Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F25322g1269125061110.0
YMR012W (CLU1)1277126824390.0
Kwal_26.81611229124323840.0
CAGL0M07722g1267126023540.0
ABR050W1228126723270.0
Scas_709.561281127922750.0
Kwal_55.2202872684723.2
Scas_489.662294713.3
KLLA0C10362g52668697.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F25322g
         (1250 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690 S...  2358   0.0  
YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiat...   944   0.0  
Kwal_26.8161                                                          922   0.0  
CAGL0M07722g complement(774048..777851) similar to sp|Q03690 Sac...   911   0.0  
ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH] complement(4...   900   0.0  
Scas_709.56                                                           880   0.0  
Kwal_55.22028                                                          32   3.2  
Scas_489.6                                                             32   3.3  
KLLA0C10362g complement(888123..889703) similar to sgd|S0002707 ...    31   7.1  

>KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w CLU1 translation
            initiation factor eIF3 (p135 subunit) singleton,
            hypothetical start
          Length = 1269

 Score = 2358 bits (6111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1176/1250 (94%), Positives = 1176/1250 (94%)

Query: 1    MSADNIEVIVKGTPSYTKSKNSDIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSR 60
            MSADNIEVIVKGTPSYTKSKNSDIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSR
Sbjct: 1    MSADNIEVIVKGTPSYTKSKNSDIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSR 60

Query: 61   VVDDEDVLGDLAGNGSSLTFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISS 120
            VVDDEDVLGDLAGNGSSLTFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISS
Sbjct: 61   VVDDEDVLGDLAGNGSSLTFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISS 120

Query: 121  GSQFQDMSLEPNSEKSNGSETTISDQEKVKFLQTCNELLESTNTDFNIASLKTGNLLVTP 180
            GSQFQDMSLEPNSEKSNGSETTISDQEKVKFLQTCNELLESTNTDFNIASLKTGNLLVTP
Sbjct: 121  GSQFQDMSLEPNSEKSNGSETTISDQEKVKFLQTCNELLESTNTDFNIASLKTGNLLVTP 180

Query: 181  VLKSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPK 240
            VLKSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPK
Sbjct: 181  VLKSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPK 240

Query: 241  DEFEPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVSQLPSNN 300
            DEFEPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVSQLPSNN
Sbjct: 241  DEFEPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVSQLPSNN 300

Query: 301  GDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAVKGAM 360
            GDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAVKGAM
Sbjct: 301  GDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAVKGAM 360

Query: 361  AIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQDLQIINS 420
            AIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQDLQIINS
Sbjct: 361  AIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQDLQIINS 420

Query: 421  LNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKEVAEPMETLISV 480
            LNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKEVAEPMETLISV
Sbjct: 421  LNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKEVAEPMETLISV 480

Query: 481  NYGYDDFVATLKFDEKFHEKVCEFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQRAYILD 540
            NYGYDDFVATLKFDEKFHEKVCEFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQRAYILD
Sbjct: 481  NYGYDDFVATLKFDEKFHEKVCEFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQRAYILD 540

Query: 541  LANTNPVDIEFVKAHYDDVKENKYPHRQXXXXXXXXXXWRAEKIAASGKTLQEASEDVSF 600
            LANTNPVDIEFVKAHYDDVKENKYPHRQ          WRAEKIAASGKTLQEASEDVSF
Sbjct: 541  LANTNPVDIEFVKAHYDDVKENKYPHRQVLLRRELVERWRAEKIAASGKTLQEASEDVSF 600

Query: 601  IYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTDLFHTNGVN 660
            IYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTDLFHTNGVN
Sbjct: 601  IYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTDLFHTNGVN 660

Query: 661  MRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIKERQEEINK 720
            MRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIKERQEEINK
Sbjct: 661  MRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIKERQEEINK 720

Query: 721  YVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIARSIKHIFR 780
            YVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIARSIKHIFR
Sbjct: 721  YVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIARSIKHIFR 780

Query: 781  QQSKKLSSPTLVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYTREQLIEEV 840
            QQSKKLSSPTLVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYTREQLIEEV
Sbjct: 781  QQSKKLSSPTLVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYTREQLIEEV 840

Query: 841  RVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQKFGIQLINKEYFFTKEQYEKWKQAQ 900
            RVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQKFGIQLINKEYFFTKEQYEKWKQAQ
Sbjct: 841  RVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQKFGIQLINKEYFFTKEQYEKWKQAQ 900

Query: 901  DKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAVSVXXXXXXXX 960
            DKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAVSV        
Sbjct: 901  DKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAVSVEEEEAEKK 960

Query: 961  XXXXXXXXXXXXXXXXXXXTSXXXXXXXXXXXXMNEALTLLGQSIAFREDIFGLVHPSLV 1020
                               TS            MNEALTLLGQSIAFREDIFGLVHPSLV
Sbjct: 961  KEESKKAAADGEDAGSSGATSKEEEQAKERAKKMNEALTLLGQSIAFREDIFGLVHPSLV 1020

Query: 1021 SSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAYLEYGQGSIYN 1080
            SSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAYLEYGQGSIYN
Sbjct: 1021 SSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAYLEYGQGSIYN 1080

