac...    30   5.8  

>KLLA0F25388g complement(2362150..2363367) some similarities with
           sp|P21957 Saccharomyces cerevisiae YHL020c OPI1 negative
           regulator of phospholipid biosynthesis pathway
           singleton, hypothetical start
          Length = 405

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/399 (91%), Positives = 367/399 (91%)

Query: 1   MSEDRGNQSTIKFTVSKDSEEIAVEALDKLRNGDYSVTPSGSESSGKSERLLDKMKQSAV 60
           MSEDRGNQSTIKFTVSKDSEEIAVEALDKLRNGDYSVTPSGSESSGKSERLLDKMKQSAV
Sbjct: 1   MSEDRGNQSTIKFTVSKDSEEIAVEALDKLRNGDYSVTPSGSESSGKSERLLDKMKQSAV 60

Query: 61  DLYEQTRTNHPKLIRRADRLVKKIEKTSGIWIGAAKRKIDEVDTQSNGXXXXXXXACVHG 120
           DLYEQTRTNHPKLIRRADRLVKKIEKTSGIWIGAAKRKIDEVDTQSNG       ACVHG
Sbjct: 61  DLYEQTRTNHPKLIRRADRLVKKIEKTSGIWIGAAKRKIDEVDTQSNGDDDDSDDACVHG 120

Query: 121 LDIEHIKVQGKEICVTGKERGSKRRRIKENLKEYQLNMSIESKKRLMTCLGLLKLANKQL 180
           LDIEHIKVQGKEICVTGKERGSKRRRIKENLKEYQLNMSIESKKRLMTCLGLLKLANKQL
Sbjct: 121 LDIEHIKVQGKEICVTGKERGSKRRRIKENLKEYQLNMSIESKKRLMTCLGLLKLANKQL 180

Query: 181 SQRVMSLQDVVKKEQXXXXXXXXXXXXXDAEVRPRNHCSVRETTSSAEHPGHXXXXXXXX 240
           SQRVMSLQDVVKKEQ             DAEVRPRNHCSVRETTSSAEHPGH        
Sbjct: 181 SQRVMSLQDVVKKEQLRRRSPLPISSSIDAEVRPRNHCSVRETTSSAEHPGHDRDEEEDE 240

Query: 241 XXXXASSQLNEQAGNRKQDDTNKEQEDLDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSL 300
               ASSQLNEQAGNRKQDDTNKEQEDLDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSL
Sbjct: 241 QFFDASSQLNEQAGNRKQDDTNKEQEDLDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSL 300

Query: 301 PEPARSQVRESLLKLPTKWMINSEKPNSKRISSNKRALLLAQEALDMVGNVMNVVDGTLG 360
           PEPARSQVRESLLKLPTKWMINSEKPNSKRISSNKRALLLAQEALDMVGNVMNVVDGTLG
Sbjct: 301 PEPARSQVRESLLKLPTKWMINSEKPNSKRISSNKRALLLAQEALDMVGNVMNVVDGTLG 360

Query: 361 KAEEWVKNKQELKQMLMEQFRHEQLKQQVKHQLTKESAS 399
           KAEEWVKNKQELKQMLMEQFRHEQLKQQVKHQLTKESAS
Sbjct: 361 KAEEWVKNKQELKQMLMEQFRHEQLKQQVKHQLTKESAS 399

>Kwal_26.8152
          Length = 373

 Score =  213 bits (542), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 156/410 (38%), Positives = 220/410 (53%), Gaps = 95/410 (23%)

Query: 22  IAVEALDKLRNGDYSVTPSGSESSGKSERLLDKMK-----QSAVDLYEQTRTNHPKLIRR 76
           +AVEAL  LRN         S   G+ + LLDK++      +AV +YEQ+++ +PK  + 
Sbjct: 21  LAVEALRDLRN---------SHGQGQHDTLLDKVRSNALINNAVRVYEQSKSQYPKFRKG 71

Query: 77  ADRL--------VKKIEKTSGIWIGAAKR---------KIDEVDTQSNGXXXXXXXACVH 119
           A+ +        VK++EKTS  W    KR            +    S+            
Sbjct: 72  AEMMERKAFIPMVKRLEKTSHKWKSRGKRCHDDEDEDEMDQQKAEGSDEEDNDGDDEEED 131

Query: 120 GLDIEHIKVQGKEICVTGKERGSKRRRI-------KENLKEYQLNMSIESKKRLMTCLGL 172
               E + +    +C   ++R SKR++I       K NLK YQL+MSIESKKRL+TCL L
Sbjct: 132 EDHRESVLLLDDRLC---RKRTSKRQKISNAIAKSKVNLKGYQLDMSIESKKRLVTCLHL 188

