Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F20658g1082106656310.0
KLLA0E14630g1082106650820.0
AGL097C1096105940180.0
Kwal_23.31601100106539960.0
CAGL0K12034g1087106537820.0
YDR038C (ENA5)1091106637080.0
YDR039C (ENA2)1091106637020.0
YDR040C (ENA1)1091106636990.0
Scas_569.0d46837415520.0
CAGL0J01870g94610129271e-109
YGL167C (PMR1)9509099211e-108
CAGL0I04312g9518999111e-106
KLLA0A03157g9389368951e-104
AEL301W9579998791e-102
Kwal_14.14989399128731e-101
Scas_707.48*7418048541e-100
Kwal_47.1754712409545781e-60
KLLA0A08910g12805964942e-50
YGL006W (PMC1)11734074602e-46
CAGL0A00517g11223834291e-42
AFL011W12424064077e-40
Kwal_47.175228993593271e-30
CAGL0A00495g9023553272e-30
YGL008C (PMA1)9183733262e-30
KLLA0A09031g8993713243e-30
Scas_297.18002853153e-29
YPL036W (PMA2)9473553163e-29
Scas_688.19133563111e-28
Scas_710.419043553111e-28
AGL085C9093582994e-27
CAGL0M11308g14528192763e-24
Scas_665.3014398302692e-23
KLLA0B08217g14398342503e-21
YOR291W14728612486e-21
Kwal_26.920714698422442e-20
YIL048W (NEO1)11515042243e-18
ADL079C11665502181e-17
Sklu_2193.111437132073e-16
Kwal_23.578911335402074e-16
Scas_704.3811614921983e-15
CAGL0L00715g11444931941e-14
KLLA0C08393g11485031878e-14
Scas_583.14*8752961715e-12
KLLA0E22352g12067281716e-12
YEL031W (SPF1)12153051708e-12
AFR354C12107021699e-12
ADR350W13115811682e-11
YAL026C (DRS2)13555101662e-11
KLLA0A04015g13434891644e-11
Kwal_26.707013155501635e-11
CAGL0L01419g12143371582e-10
Scas_615.99421811545e-10
AFR567W14493291529e-10
CAGL0G06270g13283011521e-09
CAGL0M08602g10122841511e-09
YDR270W (CCC2)10041911465e-09
AFL191W15752921313e-07
KLLA0D04092g11521491304e-07
KLLA0F07447g9751821223e-06
AGL041C12331501223e-06
YBR295W (PCA1)12161581224e-06
Scas_89.12712521175e-06
CAGL0H04477g16262931198e-06
Kwal_55.215759891691171e-05
ACR086C8102221143e-05
KLLA0C17644g15766591134e-05
YER166W (DNF1)15714261091e-04
Kwal_23.355615972801072e-04
Scas_669.316381581053e-04
KLLA0E01650g15503351045e-04
YMR162C (DNF3)16562431036e-04
Scas_576.815911861010.001
CAGL0G08085g1578419980.002
CAGL0L11814g1576426960.005
AGR120C1547417950.005
Scas_636.161554182950.006
YDR093W (DNF2)1612184930.010
Kwal_33.1552631166790.31
Scas_505.41025249800.34
Sklu_786.1312115750.95
YGR208W (SER2)30947721.8
Scas_463.331546722.0
AGR226W32340712.8
YDR495C (VPS3)101136704.3
Scas_665.1356896695.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F20658g
         (1066 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...  2173   0.0  
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...  1962   0.0  
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....  1552   0.0  
Kwal_23.3160                                                         1543   0.0  
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...  1461   0.0  
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...  1432   0.0  
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...  1430   0.0  
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...  1429   0.0  
Scas_569.0d                                                           602   0.0  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...   361   e-109
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...   359   e-108
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...   355   e-106
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....   349   e-104
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...   343   e-102
Kwal_14.1498                                                          340   e-101
Scas_707.48*                                                          333   e-100
Kwal_47.17547                                                         227   1e-60
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   194   2e-50
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   181   2e-46
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   169   1e-42
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   161   7e-40
Kwal_47.17522                                                         130   1e-30
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   130   2e-30
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   130   2e-30
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   129   3e-30
Scas_297.1                                                            125   3e-29
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   126   3e-29
Scas_688.1                                                            124   1e-28
Scas_710.41                                                           124   1e-28
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   119   4e-27
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...   110   3e-24
Scas_665.30                                                           108   2e-23
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   100   3e-21
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...   100   6e-21
Kwal_26.9207                                                           99   2e-20
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    91   3e-18
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    89   1e-17
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          84   3e-16
Kwal_23.5789                                                           84   4e-16
Scas_704.38                                                            81   3e-15
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    79   1e-14
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    77   8e-14
Scas_583.14*                                                           70   5e-12
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    70   6e-12
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    70   8e-12
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    70   9e-12
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    69   2e-11
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    69   2e-11
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    68   4e-11
Kwal_26.7070                                                           67   5e-11
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    65   2e-10
Scas_615.9                                                             64   5e-10
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    63   9e-10
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    63   1e-09
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    63   1e-09
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    61   5e-09
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    55   3e-07
KLLA0D04092g complement(344666..348124) some similarities with s...    55   4e-07
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    52   3e-06
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    52   3e-06
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    52   4e-06
Scas_89.1                                                              50   5e-06
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    50   8e-06
Kwal_55.21575                                                          50   1e-05
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    49   3e-05
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    48   4e-05
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    47   1e-04
Kwal_23.3556                                                           46   2e-04
Scas_669.3                                                             45   3e-04
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    45   5e-04
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    44   6e-04
Scas_576.8                                                             44   0.001
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    42   0.002
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    42   0.005
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    41   0.005
Scas_636.16                                                            41   0.006
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    40   0.010
Kwal_33.15526                                                          35   0.31 
Scas_505.4                                                             35   0.34 
Sklu_786.1 YGR208W, Contig c786 410-1348                               33   0.95 
YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine phosph...    32   1.8  
Scas_463.3                                                             32   2.0  
AGR226W [4537] [Homologous to ScYPL112C - SH] complement(1174528...    32   2.8  
YDR495C (VPS3) [1310] chr4 complement(1438103..1441138) Vacuolar...    32   4.3  
Scas_665.13                                                            31   5.8  