Query: 1081 SAXXXXXXXXXXXXXAPFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKLSELLLKITGS 1140
            SA             APFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKLSELLLKITGS
Sbjct: 1081 SALVLKKVHELLKLLAPFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKLSELLLKITGS 1140

Query: 1141 EETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLTSKQWSETIKG 1200
            EETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLTSKQWSETIKG
Sbjct: 1141 EETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLTSKQWSETIKG 1200

Query: 1201 IITKQQQEKKLASAQQATKPANIXXXXXXXXXXXXPALTNKSVDELLQFI 1250
            IITKQQQEKKLASAQQATKPANI            PALTNKSVDELLQFI
Sbjct: 1201 IITKQQQEKKLASAQQATKPANISQKKGKKSSSSSPALTNKSVDELLQFI 1250

>YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiation
            factor eIF3, p135 subunit [3834 bp, 1277 aa]
          Length = 1277

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1268 (40%), Positives = 753/1268 (59%), Gaps = 86/1268 (6%)

Query: 19   SKNSDIKYQLGKESNVSHLRTFLSFEESTKFYTSYDL--IENSRVVDDEDVLGDLAGNGS 76
            SKN+DI +++GKES +  +   L+   S+K+ T+  L  IE    + DE  + ++ G  S
Sbjct: 38   SKNNDISFEIGKESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKS 97

Query: 77   SLTFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQFQDMSLEPNSEKS 136
             L  Q   K Y+   A++H++ +R+ +GF+ E  DG+SEFAIS+GS F  + L P  E+S
Sbjct: 98   ELKLQLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIKERS 157

Query: 137  NGSETT--------------ISDQEKVKFLQTCNELLES-TNTDFNIASLKTGNLLVTPV 181
               E                ++D+EK+KF +  +E+  S  N+  N       N+ +TP 
Sbjct: 158  KQEEKDEKSDPEEKKNTFKDVTDEEKLKFNEMVHEVFSSFKNSSINKLLTSESNI-ITPC 216

Query: 182  LKSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPKD 241
            ++SL F+ YNPVP FY++KGHL YLQ  TLE E+F+IT   SGFYVNKS+S KFDPSPK+
Sbjct: 217  VRSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKE 276

Query: 242  EFEPK-------FNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVS 294
              +         ++L DL+   SKKF  HV +   KLS+ DS  YV+P++ FL KPW VS
Sbjct: 277  NTDENAHSSLIYYSLFDLIASRSKKFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVS 336

Query: 295  QLPSNNGDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSE 354
             LP NN D++R Q    +   ERNF DEFQAIKDL  ++  DR++ E++ + ++HEF+  
Sbjct: 337  SLPPNNPDYLRLQTAALDTTPERNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVT 396

Query: 355  AVKGAMAIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQD 414
            A  GAM+IF ++   ++P +   + ++   ++ +S+V+DVSG Y   GG+EAA A +NQD
Sbjct: 397  AASGAMSIFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQD 456

Query: 415  LQIINSLNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEE-DKEVAEP 473
            L+ IN LNRL +  +R+ LT ++++AG R+L Q+PVPGLL  +G  I+ D    +EV E 
Sbjct: 457  LKTINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTED 516

Query: 474  METLISVNYGYDDFVATLKFDEKFHEKVCE--FSKNFYLKEHKVEEVDLRISSKSKGIFG 531
                I+V YG D+ +  + +D  F + V E  F K F+LK+HKV   +L  SS+SKGI G
Sbjct: 517  FVNDINVKYGLDEGLGKIVYDADF-DSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVG 575

Query: 532  VDQRAYILDLANTNPVDIEFVKAHYDDVKE--NKYPHRQXXXXXXXXXXWRAEKIAASGK 589
             D+R YILDLANT P+DI F + ++D+++E  N+YPHRQ          W   K+   G 
Sbjct: 576  FDKRRYILDLANTYPLDINFARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGV 635

Query: 590  TLQEASEDVSFIYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQH 649
              ++A E+  F YNPDAY ++G+ED NV +MS +L   V+   ++D L GN + PY+G+H
Sbjct: 636  EFEKAYEENLFSYNPDAYQVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEH 695

Query: 650  LTDLFHTNGVNMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEK 709
            L D  H NG+NMRYLGK IE  + + + Q     + L  +EQ+NKEY+DWE  YL K+E 
Sbjct: 696  LADTLHKNGINMRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIEN 755

Query: 710  LIKERQEEINKYVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELE 769
            +IKERQ +INK VQ+GKEVP +L E ++L+  ++K+P   +   V  D+   LI + ELE
Sbjct: 756  MIKERQAKINKLVQEGKEVPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELE 815

Query: 770  MIARSIKHIFRQQSKKLSSPT-LVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEF 828
            +++RS+KH+ +  SK +  P  LVP LVA+  N+L G +YN     E +D  + +N+  F
Sbjct: 816  IVSRSLKHVLKDLSKDV--PVFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKCSF 873

Query: 829  AQYTREQLIEEVRVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQKFGIQLINKEYFF 888
            A+ TR +L+E V  QA LRFR+ L S W +   +  + + LIR+++ KFGIQL+NKEYFF
Sbjct: 874  AKLTRSELLEAVSKQAFLRFRHQLPSNWIEAYME--NPFTLIRSVSYKFGIQLLNKEYFF 931

Query: 889  TKEQYEKWKQAQDKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVN 948
            T+EQ E +KQ+ DKK+R+K V+P  TFS++D ++ P +K +E+ S ++EE W QGAS++N
Sbjct: 932  TREQLESYKQSLDKKIRNKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMIN 991

Query: 949  AVSVXXXXXXXXXXXXXXXXXXXXXXXXXXXTSXXXXXXXXXXXXMNEALTLLGQSIAFR 1008
                                                            ALTLL QSI   
Sbjct: 992  -------------------------------------------EDKQSALTLLAQSITVL 1008

Query: 1009 EDIFGLVHPSLVSSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNL 1068
            ED+  ++HP++   YL LS +Y++L  Y +A+ FC KA  + ER  G+DSFE +R L+NL
Sbjct: 1009 EDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALTNL 1068

Query: 1069 AYLEYGQGSIYNSAXX-XXXXXXXXXXXAPFV-HSGRVNVFNLLFQIAASTEDKKVQIKI 1126
            A LE+   S YN+                P + H    ++FN L Q+A   +D K+ I++
Sbjct: 1069 AILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEV 1128

Query: 1127 LNKLSELLLKITGSEETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQ 1186
            L +LS  ++++ G +++L YG  ESR+ NL+ +L D   AL HI   + IF+K+LG+N  
Sbjct: 1129 LGQLSSYVVELEG-KDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHT 1187

Query: 1187 TTLTSKQWSETIKGIITKQQQEKKLASAQQATKPANIXXXXXXXXXXX----XPALTNKS 1242
             +  S+QW   +  +I   +Q+K+LA  Q +T  +N                 P L NKS
Sbjct: 1188 HSAQSRQWVNGLSSLIMDLKQKKQLAQDQMSTTGSNSAGHKKTNHRQKKDDVKPELANKS 1247

Query: 1243 VDELLQFI 1250
            VDELL FI
Sbjct: 1248 VDELLTFI 1255

>Kwal_26.8161
          Length = 1229

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/1243 (40%), Positives = 737/1243 (59%), Gaps = 65/1243 (5%)

Query: 23   DIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSRVVDDEDVLGDLAGNGSSLTFQF 82
            +++  L K S V  +   L F  ST+  T+ +     + +  E+ L DLA     +    
Sbjct: 21   EVQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKLSGEESLLDLASE-DKVKLDV 79

Query: 83   KPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQFQDMSLEP-------NSEK 135
            K  AY    A++H+  +R+T+GF+SE  DGIS+FA+S+G QF DM L P         +K
Sbjct: 80   KFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQFCDMPLRPVEHAAPQEEDK 139

Query: 136  SNGSETTISDQEKVKFLQTCNELLESTNTDFNIASLKTGNLLVTPVLKSLHFSAYNPVPA 195
            +  +   IS+ EK  F +T  + L    T   +  LKT + ++TP L++L  S YNPVP 
Sbjct: 140  TASTAFKISEDEKNDFQRTVKDTLNQGKTVNEV--LKTRSGIITPCLRALALSGYNPVPP 197

Query: 196  FYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPKDEF-EPKFNLIDLLT 254
            FY+ KGHLLYLQA++LE E FHIT +  GFYVNKS++ KFDPSP+D+    K +L+DLL+
Sbjct: 198  FYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPSPRDDAGATKVSLLDLLS 257

Query: 255  QVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVSQLPSNNGDFMRTQLEHFNND 314
              SKKF  H+ +L  ++SS D+  + +P++ FL KPWL+S +P+++GD+ R QL   + +
Sbjct: 258  THSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMPTSSGDYARLQLSEVDFN 317

Query: 315  DERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAVKGAMAIFNNELTPIDPGT 374
             ERNF DEFQAIKD+  +     +  EK+TA +  EF   AV+ AM+IF  +L  ++P  
Sbjct: 318  TERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVRDAMSIFYADLVAMNPEA 377

Query: 375  TGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQDLQIINSLNRLGLKGIRHCLT 434
              +  ++   ++ +SFV DV+G YS IGG+ AA+A +NQDLQ +  L+R+ L  I + L 
Sbjct: 378  PTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQTVKLLHRVSLPEIHYLLC 437

Query: 435  AIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKE-VAEPMETLISVNYGYDDFVATLKF 493
             IID+AG R+L Q+PVPGLL+ +G     D +  E V E + + +++ YG D+    + +
Sbjct: 438  TIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVSDVNIVYGQDEASGDVLY 497

Query: 494  DEKFHEKVCEFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQRAYILDLANTNPVDIEFVK 553
            +++F + +  FSK F+L++HK   V+++ SS SKGI G D+R YILDLAN+ P+D+EF  
Sbjct: 498  NQEFDDALESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRKYILDLANSQPLDVEFAT 557

Query: 554  AHYDDVKEN-KYPHRQXXXXXXXXXXWRAEKIAASGKTLQEASEDVSFIYNPDAYVIDGV 612
             +YD V E+ +YPHRQ          W A K+  S     +A E+  F  NPDAYV++GV
Sbjct: 558  GNYDGVPESERYPHRQTLVRNELVDKWWANKLDESKLDFNKAFEENKFAINPDAYVVEGV 617

