Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F25366g2242218511e-117
ABR049C2232215825e-76
YKL041W (VPS24)2242235443e-70
CAGL0L01837g2242225252e-67
Scas_625.72242225244e-67
Sklu_1576.22232225235e-67
Kwal_26.81562222225044e-64
Scas_668.262331301032e-05
YKL002W (DID4)232861013e-05
KLLA0B13343g2361221014e-05
ABR002C234122989e-05
CAGL0K02827g15353690.40
Kwal_23.6139131943661.8
ABR154C71960642.9
Kwal_26.792314853595.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F25366g
         (221 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F25366g 2361279..2361953 similar to sp|P36095 Saccharomyces...   332   e-117
ABR049C [640] [Homologous to ScYKL041W (VPS24) - SH] (482245..48...   228   5e-76
YKL041W (VPS24) [3217] chr11 (359787..360461) Protein involved i...   214   3e-70
CAGL0L01837g 211118..211792 highly similar to sp|P36095 Saccharo...   206   2e-67
Scas_625.7                                                            206   4e-67
Sklu_1576.2 YKL041W, Contig c1576 607-1278 reverse complement         206   5e-67
Kwal_26.8156                                                          198   4e-64
Scas_668.26                                                            44   2e-05
YKL002W (DID4) [3255] chr11 (437421..437480,437549..438187) Clas...    44   3e-05
KLLA0B13343g join(complement(1171345..1171404), similar to sp|P3...    44   4e-05
ABR002C [593] [Homologous to ScYKL002W (DID4) - SH] (400237..400...    42   9e-05
CAGL0K02827g 254429..254890 highly similar to sp|P36108 Saccharo...    31   0.40 
Kwal_23.6139                                                           30   1.8  
ABR154C [747] [Homologous to ScYOR381W (FRE3) - NSH; ScYKL220C (...    29   2.9  
Kwal_26.7923                                                           27   5.8  

>KLLA0F25366g 2361279..2361953 similar to sp|P36095 Saccharomyces
           cerevisiae YKL041w VPS24 endosomal Vps protein complex
           subunit singleton, start by similarity
          Length = 224

 Score =  332 bits (851), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 171/221 (77%)

Query: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKT 60
           MNFIKTAIWGPDPKEQHRKLKSILRKNDRQ              TQQLIKQAAKQNDIKT
Sbjct: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQLSKSLNELSSLKAKTQQLIKQAAKQNDIKT 60

Query: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120
           VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR
Sbjct: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120

Query: 121 LPQLRGTMIELEKELVKSGIITXXXXXXXXXXXXXXXXXXXXXXXXQIVAEYTSEKLGKV 180
           LPQLRGTMIELEKELVKSGIIT                        QIVAEYTSEKLGKV
Sbjct: 121 LPQLRGTMIELEKELVKSGIITEMMDDAMESYEDMEEEEEINEQVDQIVAEYTSEKLGKV 180

Query: 181 EETPNVVLSXXXXXXXXXXXXSNIDAEADNMIKAMKERLNA 221
           EETPNVVLS            SNIDAEADNMIKAMKERLNA
Sbjct: 181 EETPNVVLSEPPPAEQEVVPESNIDAEADNMIKAMKERLNA 221

>ABR049C [640] [Homologous to ScYKL041W (VPS24) - SH]
           (482245..482916) [672 bp, 223 aa]
          Length = 223

 Score =  228 bits (582), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 119/221 (53%), Positives = 143/221 (64%), Gaps = 1/221 (0%)

Query: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKT 60
           MNFIKTAIWG DP+EQHRK+K+ILRKN RQ              TQ LIK++AK ND+KT
Sbjct: 1   MNFIKTAIWGVDPREQHRKMKAILRKNHRQLDKSLRELAALKGKTQVLIKKSAKTNDVKT 60

Query: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120
           VR+YAKELY +NKQY+R+YTSKAQLQSVGMKIEE F MNK+Q  MAQSA LMR+VNSLV 
Sbjct: 61  VRIYAKELYQINKQYDRIYTSKAQLQSVGMKIEEAFHMNKMQQTMAQSAGLMREVNSLVS 120

Query: 121 LPQLRGTMIELEKELVKSGIITXXXXXXXXXXXXXXXXXXXXXXXXQIVAEYTSEKLGKV 180
           +PQLR TM+ELEKEL++SGI++                        QIV +YT  K   V
Sbjct: 121 VPQLRSTMMELEKELLRSGIVSEMVNDSLENIDMTVDDEEVDEQVEQIVMQYTGAKFNAV 180