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 2173 bits (5631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1050/1066 (98%), Positives = 1050/1066 (98%)

Query: 1    MGTKIKEIPADSPYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDT 60
            MGTKIKEIPADSPYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDT
Sbjct: 1    MGTKIKEIPADSPYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDT 60

Query: 61   KINIKGILISQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKT 120
            KINIKGILISQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKT
Sbjct: 61   KINIKGILISQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKT 120

Query: 121  MNSLKSLSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEAL 180
            MNSLKSLSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEAL
Sbjct: 121  MNSLKSLSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEAL 180

Query: 181  LTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSL 240
            LTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSL
Sbjct: 181  LTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSL 240

Query: 241  KSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXX 300
            KSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQ               
Sbjct: 241  KSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIV 300

Query: 301  XMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEAL 360
             MGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEAL
Sbjct: 301  VMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEAL 360

Query: 361  GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYK 420
            GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYK
Sbjct: 361  GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYK 420

Query: 421  HDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDP 480
            HDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDP
Sbjct: 421  HDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDP 480

Query: 481  TEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTED 540
            TEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTED
Sbjct: 481  TEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTED 540

Query: 541  PATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAF 600
            PATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAF
Sbjct: 541  PATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAF 600

Query: 601  AKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660
            AKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM
Sbjct: 601  AKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660

Query: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720
            LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA
Sbjct: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720

Query: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780
            RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS
Sbjct: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780

Query: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840
            DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE
Sbjct: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840

Query: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900
            VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC
Sbjct: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900

Query: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960
            FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM
Sbjct: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960

Query: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020
            NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG
Sbjct: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020

Query: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT 1066
            FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT
Sbjct: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT 1066

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 1962 bits (5082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 932/1066 (87%), Positives = 997/1066 (93%)

Query: 1    MGTKIKEIPADSPYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDT 60
            MGTK KEIP DSPYAR+DFH L+  +VE LLSTHINQGLN TQIAERL L+GENTLGDD+
Sbjct: 1    MGTKSKEIPPDSPYARDDFHSLSVSRVETLLSTHINQGLNTTQIAERLGLIGENTLGDDS 60

Query: 61   KINIKGILISQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKT 120
            KINIKGI ISQICNAMIMVLIISMVI+ AIKDWISGGV+AFVV INVVIGAYQEYNASKT
Sbjct: 61   KINIKGIFISQICNAMIMVLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKT 120

Query: 121  MNSLKSLSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEAL 180
            MNSLKSLSTPSAHVIR GND+TI+SKELVPGDICII+VGDTVPADLRL E+INLETDEAL
Sbjct: 121  MNSLKSLSTPSAHVIRAGNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEAL 180

Query: 181  LTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSL 240
            LTGESLPVAKSH EVYE+DTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSL
Sbjct: 181  LTGESLPVAKSHGEVYEQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSL 240

Query: 241  KSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXX 300
            KSE S IS+D++KSFG+NLWITL+E+IG+FLGT+VGTPLHRKLSQ               
Sbjct: 241  KSEASLISRDKSKSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIV 300

Query: 301  XMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEAL 360
             MGTQK++VNKQVAIYAICVA+SMIPSSLVVVLTITMSAGAKVMATR+VI+RKLDSLEAL
Sbjct: 301  VMGTQKFKVNKQVAIYAICVALSMIPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEAL 360

Query: 361  GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYK 420
            GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTI VQ SNEPFNPTIGEI LIPKFSPYQYK
Sbjct: 361  GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYK 420

Query: 421  HDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDP 480
            HDDEEDVG+I DFKSKY A ELGPLNVSLF QWLYTATLANIATVF+D ETQDWKAHGDP
Sbjct: 421  HDDEEDVGMITDFKSKYYADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDP 480

Query: 481  TEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTED 540
            TEIAIQVFATRMDLPR VLTGED DDEK+   + +FEHVAE+PFDSSVKRMSAIYKN E+
Sbjct: 481  TEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRMSAIYKNVEE 540

Query: 541  PATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAF 600
            P  PIYEVFTKGAFERVLQCC+SWYTTPDG P PL++EDLET+QKNVDTLSSEGLRVLAF
Sbjct: 541  PKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAF 600

Query: 601  AKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660
            AKK+FNES+F  NKDKLLKERDFVE  LTFLGL+GIYDPPR+ESLAAVKKCH AGINVHM
Sbjct: 601  AKKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHM 660

Query: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720
            LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVM ATDFDALSD+EID+L VLPLVIA
Sbjct: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIA 720

Query: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780
            RCAPQTKVRMIEALHRR++FCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS
Sbjct: 721  RCAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780

Query: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840
            DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCF+D+EGFSVFPLSPVE
Sbjct: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVE 840

Query: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900
            VLW+IVVTSCFPAMGLGLEKA+VDVMEKPPKDAKAV+FTWEVI+DMLVYGVI+AACCMAC
Sbjct: 841  VLWVIVVTSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVIVDMLVYGVIIAACCMAC 900

Query: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960
            FVTV+YGTGDGNLG  CN+   ++C LVF+GRAAAFATMTWCALILAWEVVDMRRSFFMM
Sbjct: 901  FVTVIYGTGDGNLGRGCNNGFDDSCRLVFKGRAAAFATMTWCALILAWEVVDMRRSFFMM 960

Query: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020
            NPE+ETPYTQVFKD+WSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHY+I+YEWGF++G
Sbjct: 961  NPETETPYTQVFKDVWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYDITYEWGFSLG 1020

Query: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT 1066
            FS AFWAG ELYKYGKR YFG KDRV+NPE+DLEKR+V DPFEQYT
Sbjct: 1021 FSLAFWAGAELYKYGKRRYFGSKDRVENPESDLEKRSVQDPFEQYT 1066

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 1552 bits (4018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/1059 (69%), Positives = 874/1059 (82%), Gaps = 8/1059 (0%)