Query: 613  EDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTDLFHTNGVNMRYLGKAIEFVK 672
            ED  V D+SK+LN+ VL   + +   GN  +PYDG HLT+  H NG+NMRYLGK I   +
Sbjct: 618  EDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLHKNGINMRYLGKLISLAE 677

Query: 673  AKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIKERQEEINKYVQQGKEVPSKL 732
             +YE Q ++    L+ +   N++++ WE  YL KVEK IKERQE+INK V +GKE+P +L
Sbjct: 678  KEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQEKINKLVHEGKEIPEEL 737

Query: 733  KEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIARSIKHIFRQQSKKLSSPTLV 792
            K  ++LD+ D+++P + E   V  DQ   LI V +LE++ARS+KHI R  SK L   +LV
Sbjct: 738  KGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSLKHILRDYSKGLPV-SLV 796

Query: 793  PHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYTREQLIEEVRVQAKLRFRYDL 852
            P +VA+F NLLFG SYN S  VE +D  F      F   +R  L++ ++ QAK RF YDL
Sbjct: 797  PSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDLLKAIQGQAKRRFIYDL 856

Query: 853  TSEWF-DINEKRFSKYALIRAIAQKFGIQLINKEYFFTKEQYEKWKQAQDKKLRSKIVDP 911
            + E   D+  K F   ALIRA++++FGIQL+NKEYFF  E+YE +KQ+QDKK RSK+  P
Sbjct: 857  SEEALEDLCAKPF---ALIRAVSKRFGIQLLNKEYFFNSEEYETFKQSQDKKTRSKLSKP 913

Query: 912  KQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAVSVXXXXXXXXXXXXXXXXXXX 971
              TFS ND ++ P IK  +++SL  +  W QGA+++N                       
Sbjct: 914  LSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILNEKEA------------------- 954

Query: 972  XXXXXXXXTSXXXXXXXXXXXXMNEALTLLGQSIAFREDIFGLVHPSLVSSYLLLSNMYS 1031
                                    + L LL Q++  +E++ G VH S+  SY+ +S +Y 
Sbjct: 955  ------------------------DGLVLLSQALKIKEEVNGTVHQSVAESYMAMSTIYH 990

Query: 1032 RLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAYLEYGQGSIYNSAXXXXXXXXX 1091
             L +  +A+TFC +A  + ER  GVDSFE +R L+NLA LE    S  N+A         
Sbjct: 991  TLKRIPEAITFCRRACGIYERTCGVDSFEVLRCLTNLAVLELSNKSPSNAAVVLQRILCT 1050

Query: 1092 XXXXAPFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKLSELLLKITGSEETLPYGQNES 1151
                   +H   +N + +L Q + + +D ++ I++L KLS  +L+I   + +L YG N+S
Sbjct: 1051 MNALCVTIHPATINSYTMLQQASLACKDARLAIEVLKKLSSTILEIEDGQHSLAYGYNQS 1110

Query: 1152 RIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLTSKQWSETIKGIITKQQQEKKL 1211
            RI +LY ++ D + +L  I +AK++F++ELG+ND+TT   +QW + ++G++  Q+Q++ L
Sbjct: 1111 RIGDLYVTMKDYTSSLKAISEAKNVFTRELGVNDETTAQCRQWVQALEGLLQSQKQQQTL 1170

Query: 1212 ASAQQATKPANIXXXXXXXXXXX----XPALTNKSVDELLQFI 1250
               Q A   A                  P L NKSVDELL FI
Sbjct: 1171 NQQQTAANSAGTTRMRKQKNSKNDEKPRPDLANKSVDELLSFI 1213

>CAGL0M07722g complement(774048..777851) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w translation initiation
            factor eIF3, hypothetical start
          Length = 1267

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1260 (39%), Positives = 746/1260 (59%), Gaps = 82/1260 (6%)

Query: 24   IKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSR----VVDDEDVLGDLAGNGSSLT 79
            I  Q  K+S + ++  FLS   +TK++T+Y+L +NS     +  +E  L +L  +     
Sbjct: 35   ITLQFRKDSKLQNVLDFLSIAPATKYFTNYNL-KNSTGDLLLSSEEKTLRELCSDKDEYK 93

Query: 80   FQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQFQDMSLEPNSEKSNGS 139
               + K YN   A++H++  R+  GF+SE EDG+S  A+S+GS+F  + L+   EKS  +
Sbjct: 94   VALELKPYNQYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPEN 153

Query: 140  E-----------TTISDQEKVKFLQTCNELLESTNTDFNIAS---LKTGNLLVTPVLKSL 185
            E             ++D+EKV+F    + L E+   +  +     + T   +VTP L+S+
Sbjct: 154  EDKDTENKKPTSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSI 213

Query: 186  HFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPKDEF-- 243
            +FS YNPVPAFY+ KGHL YLQ  TLE E+  +T   SGFY+NKS++ KFDPSPK+    
Sbjct: 214  NFSPYNPVPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGH 273

Query: 244  --EPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVSQLPSNNG 301
                 + L DLL   SK F  H++SL  K    +S  YV+PA   L+KPWL+  +P+N  
Sbjct: 274  VDTVHYTLYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGP 333

Query: 302  DFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAVKGAMA 361
            D++RTQ++ FN + ERNF DEFQ+IK++  N+   R+++E+I A L HEF   A KGAM 
Sbjct: 334  DYLRTQIDSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMD 393