Query: 181 EETPNVVLSXXXXXXXXXXXXSNIDAEADNMIKAMKERLNA 221
           +  P   L              +I  EADNM++ M+ERLNA
Sbjct: 181 DNVPETQLE-RQDALEEVVPEEDIKDEADNMLREMRERLNA 220

>YKL041W (VPS24) [3217] chr11 (359787..360461) Protein involved in
           sorting of proteins in the pre-vacuolar endosome,
           component of ESCRT-III complex with Did4p, Vps20p, and
           Snf7p [675 bp, 224 aa]
          Length = 224

 Score =  214 bits (544), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 113/223 (50%), Positives = 143/223 (64%), Gaps = 4/223 (1%)

Query: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKT 60
           M++IK AIWGPDPKEQ R+++S+LRKN R               TQQLIK++AK+ND++T
Sbjct: 1   MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRT 60

Query: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120
           VRLYAKELY +NKQY+RMYTS+AQL SV MKI+E  +MN L ++MA SA LMR+VNSLVR
Sbjct: 61  VRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVR 120

Query: 121 LPQLRGTMIELEKELVKSGIITXXXXXXXXX--XXXXXXXXXXXXXXXQIVAEYTSEKLG 178
           LPQLR TMIELEKEL+KSGII+                          +IV +YT+EK  
Sbjct: 121 LPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFK 180

Query: 179 KVEETPNVVLSXXXXXXXXXXXXSNIDAEADNMIKAMKERLNA 221
            V++ P V L+              +D EAD M+  M+ERL A
Sbjct: 181 NVDQVPTVELA--ANEEEQEIPDEKVDEEADRMVNEMRERLRA 221

>CAGL0L01837g 211118..211792 highly similar to sp|P36095
           Saccharomyces cerevisiae YKL041w VPS24, start by
           similarity
          Length = 224

 Score =  206 bits (525), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 113/222 (50%), Positives = 139/222 (62%), Gaps = 2/222 (0%)

Query: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKT 60
           M+++KTAIWGPD KEQ R +KS+LRKN RQ              TQ LIK++AK+ND++ 
Sbjct: 1   MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNKTQSLIKKSAKKNDVRN 60

Query: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120
           VRLYAKELYH+NKQY+RMYTSKAQL+SV MKI+E F+M  L ++MA S  LM +VNSLVR
Sbjct: 61  VRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLSNQMASSTGLMMEVNSLVR 120

Query: 121 LPQLRGTMIELEKELVKSGIITXX-XXXXXXXXXXXXXXXXXXXXXXQIVAEYTSEKLGK 179
           LPQL+GTMIELEKEL+KSGII+                         +IV +YTSEKL K
Sbjct: 121 LPQLQGTMIELEKELMKSGIISEMIDETMESIGDTDELNDEVDEEVNKIVEQYTSEKLAK 180

Query: 180 VEETPNVVLSXXXXXXXXXXXXSNIDAEADNMIKAMKERLNA 221
           VE  P   L                  EAD M+  M++RL A
Sbjct: 181 VENVPTTELPKSEQEEQEVPEEEIE-DEADKMLNDMRDRLRA 221

>Scas_625.7
          Length = 224

 Score =  206 bits (524), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 108/222 (48%), Positives = 139/222 (62%), Gaps = 2/222 (0%)

Query: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKT 60
           M++IK  IWGPDPKEQ R++K++LRKN+R               TQQLIK+AAK+NDIKT
Sbjct: 1   MDYIKKTIWGPDPKEQQRRIKAVLRKNNRALEKSLRDLTNLQNKTQQLIKRAAKKNDIKT 60

Query: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120
           VR+YA+ELY +NKQY RMY+SK QL SV  +I+E  ++  + DKMA+S  LMR+VNSLVR
Sbjct: 61  VRIYARELYQINKQYTRMYSSKVQLTSVSRQIDEALRLKTMSDKMAESTGLMREVNSLVR 120

Query: 121 LPQLRGTMIELEKELVKSGIITXXXXXXXXXXXXXXX-XXXXXXXXXQIVAEYTSEKLGK 179
           LP+L+GTMIELEKEL+KSGII+                         +IV +YT+EK  K
Sbjct: 121 LPELQGTMIELEKELMKSGIISEMVDETMDSVMESEELDEEVDAEVNKIVEQYTNEKFEK 180

Query: 180 VEETPNVVLSXXXXXXXXXXXXSNIDAEADNMIKAMKERLNA 221
           +   P   L               +D EAD M++ MKERLNA
Sbjct: 181 INNVPTTELP-AHEEEEKEIPEDQVDEEADKMLREMKERLNA 221

>Sklu_1576.2 YKL041W, Contig c1576 607-1278 reverse complement
          Length = 223

 Score =  206 bits (523), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 110/222 (49%), Positives = 142/222 (63%), Gaps = 3/222 (1%)