Query: 14   YARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQIC 73
            Y R DFH L A +V +LL T + +GL   +   RL +VG+NTLG++  IN++ IL+ Q+C
Sbjct: 16   YERTDFHALPAHEVARLLGTDLRRGLTAEEARARLEVVGDNTLGEEEGINVRAILLKQMC 75

Query: 74   NAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAH 133
            NAMI+VLIISMVI LAIKDWISGGV+AFVV +NV IGAYQEYNA KTMNSLK LSTPSA 
Sbjct: 76   NAMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSAR 135

Query: 134  VIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHS 193
            VIR+G D+ + S ++VPGDI  ++VGDTVPADLRL+E++NLETDEALLTGE+LPVAK  +
Sbjct: 136  VIRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPA 195

Query: 194  EVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENK 253
             V+E+DTPVGDRLNLAFA+STV+KGRATGIV++T L +EIGKIA+SL+ + S IS+DENK
Sbjct: 196  AVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSLISRDENK 255

Query: 254  SFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQV 313
            S  QN  +T+K ++GSFLGTNVGTPLHRKL++                M TQK+ VN++V
Sbjct: 256  SGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQKFIVNREV 315

Query: 314  AIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGT 373
            AIYAICVA+SMIPSSLVVVLTITMSAGAKVM+TRNVIVR+LDSLEALGAVNDICSDKTGT
Sbjct: 316  AIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVNDICSDKTGT 375

Query: 374  LTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDF 433
            LTQGKMI KQ+W+P+FGT+ V  SN PF+PT+G++ LIP+FSP++Y+HD+EEDVGII +F
Sbjct: 376  LTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEEEDVGIIANF 435

Query: 434  KSKYLAGELGP-LNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRM 492
            K ++ +  L   LN   F+ WL+TATLANIATVF+DS++++W+AHGDPTEIAIQVFATRM
Sbjct: 436  KQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRM 495

Query: 493  DLPRHVLTGE-DKDDEKDARANSS---FEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEV 548
            D P H LT E D++D   ++ N +   +EH AEFPFDSS+KRMSA+Y N  D  T    V
Sbjct: 496  DHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKRMSAVYINLRDKNT--RHV 553

Query: 549  FTKGAFERVLQCCDSWYTTP-DGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNE 607
            FTKGAFERVL+CC  W   P  G   PL+++DLE IQKNVDTLS+EGLRVLAFA K+   
Sbjct: 554  FTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLAFATKTIPA 613

Query: 608  SEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPG 667
             E  +  ++L K+RDFVE  L F GL+GIYDPPR E+  AVKKCH+AGINVHMLTGDFPG
Sbjct: 614  EEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPG 673

Query: 668  TAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTK 727
            TAK+IAQEVGILPHNLYHYPKEVV+ MVM AT FD+L+D+E+D L VLPLVIARCAPQTK
Sbjct: 674  TAKAIAQEVGILPHNLYHYPKEVVDIMVMTATQFDSLTDEELDQLPVLPLVIARCAPQTK 733

Query: 728  VRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASI 787
            VRMI+ALHRR KFCAMTGDGVNDSPSLK ANVGIAMGINGSDVAKDASDIVLSDDNFASI
Sbjct: 734  VRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASI 793

Query: 788  LNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVV 847
            LNAVEEGRRMSDNIQKFVLQLLA NVAQA+YLM+GL F+D++  SVFPLSPVEVLWIIVV
Sbjct: 794  LNAVEEGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKLSVFPLSPVEVLWIIVV 853

Query: 848  TSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMACFVTVLYG 907
            TSC PAMGLGLEKA+ D+MEKPP D+KA +FTWEVI+DM+VYG++MA CC+ CFV+++Y 
Sbjct: 854  TSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCCLGCFVSIIYK 913

Query: 908  TGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMMNPESETP 967
             G GNLG++CN    ++C  VF GRAA FATMTWCALILAWEV+DMRRSFF M PE++TP
Sbjct: 914  DGHGNLGTNCNVEYSDSCKSVFSGRAATFATMTWCALILAWEVIDMRRSFFAMKPETDTP 973