Query: 362  IFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQDLQIINSL 421
            I     T ++P +  E  ++   ++ +SFV D++ TY+  GG+EAA A ANQDL+ +N L
Sbjct: 394  ILYGNGTAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLRTLNML 453

Query: 422  NRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNI--IVDEEDKEVAEPMETLIS 479
             RL L  I H LT I+D+ G R+L Q+PVPGLL+P+GV I    + +++ V+E + + I 
Sbjct: 454  TRLNLPNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSE-LSSDIC 512

Query: 480  VNYGYDDFVATLKFDEKFHEKVC-EFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQRAYI 538
            V YG D+    + F+E+F E +  +F+K+F+LK+H ++  +L  SS+SKGI G D+R YI
Sbjct: 513  VKYGLDENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYI 572

Query: 539  LDLANTNPVDIEFVKAHYDDVKE--NKYPHRQXXXXXXXXXXWRAEKIAASGKTLQEASE 596
            LDLANT P+D+EF K ++DDVKE   KYPHRQ          W A KI      L +A E
Sbjct: 573  LDLANTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYE 632

Query: 597  DVSFIYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTDLFHT 656
            +  + YNPDAY + GVEDE V ++SK+LN+ ++   ++D L GN   PY+G+HL D FH 
Sbjct: 633  ENLYSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHK 692

Query: 657  NGVNMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIKERQE 716
            NGVNMRYLGK    VK +   Q++     L+++  +NKEY++WE  YL K+E +IKERQ 
Sbjct: 693  NGVNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQA 752

Query: 717  EINKYVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIARSIK 776
            +INK VQ+GKEVP +L E ++LD  ++K+P   +   V  D+   LI   ELE+I+RS+K
Sbjct: 753  KINKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLK 812

Query: 777  HIFRQQSKKLSSPTLVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYTREQL 836
            HI R+ S+ L  P ++P L++F  NLLFG +YN +  VE++D L+ +++ EF   T + L
Sbjct: 813  HILRKYSRSL-PPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTL 871

Query: 837  IEEVRVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQKFGIQLINKEYFFTKEQYEKW 896
            ++E+  +A +R+RY+L  +WF   E     + LIR+I  KFG+QL+NK+YFF+ EQ E++
Sbjct: 872  LKEIEQEAVVRYRYELEGDWF--AEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEY 929

Query: 897  KQAQDKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAVSVXXXX 956
            KQ+ DKK R+K V P  TFS++D ++ P IK  ++ S I+EELW QGAS++N        
Sbjct: 930  KQSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIIN-------- 981

Query: 957  XXXXXXXXXXXXXXXXXXXXXXXTSXXXXXXXXXXXXMNEALTLLGQSIAFREDIFGLVH 1016
                                                   + LTLL QSI F+E++  ++H
Sbjct: 982  -----------------------------------ENQKDGLTLLAQSIGFKEEVNSILH 1006

Query: 1017 PSLVSSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAYLEYGQG 1076
             S+   YL LS +Y++LG  ++A+ FC K+  + ER  GVDSFE +R L+NLA LE+   
Sbjct: 1007 SSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRALTNLATLEFANE 1066

Query: 1077 SIYNSAXXXXXXXXXXXXXA--PFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKLSELL 1134
            S YN A                   H    N+FN L Q++   +D K+ +++L  L + L
Sbjct: 1067 SPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKLAVEVLKSLGDFL 1126

Query: 1135 LKITGSEETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLTSKQW 1194
            + I G+ E+LPY   +S++ NL  + +  S AL+ I+ A+ IF+KELG N  +T  ++QW
Sbjct: 1127 VSIDGT-ESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIFTKELGTNHGSTAQARQW 1185

Query: 1195 SETIKGIITKQQQEKKLASAQQAT----KPANIXXXXXXXXXXXXPALTNKSVDELLQFI 1250
             + +  +I    Q+K+L   Q A     +                P L +KSVDELL FI
Sbjct: 1186 VDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKETTNPDLADKSVDELLSFI 1245

>ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH]
            complement(483635..487321) [3687 bp, 1228 aa]
          Length = 1228

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1267 (38%), Positives = 736/1267 (58%), Gaps = 82/1267 (6%)

Query: 4    DNIEVIVKGTPSYTKSKNSDIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSRVVD 63
            D +EV ++  P + KSK   +     + + V  +  FL+F  ++K+YT+Y+L+ N   VD
Sbjct: 6    DTVEVSIR-VP-FGKSKR--LSTTASRRARVQSIMYFLAFNAASKYYTNYELLHNGVEVD 61

Query: 64   DEDVLGDLAGNGSSLTFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQ 123
            ++ ++ +LAGN  ++  Q + K YN    ++H V  RE +GF  + +D I+  A+S+ ++
Sbjct: 62   EQQLISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAK 121

Query: 124  FQDMSLEPNSEKSNGSETT---------ISDQEKVKFLQTCNELLESTNTDFNIASLKTG 174
            F+++ L   +  S  +E           +SD EK  F +  + +LE   +  ++  LK G
Sbjct: 122  FRELPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTKELDSILELRPSAQDV--LKGG 179

Query: 175  NLLVTPVLKSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVK 234
            + L  P L+SL  S YNPVPAF++ KGHLLYLQA TLE ET HIT ++SGFYVNKSS++K
Sbjct: 180  SALSKPCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIK 239

