Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F21934g2001667831e-107
Scas_647.81971696071e-80
Sklu_1575.21911665896e-78
YJR014W1981695785e-76
ACL112C1991675707e-75
Kwal_33.154611961675698e-75
CAGL0B03927g1961675453e-71
CAGL0J07678g10862790.009
YNL244C (SUI1)10862780.010
Scas_706.1510862780.011
KLLA0C03091g10872760.021
CAGL0B01837g56975800.022
AER457W10862710.10
ADL395C10862710.10
Sklu_2432.820262730.12
AFR642C10862660.47
ADR091W66437633.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F21934g
         (197 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces...   306   e-107
Scas_647.8                                                            238   1e-80
Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement        231   6e-78
YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with sim...   227   5e-76
ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [6...   224   7e-75
Kwal_33.15461                                                         223   8e-75
CAGL0B03927g 386875..387465 highly similar to sp|P47089 Saccharo...   214   3e-71
CAGL0J07678g 750008..750334 highly similar to sp|P32911 Saccharo...    35   0.009
YNL244C (SUI1) [4363] chr14 complement(187169..187495) Subunit (...    35   0.010
Scas_706.15                                                            35   0.011
KLLA0C03091g complement(276491..276817) highly similar to sp|P32...    34   0.021
CAGL0B01837g complement(166953..168662) similar to tr|Q04600 Sac...    35   0.022
AER457W [2957] [Homologous to ScYNL244C (SUI1) - SH] complement(...    32   0.10 
ADL395C [1346] [Homologous to ScYNL244C (SUI1) - SH] (17676..180...    32   0.10 
Sklu_2432.8 YNL244C, Contig c2432 18118-18726                          33   0.12 
AFR642C [3834] [Homologous to ScYNL244C (SUI1) - SH] (1607516..1...    30   0.47 
ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W (...    29   3.5  

>KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces
           cerevisiae YJR014w singleton, start by similarity
          Length = 200

 Score =  306 bits (783), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 150/166 (90%), Positives = 150/166 (90%)

Query: 1   MPLTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDVTEDVSKQLAESSI 60
           MPLTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDVTEDVSKQLAESSI
Sbjct: 1   MPLTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDVTEDVSKQLAESSI 60

Query: 61  GDXXXXXXXXXXXXXXXXQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEID 120
           GD                QQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEID
Sbjct: 61  GDEREEKLEKALEKLERKQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEID 120

Query: 121 MKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL 166
           MKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL
Sbjct: 121 MKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL 166

>Scas_647.8
          Length = 197

 Score =  238 bits (607), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (79%), Gaps = 3/169 (1%)

Query: 1   MPLTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDVTEDVSK---QLAE 57
           MPL  V+YCGVC +P EYCEF+GK KRCK WL+ENHP+L+TK YGD   DV+    +LAE
Sbjct: 1   MPLQEVVYCGVCSYPPEYCEFTGKLKRCKVWLKENHPDLFTKLYGDDNGDVAAVAGKLAE 60

Query: 58  SSIGDXXXXXXXXXXXXXXXXQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVF 117
           SSIG+                Q+ RE+RELAKKLSSKV+I+REARTKRK +IAISGLEVF
Sbjct: 61  SSIGEEREEKLEKDLLKLQTKQENREQRELAKKLSSKVIIKREARTKRKFIIAISGLEVF 120

Query: 118 EIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL 166
           EIDMKKL+KTFASKFATGCS+SKNAEKKEE+++QGD+ + VEAYIHSLL
Sbjct: 121 EIDMKKLAKTFASKFATGCSVSKNAEKKEEIVIQGDVLEAVEAYIHSLL 169

>Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement
          Length = 191

 Score =  231 bits (589), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 130/166 (78%), Gaps = 2/166 (1%)

Query: 3   LTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDVTE--DVSKQLAESSI 60
           L  V+YCGVC  P EYCEF+GK KRCK WL+ENH +L+ + Y    E  DV+ +L  SSI
Sbjct: 2   LKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCEVDDVATKLGNSSI 61

Query: 61  GDXXXXXXXXXXXXXXXXQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEID 120
           G                 Q++RE+RELAKKLSSKVVI+REARTKRKCMIAISGLEVFEID
Sbjct: 62  GGAREEKLEKDLLRLQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFEID 121

Query: 121 MKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL 166
           MKKL+KTFASKFATGCS+SKNAEKKEE++VQGD+ADEVEAYIHSLL
Sbjct: 122 MKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLL 167

>YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with
           similarity to human DENR/DRP density-regulated protein
           [597 bp, 198 aa]
          Length = 198