Query: 173 LKLANKQLSQRVMSLQDVVKKEQXXXXXXXXXXXXXDAEVRPRNHCSVRETTSSAEHPGH 232
           LKLAN QLS RV  LQD+V KEQ                +R R                 
Sbjct: 189 LKLANNQLSNRVGFLQDLVLKEQKLRK----------GRIRDR----------------- 221

Query: 233 XXXXXXXXXXXXASSQLNEQAGNRKQDDTNKEQEDLDIDAAANDIQLEVVGTLKKVYSVV 292
                              QA +  +++     +++D    +N +++E+VGT+KKVYS++
Sbjct: 222 -------------------QAESDDEEEYYDASDNID--ELSNVVKMEIVGTVKKVYSLI 260

Query: 293 SRFTGNSLPEPARSQVRESLLKLPTKW--MINSEK----PNSKRISSNKRALLLAQEALD 346
           S+FTG+SLPEPAR+QVRESLLKLP  W   +NSE      +SK +S N + L+LA+E+L 
Sbjct: 261 SKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENLARYTSSKGVSPNGKVLILAKESLG 320

Query: 347 MVGNVMNVVDGTLGKAEEWVKNKQELKQMLMEQFRHEQLKQQVKHQLTKE 396
           MV NVMNVVD TLGKAEEWVK KQE+K++L +Q+ H + +++VK Q+ KE
Sbjct: 321 MVHNVMNVVDNTLGKAEEWVKQKQEVKELLKKQYLHGRYREKVKTQIIKE 370

>CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces
           cerevisiae YHL020c Negative regulator of phospholipid
           biosynthesis, hypothetical start
          Length = 487

 Score =  180 bits (457), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 115/277 (41%), Positives = 152/277 (54%), Gaps = 67/277 (24%)

Query: 142 SKRRRIKE-------NLKEYQLNMSIESKKRLMTCLGLLKLANKQLSQRVMSLQDVVKKE 194
           SKR+ + E       NL+EY+L MSIESKKRL+TCL LLKLANKQLS +V  LQD V+KE
Sbjct: 200 SKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKLANKQLSDKVAYLQDAVEKE 259

Query: 195 QXXXXXXXXXXXXXDAEVRPRNHCSVRETTSSAEHPGHXXXXXXXXXXXXASSQLNEQAG 254
           Q               E R  N                                  E +G
Sbjct: 260 QELANGEEVKK-----ETRALN---------------------------------GEHSG 281

Query: 255 NRKQDDTNKEQEDLDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSLPEPARSQVRESLLK 314
            +  DD         +D  + D+ LE+VGT+KKVYS++S++TG+SLPEPARSQVRESLL 
Sbjct: 282 PQNDDDLEFYDASESVDQNSGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLLN 341

Query: 315 LPTKW---MINSEKPNSKRI-------------------SSNKRALLLAQEALDMVGNVM 352
           LP+ W   + N  K N   I                   SSN + L+LA+E+L+MV +V+
Sbjct: 342 LPSNWNTSVHNGFKNNGTGIMTASSSTDSLSSYSSILPVSSNGKYLILAKESLNMVQSVI 401

Query: 353 NVVDGTLGKAEEWVKNKQELKQMLMEQFRHEQLKQQV 389
           +VVD TLG+AEEWVK KQELK+M+ ++F  +Q  Q++
Sbjct: 402 DVVDSTLGRAEEWVKQKQELKEMIKKKFLEQQEHQKM 438

>Scas_709.57
          Length = 394

 Score =  173 bits (439), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 144/266 (54%), Gaps = 46/266 (17%)

Query: 142 SKRRRI-------KENLKEYQLNMSIESKKRLMTCLGLLKLANKQLSQRVMSLQDVVKKE 194
           SKRR++       K+N KEY+LNMSIESKKRL+TCL LLKLANKQLS +V  L       
Sbjct: 145 SKRRKLSEALLKSKDNFKEYKLNMSIESKKRLITCLHLLKLANKQLSDKVTFL------- 197

Query: 195 QXXXXXXXXXXXXXDAEVRPRNHCSVRETTSSAEHPGHXXXXXXXXXXXXASSQLNEQAG 254
           Q                +  + H    +     EH                         
Sbjct: 198 QELVEEEETVKEEDSHAIEKKEHVVRNKKQQHTEHEDDEDEDEDEDEDEFF--------- 248

Query: 255 NRKQDDTNKEQEDLDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSLPEPARSQVRESLLK 314
                D N   E ++ D     I +E+VGT+KKVYS+VS++ G SLPEPAR+QVRE+LL 
Sbjct: 249 -----DAN---ESVNYDEKCTIINMEIVGTIKKVYSLVSKYGGTSLPEPARTQVREALLN 300

Query: 315 LPTKWMIN--------------SEKP-NSKRISSNKRALLLAQEALDMVGNVMNVVDGTL 359
           LPT W I+              +E P +   +++N + L+LA+E+L++V N+M+VVD +L
Sbjct: 301 LPTNWTISVNNSFFSSSTAPAATEPPKDEPLLTTNGKVLILAKESLNVVRNIMDVVDSSL 360

Query: 360 GKAEEWVKNKQELKQMLMEQFRHEQL 385
           GKAEEWVK KQELK+M+ EQF   QL
Sbjct: 361 GKAEEWVKQKQELKEMIREQFLQRQL 386

>ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH]
           complement(481129..482202) [1074 bp, 357 aa]
          Length = 357

 Score =  159 bits (402), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 80/157 (50%), Positives = 115/157 (73%), Gaps = 9/157 (5%)

Query: 251 EQAGNRKQDDTNKEQ----EDLDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSLPEPARS 306
           E +G R+ ++ + EQ     +  +   + +I++EVVGT+KKVYS++SRF G+SLPEPARS
Sbjct: 189 EDSGPREPEEEDGEQYFDASETIVSERSKEIKMEVVGTVKKVYSLISRFAGSSLPEPARS 248

Query: 307 QVRESLLKLPTKW--MINS---EKPNSKRISSNKRALLLAQEALDMVGNVMNVVDGTLGK 361
           QVRE+LLK+PT W   +NS   E P + R+S+N + L+LA+E+LDMV N++ V D TLG+
Sbjct: 249 QVRETLLKMPTNWSLTVNSASRETPTNARLSANSKMLILAEESLDMVSNIIQVFDMTLGR 308

Query: 362 AEEWVKNKQELKQMLMEQFRHEQLKQQVKHQLTKESA 398
           AEEWVK+KQELK+++  Q+   QLK +VK QL KE +
Sbjct: 309 AEEWVKHKQELKELIKSQYMEAQLKSKVKQQLEKEQS 345

 Score =  111 bits (278), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 118/204 (57%), Gaps = 50/204 (24%)

Query: 17  KDSEEIAVEALDKL---RNGDYSVTPSGSESSGKS-------ERLLDKMKQS-----AVD 61
           ++ E IA+EAL +L    NG+  +  S     G++       E LL +M+Q+     AV 
Sbjct: 10  EEHELIAIEALSRLCNGTNGETRLEKSHGAEQGQAQQHQDDGETLLCRMRQNPIFTNAVS 69

Query: 62  LYEQTRTNHPKLIRRADRLVKK-----IEKTSGIWI---GAAKRKIDEVDTQSNGXXXXX 113
           LYEQT+++HP   RRA+ LV++     + +TS +W    GA+K +++E            
Sbjct: 70  LYEQTKSHHPNFRRRAE-LVERSASTMVRRTSELWAPRDGASKHRLEE------------ 116

Query: 114 XXACVHG--LDIEHIKVQGKEICVTGKERGSKRRRIKENLKEYQLNMSIESKKRLMTCLG 171
             +C  G  LD E          V    R SKR++IKENLKEY+L MSIESKK+L+TCL 
Sbjct: 117 --SCETGTPLDDE----------VGPSPRVSKRQKIKENLKEYRLTMSIESKKQLITCLH 164

Query: 172 LLKLANKQLSQRVMSLQDVVKKEQ 195
           LLKLAN+QLS  V SLQD+V+KE+
Sbjct: 165 LLKLANRQLSSTVGSLQDLVQKER 188

>YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative
           regulator of phospholipid biosynthesis pathway [1215 bp,
           404 aa]
          Length = 404

 Score =  132 bits (333), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 101/175 (57%), Gaps = 37/175 (21%)

Query: 148 KENLKEYQLNMSIESKKRLMTCLGLLKLANKQLSQRVMSLQDVVKKEQXXXXXXXXXXXX 207
           K+NLKEY+LNMSIESKKRL+TCL LLKLANKQLS ++  LQD+V+KEQ            
Sbjct: 121 KDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEKEQ------------ 168