Query: 235  FDPSPKDEFEPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVS 294
            FDP+ K +      L +LLT+ SKKF  H++ L   L + +S  YVKP S FL K W  S
Sbjct: 240  FDPTLKTDAAVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPS 299

Query: 295  QLPSNNGDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSE 354
             LPSN+ DF   QLE  N   ERNF DEFQA+K+        RL+ EK+   +IH+FN  
Sbjct: 300  SLPSNSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVA 359

Query: 355  AVKGAMAIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQD 414
            A KG+M IF   +  ++P    +  ++   ++ +SFV+D+ G Y   GG+ AA+A +NQD
Sbjct: 360  ASKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQD 419

Query: 415  LQIINSLNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKEVAEPM 474
            L II +L +  ++ +RH L A++          SPVPG+L   G+  I +E+ +E A   
Sbjct: 420  LHIIKTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEKGEEEAIQA 479

Query: 475  ETLISVNYGYDDFVATLKFDEKFHEKVCEFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQ 534
            +  I+V YG+D+    +  D +F   + +F+K F+LK+H+V+ V+L+++S SKG+ G D+
Sbjct: 480  KNDITVCYGFDEASNKVIADAEFGSSLDDFAKVFHLKKHEVDGVELKVASTSKGVVGFDK 539

Query: 535  RAYILDLANTNPVDIEFVKAHYDDVKENK--YPHRQXXXXXXXXXXWRAEKIAASGKTLQ 592
            R YILDLA+ NP+D+ F   ++D V + K  YPHRQ          W   K+  +G  ++
Sbjct: 540  RNYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEME 599

Query: 593  EASEDVSFIYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTD 652
             A E+  F YNPDAY I+G+EDE V ++S +L   V+   ++++ +G+   P++G+HL D
Sbjct: 600  AAYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVD 659

Query: 653  LFHTNGVNMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIK 712
            + H NG+N+RYLG+ IE  + + E Q+  R  +L ++E +NKE+ +WE  YL  +E LIK
Sbjct: 660  IMHKNGINIRYLGRVIELAEQELEAQRALREAHLQQVEADNKEFTEWEANYLKHIESLIK 719

Query: 713  ERQEEINKYVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIA 772
            ERQ  I K + +GKEVP++LKE+++LD  ++++P   EG  V  DQ   L+ + ++E+I+
Sbjct: 720  ERQVTIQKLLAEGKEVPAELKEELKLDDKEIRKPHEKEGVAVNNDQLSVLLTLAQIEIIS 779

Query: 773  RSIKHIFRQQSKKLSSPTLVPHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYT 832
            RSIKH+FR+   +L +  ++P  +AF LNLLFG  YN++   E      DI+   F + T
Sbjct: 780  RSIKHVFRKHCHELPA-VIIPTFIAFALNLLFGYCYNKAPIAEFPTDGSDID-FAFTKLT 837

Query: 833  REQLIEEVRVQAKLRFRYDLTSEWFDINEKRF--SKYALIRAIAQKFGIQLINKEYFFTK 890
            REQL+ E+  QA LRFRY L   W    E R+  + +AL+R I  KFGIQL+NKEYFFT+
Sbjct: 838  REQLLSEISEQAVLRFRYTLPDGW----ESRYEHTPFALLRPICNKFGIQLLNKEYFFTR 893

Query: 891  EQYEKWKQAQDKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAV 950
            EQY+ W+QAQD ++RSK+V+P  TFSIND S+R +I  A   + ++++ W QGA ++N  
Sbjct: 894  EQYQNWRQAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMIN-- 951

Query: 951  SVXXXXXXXXXXXXXXXXXXXXXXXXXXXTSXXXXXXXXXXXXMNEALTLLGQSIAFRED 1010
                                                          AL L  Q+IAFRE+
Sbjct: 952  ---------------------------------------DEDKQATALGLFSQAIAFREE 972

Query: 1011 IFGLVHPSLVSSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAY 1070
              G VHP++  SYL LS ++S+L + S+AV  C KA  + ER  G DSFE +R L+NLA 
Sbjct: 973  TSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDSFEMIRSLNNLAM 1032

Query: 1071 LEYGQGSIYNSAXXXXXXXXXXXXXAPFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKL 1130
            LE    S YN+A              P  H   +N +++L  + +S ++    IK+LNKL
Sbjct: 1033 LEMANDSPYNAALCLKTIMSILSVVIPVNHPATINSYSMLHSMCSSLQNSSAMIKVLNKL 1092

Query: 1131 SELLLKITGSEETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLT 1190
             +++++I G  ++LPY  NESR+ANLY S+ +   +L+ IE    +FSKELG+N +TT+ 
Sbjct: 1093 GDIIVEIDG-HKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSKELGVNHKTTVE 1151

Query: 1191 SKQWSETIKGIITKQQQ-------EKKLASAQQATKPANIXXXXXXXXXXXXPALTNKSV 1243
               W   ++ +I    Q       +   A+ Q   KPA                L +KS+
Sbjct: 1152 CNSWITGVENLIESTSQSKALAASKAAAAAKQGEKKPAQ--------KQQQSAELRDKSI 1203