Query: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKT 60
           M+++K  +WGPDPKEQHRK+KSI+RKN R               TQQLIK+AAK+NDIK+
Sbjct: 1   MDYLKKVMWGPDPKEQHRKIKSIVRKNGRNIDKSLRELTVLQNKTQQLIKRAAKKNDIKS 60

Query: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120
           VR+YAKE+Y VNKQY RMYTSKAQL+SVGMKI+E F+M  L + MA SA LMR+VNSLV+
Sbjct: 61  VRIYAKEIYQVNKQYIRMYTSKAQLESVGMKIDEAFRMKNLSENMAASAGLMREVNSLVK 120

Query: 121 LPQLRGTMIELEKELVKSGIITXX-XXXXXXXXXXXXXXXXXXXXXXQIVAEYTSEKLGK 179
           LPQL+ +M+ELEKE++KSG+I+                         +IV++YTS+K   
Sbjct: 121 LPQLQSSMMELEKEIMKSGVISEMIDDTLEVADEDEEMESEIDEEVNKIVSQYTSDKFEI 180

Query: 180 VEETPNVVLSXXXXXXXXXXXXSNIDAEADNMIKAMKERLNA 221
           V+  P   L               I+ EADNM+  M+ERL A
Sbjct: 181 VDNVPTTELP--SKQEQELVPEEQIEDEADNMLNEMRERLKA 220

>Kwal_26.8156
          Length = 222

 Score =  198 bits (504), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 137/222 (61%), Gaps = 4/222 (1%)

Query: 1   MNFIKTAIWGPDPKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKT 60
           M+++K AIWGPDPKEQHRK++ ++R+N R               TQ LIK+AAKQND ++
Sbjct: 1   MDYLKKAIWGPDPKEQHRKIRGLVRRNGRSLDKSLRELAALQTKTQGLIKRAAKQNDTRS 60

Query: 61  VRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVR 120
           VR+YA+ELY ++KQY RMY SKAQLQSVGMKI+E F+M  LQ+ +A SA LMR+VNSLVR
Sbjct: 61  VRIYARELYQIDKQYKRMYISKAQLQSVGMKIDEAFRMQDLQENIALSAGLMREVNSLVR 120

Query: 121 LPQLRGTMIELEKELVKSGIITXXXXXXXXXXXXXXXXXXXXXXXX-QIVAEYTSEKLGK 179
           LP L+ TM+ LEKELVK+G+I                          +IV +YTS KL K
Sbjct: 121 LPYLQSTMMLLEKELVKNGLIGEMLDDSMELATEDEEMEEEVEQEVNKIVNQYTSAKLDK 180

Query: 180 VEETPNVVLSXXXXXXXXXXXXSNIDAEADNMIKAMKERLNA 221
           ++  P    S              ID EADNM+  M+ERL A
Sbjct: 181 IDNIPT---SEPPMAHEEIVPEDKIDDEADNMLNEMRERLKA 219

>Scas_668.26
          Length = 233

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 2/130 (1%)

Query: 7   AIWGPD--PKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKTVRLY 64
           A +G    P+E+ +K +  L +  R+                Q IK++AKQ  I   ++ 
Sbjct: 6   AFFGKSMTPQERLKKNQRALERAQRELEREKRKLATQEKKIIQEIKKSAKQGQINAAKIQ 65

Query: 65  AKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVRLPQL 124
           AK+L        +    + QLQ++ ++I+     +++   M ++  L+  +N  + LPQL
Sbjct: 66  AKDLVRTRNYMEKFDNMRTQLQAISLRIQAVRSSDQMTSSMREATGLLAGMNRSMNLPQL 125

Query: 125 RGTMIELEKE 134
           +   +E EK+
Sbjct: 126 QNISMEFEKQ 135

>YKL002W (DID4) [3255] chr11 (437421..437480,437549..438187) Class E
           vacuolar protein-sorting (vps) factor involved in
           endosome to vacuole transport, component of ESCRT-III
           complex with Vps24p, Vps20p, and Snf7p, has similarity
           to human BC-2 breast adenocarcinoma marker protein [699
           bp, 232 aa]
          Length = 232

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 47/86 (54%)

Query: 49  IKQAAKQNDIKTVRLYAKELYHVNKQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQS 108
           IK++AK   +   ++ AK+L        +    KAQLQ++ ++I+     +++   M+++
Sbjct: 50  IKKSAKNGQVAAAKVQAKDLVRTRNYIQKFDNMKAQLQAISLRIQAVRSSDQMTRSMSEA 109