 Score =  227 bits (578), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 111/169 (65%), Positives = 132/169 (78%), Gaps = 5/169 (2%)

Query: 3   LTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYG--DVTEDV---SKQLAE 57
           L  VIYCG+C +P EYCEFSGK KRCK WL ENH +LY K YG  D T++V   + +LAE
Sbjct: 2   LREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLAE 61

Query: 58  SSIGDXXXXXXXXXXXXXXXXQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVF 117
           SSIG+                Q+ RE+RELAKKLSSKV+I+REARTKRK ++AISGLEVF
Sbjct: 62  SSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEVF 121

Query: 118 EIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL 166
           +IDMKKL+KTFAS+FATGCS+SKNAEKKEEV++QGD+ DEVE YIHSLL
Sbjct: 122 DIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLL 170

>ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [600
           bp, 199 aa]
          Length = 199

 Score =  224 bits (570), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 105/167 (62%), Positives = 130/167 (77%), Gaps = 3/167 (1%)

Query: 3   LTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDVTEDV---SKQLAESS 59
           L  V+YCGVC  P EYCEF+GK +RCK WL E+  EL+ + YGD  EDV   + +L +SS
Sbjct: 2   LKKVVYCGVCSLPPEYCEFTGKIRRCKVWLHEHDQELFAQLYGDDKEDVDGVAARLGQSS 61

Query: 60  IGDXXXXXXXXXXXXXXXXQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEI 119
           IG+                ++++E+RELA+KLSS+VVIRREARTKRKCM+ ++GLEVFEI
Sbjct: 62  IGEEREEQLEKKLQKLQAREESKEQRELARKLSSRVVIRREARTKRKCMVVVAGLEVFEI 121

Query: 120 DMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL 166
           DMKKL+KTFASKFATGCS+SKN EKKEEV+VQGD+ADEVEAYIH+LL
Sbjct: 122 DMKKLAKTFASKFATGCSVSKNVEKKEEVVVQGDIADEVEAYIHALL 168

>Kwal_33.15461
          Length = 196

 Score =  223 bits (569), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 125/167 (74%), Gaps = 1/167 (0%)

Query: 1   MPLTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDV-TEDVSKQLAESS 59
           M L  VIYCGVC FP ++CEF+GK KRCK WL ENH E Y   YGD   E+ +  LA SS
Sbjct: 1   MSLRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGDQEVEEAAANLAGSS 60

Query: 60  IGDXXXXXXXXXXXXXXXXQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEI 119
           IG+                Q+ RE+RELAKKLSSKV+I+REARTKRK M+AISGLEVFEI
Sbjct: 61  IGEEREEKLEKDLLKLQSKQENREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEI 120

Query: 120 DMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL 166
           DMKKL+KTFASKFATGCS+SKN EKKEE+I+QGD+ADE EAYI  LL
Sbjct: 121 DMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLL 167

>CAGL0B03927g 386875..387465 highly similar to sp|P47089
           Saccharomyces cerevisiae YJR014w, start by similarity
          Length = 196

 Score =  214 bits (545), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 108/167 (64%), Positives = 129/167 (77%), Gaps = 3/167 (1%)

Query: 3   LTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGD---VTEDVSKQLAESS 59
           L  V+YCGVC +P +YCEFSGK KRCK WL+ENH +LY K Y +       +S +LAESS
Sbjct: 2   LKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYSEDDAAAASLSAKLAESS 61

Query: 60  IGDXXXXXXXXXXXXXXXXQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEI 119
           IG+                Q+ +E+RELAKKLSSKV+++REARTKRK ++AISGLEVFEI
Sbjct: 62  IGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFEI 121

Query: 120 DMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLL 166
           DMKKL+KTFASKFATGCS+SKNAEKKEEV+VQGD+ DEV AYIHSLL
Sbjct: 122 DMKKLAKTFASKFATGCSVSKNAEKKEEVVVQGDVLDEVVAYIHSLL 168

>CAGL0J07678g 750008..750334 highly similar to sp|P32911
           Saccharomyces cerevisiae YNL244c SUI1 translation
           initiation factor 3, start by similarity
          Length = 108

 Score = 35.0 bits (79), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 92  SSKVVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQ 151
           S+ + IR + R  RK +  + G+   E D K++ K     FA   +I K++E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGVPA-EYDQKRILKVLKKDFACNGNIVKDSEMGEIIQLQ 81

Query: 152 GD 153
           GD
Sbjct: 82  GD 83

>YNL244C (SUI1) [4363] chr14 complement(187169..187495) Subunit (16
           kDa) of translation initiation factor eIF3, involved in
           initiation and in monitoring translational accuracy
           during elongation [327 bp, 108 aa]
          Length = 108