Query: 1244 DELLQFI 1250
            DEL+ FI
Sbjct: 1204 DELMNFI 1210

>Scas_709.56
          Length = 1281

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1279 (39%), Positives = 735/1279 (57%), Gaps = 109/1279 (8%)

Query: 19   SKNSDIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSRVVDDEDVLGDLAGNGSS- 77
            +K +++ +Q  K++ V  +   L+F E TK+ T+  L  N +++++ED + D+     S 
Sbjct: 41   NKKNELLFQFNKDAKVETIINVLAFTEQTKYLTNIQLRWNDKILNEEDTIFDVINGKVSD 100

Query: 78   ---LTFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQFQDMSL----- 129
               L+ + KP  Y    +++H++ +R+ +GF+SE  DG+SEFA+S+GS+F ++ L     
Sbjct: 101  MVHLSIEVKP--YTARDSLKHLLTVRDFIGFASETSDGLSEFAVSTGSKFTELPLGEIRV 158

Query: 130  ---EPNSEKSNGSETT--------ISDQEKVKFLQTCNELLESTNTDFNIASLKTGNLLV 178
               E   +K   +E          +SD+EK  F +  +E+ ES+        L   + +V
Sbjct: 159  PTAEEEEQKDEAAEDKEVKKNVFKVSDEEKDNFAKVVHEIFESSKKTTINQVLTADSNVV 218

Query: 179  TPVLKSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPS 238
            TP ++SL  SAYNPVP FYK++GHL YLQ  TLE ETFH+T + SGFY+NKS+S KFDPS
Sbjct: 219  TPCVRSLTLSAYNPVPVFYKSQGHLFYLQVVTLEGETFHVTATQSGFYINKSTSTKFDPS 278

Query: 239  PK------DEFEPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWL 292
             +      +E +  ++L DLL   SKKF  HV +   KL+  +S  YVKP S FL KPWL
Sbjct: 279  ERLSEEHNNESKIFYSLYDLLASHSKKFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWL 338

Query: 293  VSQLPSNNGDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFN 352
            V+  P+N  DF R QL+  N   E NF D+FQAI+DL  NS  +R++ E++   +IHEF+
Sbjct: 339  VTP-PTNPPDFFRLQLDSQNVSVETNFNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFS 397

Query: 353  SEAVKGAMAIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNE-AAYAVA 411
             EA+KGAM+IFN+ L P++P +     ++    + +SFV  +       G NE AA A++
Sbjct: 398  VEAIKGAMSIFNDNLPPLNPESPTNEQIFLSGHIFYSFVTSIKDN----GINEDAARAIS 453

Query: 412  NQDLQIINSLNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKEVA 471
            N DL+ IN LNR+ L  +R+ LT I+D+AG RLL Q+PVPGLL  +G  +   E+D E  
Sbjct: 454  NHDLKTINLLNRVNLNDVRYVLTTIVDFAGRRLLAQTPVPGLLDSMGTQV---EKDPETG 510

Query: 472  EPMETL------ISVNYGYDDFVATLKFDEKFHEKVC-EFSKNFYLKEHKV------EEV 518
            E  ETL      + V YG D+    + FD  F   +  EF+K F+LK+H+V      E V
Sbjct: 511  E--ETLKDLNNDVMVKYGLDEEEGKILFDADFDAALGKEFAKIFHLKKHQVSNGKDGENV 568

Query: 519  DLRISSKSKGIFGVDQRAYILDLANTNPVDIEFVKAHYDDVKENK-YPHRQXXXXXXXXX 577
            D+  SSKS+GI G D+R YILDLANT P+DI FVK +YD+V + K YPHRQ         
Sbjct: 569  DIWFSSKSRGIVGFDKRKYILDLANTYPLDINFVKENYDNVADTKRYPHRQTLMRPELVE 628

Query: 578  XWRAEKIAASGKTLQEASEDVS-FIYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDI 636
             W   ++  +     +A+ D + F YNPDA+V+DGVED  V ++S +L   VL   + D 
Sbjct: 629  KWWNAQVEKNKDLTMDAAYDGNMFSYNPDAFVVDGVEDPTVEEISTYLTKEVLPGVVADY 688

Query: 637  LKGNSNIPYDGQHLTDLFHTNGVNMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEY 696
            ++ N NIPY+G+HL D  H NG+N+RYLGK IE V+ +   Q  +  + L  + + N EY
Sbjct: 689  IQNNVNIPYNGEHLVDTLHKNGINLRYLGKFIELVQTELSKQVAQHTEKLKTVAEGNIEY 748

Query: 697  QDWETGYLVKVEKLIKERQEEINKYVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEV 756
            ++WE  YLVK+EKLI ERQ +INK +Q+GKEVP +L E ++L+  ++++P   +   V  
Sbjct: 749  ENWEKEYLVKIEKLIAERQAKINKLIQEGKEVPKELTEDLKLNDDEIRKPTDEQPIVVAK 808

Query: 757  DQFEGLIAVCELEMIARSIKHIFRQQSKKLSSPTL-VPHLVAFFLNLLFGKSYNESVTVE 815
            D+   LI + ELE+I RS+KH+ R  SK L  P L VP L+AF LNLLFG+ YN+S   E
Sbjct: 809  DELTTLINIAELEIITRSLKHVLRSYSKDL--PVLMVPSLIAFVLNLLFGEKYNDSPVAE 866