Query: 109 AVLMRDVNSLVRLPQLRGTMIELEKE 134
             L+  +N  + LPQL+   +E EK+
Sbjct: 110 TGLLAGMNRTMNLPQLQRISMEFEKQ 135

>KLLA0B13343g join(complement(1171345..1171404), similar to
           sp|P36108 Saccharomyces cerevisiae YKL002w class E
           vacuolar-protein sorting and endocytosis factor
           singleton, start by similarity
          Length = 236

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 58/122 (47%)

Query: 13  PKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKTVRLYAKELYHVN 72
           P+E+ RK +  L +  R+                Q IK++AK   +   ++ AK+L    
Sbjct: 14  PQERMRKNQRALERAQRELEREKKKLEAQEKKLIQEIKKSAKNGQVNAAKIQAKDLVRTR 73

Query: 73  KQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVRLPQLRGTMIELE 132
           K   +    K QLQ++ ++++     +++   M ++  L+  +N  + LPQL+   +E E
Sbjct: 74  KYTEKFGNMKTQLQAISLRVQAVRSSDQMAVSMREATGLLAGMNRSMNLPQLQRISMEFE 133

Query: 133 KE 134
           K+
Sbjct: 134 KQ 135

>ABR002C [593] [Homologous to ScYKL002W (DID4) - SH]
           (400237..400881,400948..401007) [705 bp, 234 aa]
          Length = 234

 Score = 42.4 bits (98), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 59/122 (48%)

Query: 13  PKEQHRKLKSILRKNDRQXXXXXXXXXXXXXXTQQLIKQAAKQNDIKTVRLYAKELYHVN 72
           P+E+ +K ++ L +  R+                Q IK++AK   I   ++ AK+L    
Sbjct: 14  PQERLKKNQNALDRTQRELEREKRKLEAQEKRLVQDIKKSAKNGQINAAKIQAKDLVRTK 73

Query: 73  KQYNRMYTSKAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVRLPQLRGTMIELE 132
           +   +    K QLQ++ ++I+     +++   M ++  L+  +N  + LPQL+   +E E
Sbjct: 74  RYIEKFNGMKTQLQAISLRIQAVRSSDQMAISMREATGLLSSMNRSMNLPQLQRISMEFE 133

Query: 133 KE 134
           ++
Sbjct: 134 RQ 135

>CAGL0K02827g 254429..254890 highly similar to sp|P36108
           Saccharomyces cerevisiae YKL002w, start by similarity
          Length = 153

 Score = 31.2 bits (69), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%)

Query: 82  KAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVRLPQLRGTMIELEKE 134
           KAQLQ++ ++I+     +++   M ++  L+  +N  + LPQL+   +E EK+
Sbjct: 2   KAQLQAISLRIQAVRSSDQMTRSMREATGLLAGMNRSMNLPQLQKISMEFEKQ 54

>Kwal_23.6139
          Length = 1319

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 90   MKIEECFQMNKLQDKMAQSAVLMRDVNSLVRLPQLRGTMIELE 132
            MK  +  Q+N +   + ++AV+ R  +  +R+P+  G  +ELE
Sbjct: 1241 MKNPKNLQLNAIDTPLYKNAVISRTPSGAIRVPEKNGVWLELE 1283

>ABR154C [747] [Homologous to ScYOR381W (FRE3) - NSH; ScYKL220C
           (FRE2) - NSH] (688262..690421) [2160 bp, 719 aa]
          Length = 719

 Score = 29.3 bits (64), Expect = 2.9,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 6/60 (10%)

Query: 57  DIKTVRLYAKELYHVNKQYNRMYTSK------AQLQSVGMKIEECFQMNKLQDKMAQSAV 110
           ++ T  LY+K+  HV  +YNR  TS+      A L    + +  C   N + D  A  A+
Sbjct: 641 EVTTSLLYSKQFAHVEFRYNRPDTSQLIAGDMADLAGASVAVMSCASPNMVDDIRAAVAL 700

>Kwal_26.7923
          Length = 148

 Score = 27.3 bits (59), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%)

Query: 82  KAQLQSVGMKIEECFQMNKLQDKMAQSAVLMRDVNSLVRLPQLRGTMIELEKE 134
           K QLQ++ ++I+     +++   M ++  L+  +N  + LPQ++    E EK+
Sbjct: 2   KTQLQAISLRIQAVRSSDQMTTSMREATGLLASMNRSMNLPQIQLISAEFEKQ 54

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.128    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,773,007
Number of extensions: 129255
Number of successful extensions: 409
Number of sequences better than 10.0: 18
Number of HSP's gapped: 395
Number of HSP's successfully gapped: 18
Length of query: 221
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 123
Effective length of database: 13,203,545
Effective search space: 1624036035
Effective search space used: 1624036035
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)