Query: 968  YTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIGFSFAFWA 1027
            YTQVFKDIWSN+FLFWS++ GF SVFPVVYIPVIN KVFLH  I YEWG A  FS  FW 
Sbjct: 974  YTQVFKDIWSNKFLFWSVIFGFTSVFPVVYIPVINTKVFLHIGIGYEWGIAFAFSLVFWL 1033

Query: 1028 GVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT 1066
              E +K+ KR Y+  KDR  NPE+DLE R +HDPFE+Y+
Sbjct: 1034 VAEFWKFAKRRYYRNKDRAINPESDLENRRLHDPFEKYS 1072

>Kwal_23.3160
          Length = 1100

 Score = 1543 bits (3996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 750/1065 (70%), Positives = 860/1065 (80%), Gaps = 23/1065 (2%)

Query: 19   FHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIM 78
            FH ++A     +L T +  GL + +   R+S  GEN+LGDD+KI+ K IL+ QICNAMI+
Sbjct: 23   FHTVSARDTAHVLETDLQAGLRSAEATARVSQYGENSLGDDSKIDFKSILLHQICNAMIL 82

Query: 79   VLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDG 138
            VL ISMVITLAI+DWISGGV+AFVV INV IG+YQEY ASKTMNSLKSLSTPSAHVIRDG
Sbjct: 83   VLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIRDG 142

Query: 139  NDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVY-- 196
            ND TI SK+LVPGD+C++K GDTVPADLRL+E +N ETDEALLTGESLP+AK  S+VY  
Sbjct: 143  NDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPA 202

Query: 197  EKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFG 256
             +DTPVGDRLNLAFA+STV+KGRATGIV+KT LNTEIGKIA+SLK + S ISKDENK+F 
Sbjct: 203  TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDENKTFW 262

Query: 257  QNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIY 316
             N  ITL  TIGSFLGT  GTPLHRKLS+                M TQK+ VNK+VAIY
Sbjct: 263  ANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVNKEVAIY 322

Query: 317  AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376
            AICVA+SMIPSSLVVVLTITMS GAK+MATRNV+VRKLDSLEALGAVND+CSDKTGTLTQ
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQ 382

Query: 377  GKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSK 436
            GKMI KQ W+P FGTITV  S+ PF+PT G I LIP+FSP+QYKHD  EDVGII  FK+K
Sbjct: 383  GKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNK 442

Query: 437  YLAGEL-GPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP 495
            +   +L   LN  LF  WL TA LANIA V+QD ET++WKAHGDPTEIAIQVFA ++D+P
Sbjct: 443  FYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMP 502

Query: 496  RHVLTGEDKDD----------EKDARANSSFEHVAEFPFDSSVKRMSAIYKNT-EDPATP 544
            R+ LT EDK D          EK +     ++H+AEFPFDSS+KRMSA+Y +  ED A  
Sbjct: 503  RNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNA-- 560

Query: 545  IYEVFTKGAFERVLQCCDSWYTTPDG----KPSPLSKEDLETIQKNVDTLSSEGLRVLAF 600
             + VFTKGAFERVL CC  W   PDG       P+++ED E + KNV+TLSSEGLRVLAF
Sbjct: 561  -HRVFTKGAFERVLDCCTKWL--PDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAF 617

Query: 601  AKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660
            A KSF ES+     + L K RDFVE  L F GL+GIYDPPRQE+  AVK+ H+AGINVHM
Sbjct: 618  ATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHM 677

Query: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720
            LTGDFPGTAK+IAQEVGILP NLYHYPKEVV+ MVM A  FD L+D+EID+L +LPLVIA
Sbjct: 678  LTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQLTDEEIDNLLLLPLVIA 737

Query: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780
            RCAPQTKVRMI+ALHRR KFCAMTGDGVNDSPSLK ANVGIAMGINGSDVAKDASDIVLS
Sbjct: 738  RCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLS 797

Query: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840
            DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLM+GLCF+D++  SVFPLSPVE
Sbjct: 798  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSVFPLSPVE 857

Query: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900
            VLWIIVVTSCFPAMGLGLEK++ D+MEK P+D+KA +FTWE+I+DML+YG  MAACC+AC
Sbjct: 858  VLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWMAACCLAC 917