 Score = 34.7 bits (78), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 92  SSKVVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQ 151
           S+ + IR + R  RK +  + G+   E D+K++ K     FA   +I K+ E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQ 81

Query: 152 GD 153
           GD
Sbjct: 82  GD 83

>Scas_706.15
          Length = 108

 Score = 34.7 bits (78), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 92  SSKVVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQ 151
           ++ + IR + R  RK +  + G+   E D+K++ K     FA   +I K+ E  E + +Q
Sbjct: 23  ANYIHIRIQQRNGRKTLTTVQGVPA-EYDLKRILKVLKKDFACNGNIVKDVEMGEIIQLQ 81

Query: 152 GD 153
           GD
Sbjct: 82  GD 83

>KLLA0C03091g complement(276491..276817) highly similar to sp|P32911
           Saccharomyces cerevisiae YNL244c SUI1 translation
           initiation factor 3 (eIF3) singleton, start by
           similarity
          Length = 108

 Score = 33.9 bits (76), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 95  VVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDL 154
           + IR + R  RK +  + G+   E D+K++ K     FA   +I K+ E  E + +QGD 
Sbjct: 26  IHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDEEMGEVIQLQGDQ 84

Query: 155 ADEVEAYIHSLL 166
             +V  ++ + L
Sbjct: 85  RAKVSEFMITQL 96

>CAGL0B01837g complement(166953..168662) similar to tr|Q04600
           Saccharomyces cerevisiae YDR117c, start by similarity
          Length = 569

 Score = 35.4 bits (80), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 94  KVVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSI---SKNAEKKEEVIV 150
           K+ I  E +  RK +  +S  EVF+ID ++ +     K +   +I   + +A+K  EV V
Sbjct: 475 KINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQV 534

Query: 151 QGDLADEVEAYIHSL 165
           QG     + +Y++ L
Sbjct: 535 QGPHGQLIMSYLNDL 549

>AER457W [2957] [Homologous to ScYNL244C (SUI1) - SH]
           complement(1512587..1512913) [327 bp, 108 aa]
          Length = 108

 Score = 32.0 bits (71), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 92  SSKVVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQ 151
           S+ + IR + R  RK +  + G+   E D+K++ K     F    ++ K+ E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGIPE-EYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 152 GD 153
           GD
Sbjct: 82  GD 83

>ADL395C [1346] [Homologous to ScYNL244C (SUI1) - SH] (17676..18002)
           [327 bp, 108 aa]
          Length = 108

 Score = 32.0 bits (71), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 92  SSKVVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQ 151
           S+ + IR + R  RK +  + G+   E D+K++ K     F    ++ K+ E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGIPE-EYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 152 GD 153
           GD
Sbjct: 82  GD 83

>Sklu_2432.8 YNL244C, Contig c2432 18118-18726
          Length = 202

 Score = 32.7 bits (73), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 92  SSKVVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQ 151
           ++ + IR + R  RK +  + G+   E D+K++ K     FA   +I K+ E  + + +Q
Sbjct: 117 TNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDEEMGQIIQMQ 175

Query: 152 GD 153
           GD
Sbjct: 176 GD 177

>AFR642C [3834] [Homologous to ScYNL244C (SUI1) - SH]
           (1607516..1607842) [327 bp, 108 aa]
          Length = 108

 Score = 30.0 bits (66), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 92  SSKVVIRREARTKRKCMIAISGLEVFEIDMKKLSKTFASKFATGCSISKNAEKKEEVIVQ 151
           S+ + IR + R  RK +  + G+   + D+K++ K     F    ++ K+ E  E + +Q
Sbjct: 23  SNYIHIRIQQRNGRKTLTTVQGI-TKKYDLKRILKVLRKDFGCNGNMVKDDEMGEIIQLQ 81

Query: 152 GD 153
           GD
Sbjct: 82  GD 83

>ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W
           (RGT2) - SH] complement(872925..874919) [1995 bp, 664
           aa]
          Length = 664

 Score = 28.9 bits (63), Expect = 3.5,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 125 SKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAY 161
           S+T   K + GC+  KNA   E+ ++  DL D+ E +
Sbjct: 38  SETSDEKHSKGCNDQKNASHYEQPVMVTDLRDDSEGF 74

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,544,481
Number of extensions: 148686
Number of successful extensions: 488
Number of sequences better than 10.0: 21
Number of HSP's gapped: 480
Number of HSP's successfully gapped: 21
Length of query: 197
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 101
Effective length of database: 13,272,781
Effective search space: 1340550881
Effective search space used: 1340550881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)