Query: 208 XDAEVRP--RNHCSVRETTSSAEHPGHXXXXXXXXXXXXASSQLNEQAGNRKQDDTNKEQ 265
               V P  +   + R TT + E                AS Q+N             EQ
Sbjct: 169 ----VHPLHKQDGNARTTTGAGEDETSSDEDDDDEEFFDASEQVNAS-----------EQ 213

Query: 266 EDLDIDAAANDIQLEVVGTLKKVYSVVSRFTGNSLPEPARSQVRESLLKLPTKWM 320
             +        +++EVVGT+KKVYS++S+FT NSLPEPARSQVRESLL LPT W 
Sbjct: 214 SIV--------VKMEVVGTVKKVYSLISKFTANSLPEPARSQVRESLLNLPTNWF 260

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 48/59 (81%), Gaps = 1/59 (1%)

Query: 322 NSEKPNSKRISSNKRALLLAQEALDMVGNVMNVVDGTLGKAEEWVKNKQELKQMLMEQF 380
           +S  P+S  +++N + L+LA+E+L+MV NVM VVD TLGKAEEWVK KQE+K+M+ E+F
Sbjct: 318 DSASPSSS-VTANGKVLILAKESLEMVRNVMGVVDSTLGKAEEWVKQKQEVKEMIRERF 375

>CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces
           cerevisiae YFL008w SMC1 chromosome segregation protein,
           start by similarity
          Length = 1223

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 9/73 (12%)

Query: 124 EHIKVQGKEICVTGKERGSKRRRIKENLKEYQLNMS--------IESKKRLMTCLGLLKL 175
           E +K Q  +IC    E   KRRRI   LK Y+  MS        ++ KKR+ T L L +L
Sbjct: 181 EELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQKKKRVQTNLSLWQL 240

Query: 176 ANKQLSQRVMSLQ 188
            + +  +R   LQ
Sbjct: 241 YHME-DERYQCLQ 252

>CAGL0M08052g 801812..805744 similar to sp|P39993 Saccharomyces
            cerevisiae YEL022w GEA2 or sp|P47102 Saccharomyces
            cerevisiae YJR031c GEA1, hypothetical start
          Length = 1310

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 8/87 (9%)

Query: 302  EPARSQVRESLLKLPTKWMINSEKPNSKRISSNKRALLLAQEALD-----MVGNVMNVVD 356
            EP R QV + L+ L TK   +SE+P    +       +L++   D      + N++  V 
Sbjct: 1227 EPLRVQVEQCLVAL-TKECSSSEQPEPSNLVQKYYLPVLSRNITDENVVVSLVNIITTVS 1285

Query: 357  GTLGKAEEWVKNKQELKQMLMEQFRHE 383
                    W  NK+ELK+++M    HE
Sbjct: 1286 NQCTDTNSW--NKEELKKIMMPFVNHE 1310

>Scas_97.1*
          Length = 261

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%)

Query: 21  EIAVEALDKLRNGDYSVTPSGSES 44
           E+A EA+  +RNGD ++TP  SES
Sbjct: 175 EMAKEAIKAVRNGDITITPKSSES 198

>Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement
          Length = 1104

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%)

Query: 21  EIAVEALDKLRNGDYSVTPSGSES 44
           E+A EA+  +RNGD ++TP  SES
Sbjct: 530 EMAKEAIKAVRNGDITITPKSSES 553

>AFL029W [3164] [Homologous to ScYBR238C - SH; ScYGL107C - SH]
           complement(383061..385064) [2004 bp, 667 aa]
          Length = 667

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%)

Query: 147 IKENLKEYQLNMSIESKKRLMTCLGLLKLANKQLSQRVMSL 187
           I+E+ + YQL+ SI S + L+  +G ++++N+Q+  R + L
Sbjct: 472 IEESYQIYQLSKSIVSCRILLKAMGCVEVSNEQIYSRWLRL 512

>CAGL0L06622g complement(743602..747015) similar to sp|P17442
           Saccharomyces cerevisiae YGR233c PHO81 cyclin-dependent
           kinase inhibitor, start by similarity
          Length = 1137

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 276 DIQLEVVGTLKKVYSVVSRFTGNSL 300
           D++L V+GTL   Y V+  F+G SL
Sbjct: 790 DLKLSVIGTLSVEYQVIQPFSGTSL 814

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.125    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,327,457
Number of extensions: 446530
Number of successful extensions: 1735
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1726
Number of HSP's successfully gapped: 42
Length of query: 399
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 295
Effective length of database: 12,995,837
Effective search space: 3833771915
Effective search space used: 3833771915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)