Query: 816  NLDALFDINELEFAQYTREQLIEEVRVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQ 875
             +D    I    F + TR  L+E +  ++ LRFRY+L ++W  I++   S +  IR+++ 
Sbjct: 867  EIDNFHPIKSFSFHKLTRTTLLEAISKESYLRFRYELPTDW--ISKYSESPFIAIRSLSY 924

Query: 876  KFGIQLINKEYFFTKEQYEKWKQAQDKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLI 935
            K GIQL+NK+YFFT E +E +KQ+QDKK+R+K+V P  TFS+ D ++ P +K +EF SL+
Sbjct: 925  KIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVAPLNTFSVKDLTIIPRVKTSEFSSLV 984

Query: 936  AEELWIQGASLVNAVSVXXXXXXXXXXXXXXXXXXXXXXXXXXXTSXXXXXXXXXXXXMN 995
             ++ W QG   +                                                
Sbjct: 985  GQDFWTQGTLTIQEAP-------------------------------------------K 1001

Query: 996  EALTLLGQSIAFREDIFGLVHPSLVSSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYG 1055
            +ALTL  Q+I   E++  ++HPS+   YL +S +Y++LG  S+AV FC KA  + ER  G
Sbjct: 1002 DALTLFAQAITVMEEVSSILHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCG 1061

Query: 1056 VDSFETVRILSNLAYLEYGQGSIYNSAXXXXXXXXXXXX--XAPFVHSGRVNVFNLLFQI 1113
            VDSFE +R L+NLA LE    S YN+A               +   H    ++++ + Q+
Sbjct: 1062 VDSFEMLRALTNLAMLETSNKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQL 1121

Query: 1114 AASTEDKKVQIKILNKLSELLLKITGSEETLPYGQNESRIANLYTSLDDMSHALSHIEKA 1173
            +   E+ K+ + +L  L +L++   G +E+L Y   ESR+ NLY ++ D   AL HI   
Sbjct: 1122 SLGVENIKLSMAVLKHLCDLIVSFEG-KESLAYAFTESRLGNLYVTVKDFRSALQHIAVT 1180

Query: 1174 KSIFSKELGLNDQTTLTSKQWSETIKGIITKQQQEKKLASAQQATKPANIXXXXXXXXXX 1233
            + IFSKELG N  TT  S+QW   +  ++   Q  K+L   Q A    +           
Sbjct: 1181 EPIFSKELGTNHVTTAQSRQWINGLTNVVNDMQ--KQLNQTQAAVNAKSNAPAKKHKNKK 1238

Query: 1234 XXP--ALTNKSVDELLQFI 1250
              P   L +KSVDELL FI
Sbjct: 1239 DEPNAELADKSVDELLNFI 1257

>Kwal_55.22028
          Length = 726

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 7/84 (8%)

Query: 649 HLTDLFHTNGV-----NMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQE--NKEYQDWET 701
           H TD   ++ V     N+R+L +++EFV   Y+D   + +KY  K +       Y+    
Sbjct: 112 HTTDALSSSRVGFTSQNLRFLVRSVEFVNPSYQDSLLKYSKYCGKDQSSTIGGSYKYSNG 171

Query: 702 GYLVKVEKLIKERQEEINKYVQQG 725
             L  ++ +++ER  E +  +  G
Sbjct: 172 DPLSGMQNMVRERTRENSPPLASG 195

>Scas_489.6
          Length = 622

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 14/94 (14%)

Query: 475 ETLISVNYGYDDFVATLKFD----EKF--------HEKVCEFSKNFYLKEHKVEEVDLRI 522
           + LI +N   DD +   KFD    +KF         E++ EF  N YL + K+   DLRI
Sbjct: 199 DQLIDLNEFVDDMMKDYKFDPALRDKFGTSVLNSIKEQLQEFQANPYLSKRKLGGDDLRI 258

Query: 523 SSKSKGIFGVDQ--RAYILDLANTNPVDIEFVKA 554
             K   I G +Q    +  D++N +    EF + 
Sbjct: 259 RIKLDIIVGQNQLIDQFEWDISNPDNSPEEFAEC 292

>KLLA0C10362g complement(888123..889703) similar to sgd|S0002707
           Saccharomyces cerevisiae YDR299w BFR2 involved in
           protein transport steps at the Brefeldin A blocks, start
           by similarity
          Length = 526

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 12/68 (17%)

Query: 579 WRAEKIAASGKTLQEASEDVSFIYNPDAYVIDGVEDENVADMSKFLNDTVLT-------L 631
           W A+  A+SGK+L +AS+  +   + D  V     D  +ADM + L  T L        L
Sbjct: 297 WSAKVSASSGKSLLQASKFKAINQSADVQV-----DNQLADMPRLLKRTKLNRSNTKPLL 351

Query: 632 FLEDILKG 639
           F ED+ KG
Sbjct: 352 FDEDLQKG 359

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 38,971,480
Number of extensions: 1761221
Number of successful extensions: 7366
Number of sequences better than 10.0: 86
Number of HSP's gapped: 7581
Number of HSP's successfully gapped: 96
Length of query: 1250
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1137
Effective length of database: 12,684,275
Effective search space: 14422020675
Effective search space used: 14422020675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)