Query: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960
            F+TV+YG G+G LG +CN++  E+C  V+ GRAA FA+MTWCALILAWEV+DMRRSFF M
Sbjct: 918  FITVIYGKGNGELGINCNNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFKM 977

Query: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020
             PE++TPYTQ  KDIWSNQFLFWS++ GF SVFPVVYIPVIN  VF H  I YEWG A+ 
Sbjct: 978  QPETDTPYTQWMKDIWSNQFLFWSVIFGFVSVFPVVYIPVINKDVFKHKGIGYEWGLAVA 1037

Query: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQY 1065
            ++ AFW G ELYKY KR YF  K R  NPE DLE R VHDPFE+Y
Sbjct: 1038 YTIAFWIGAELYKYFKRCYFKNKGRAQNPEKDLESRRVHDPFEKY 1082

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 1461 bits (3782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/1065 (66%), Positives = 844/1065 (79%), Gaps = 18/1065 (1%)

Query: 17   NDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAM 76
            +D+H L+       L T  ++G++  +   RL+  GEN+LGDD KI+ K +LI QICNAM
Sbjct: 11   SDYHALSVEDTCARLVTDSSKGISPEEFQARLAQCGENSLGDDAKIDYKAMLIHQICNAM 70

Query: 77   IMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIR 136
            I+VLIISM+I+ AI+DWI+GGV+ FV+GINV+IG  QEY ASKTMN+L++LS+P+AHVIR
Sbjct: 71   ILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIR 130

Query: 137  DGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVY 196
            +GN   + S ++VPGD+ ++KVGDT+PADLRL+   N ETDEALLTGESLPV+K  +E++
Sbjct: 131  NGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIF 190

Query: 197  EKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFG 256
            + +TPVGDR+NLAF++STV KGRA GI IKT LNTEIGKIAKSL+     IS+D  K++ 
Sbjct: 191  DDETPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWY 250

Query: 257  QNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIY 316
            QN WI+ K T+G+FLGT  GTPLHRKLS+                M +QK+ V++ VAIY
Sbjct: 251  QNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVDRGVAIY 310

Query: 317  AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376
            A+CVA+SMIPSSLVVVLTITMS GA VMA+RNVI+RKLDSLEALGAVNDICSDKTGTLTQ
Sbjct: 311  AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVNDICSDKTGTLTQ 370

Query: 377  GKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSK 436
            GKMIAKQ+W+P+FGT+ V  SNEP NP  G+I+ IP  SPY+Y H++ EDVGI+ +FK K
Sbjct: 371  GKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDK 430

Query: 437  YLAGEL-GPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP 495
            Y    + G     LFD+WL TA+LANIA+VF D ET++WKAHGDPTEIAIQVFATRMDLP
Sbjct: 431  YEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLP 490

Query: 496  RHVLTGEDKD------------DEKDARA-NSSFEHVAEFPFDSSVKRMSAIYKNTEDPA 542
            RHVLTGE  D             EKDA A N+ F H AEFPFDS++KRMS++Y++ +   
Sbjct: 491  RHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRD--- 547

Query: 543  TPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAK 602
               YE++TKGAFE VL CC  WY       + ++  D++TI++N+D++SSEGLRVLAFA 
Sbjct: 548  YKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKENIDSMSSEGLRVLAFAN 607

Query: 603  KSFNESEFNANK-DKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHML 661
            KS+ +S+ N  K  K+LKERD+ E  LTFLGLIGIYDPPR+E+  AVKK HQAGINV ML
Sbjct: 608  KSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRML 667

Query: 662  TGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIAR 721
            TGDFPGTAK+IAQEVGILP NLYHY KEVV+ MVM    FD LS+ EID+L VLPLVIAR
Sbjct: 668  TGDFPGTAKAIAQEVGILPTNLYHYSKEVVDIMVMTGKQFDNLSEDEIDNLPVLPLVIAR 727

Query: 722  CAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSD 781
            C+PQTKVRMIEALHRR KFCAMTGDGVNDSPSLK+ANVGIAMGINGSDVAKDASDIVLSD
Sbjct: 728  CSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDASDIVLSD 787

Query: 782  DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEV 841
            DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYL+VGL F DKEG SVFPL+PVEV
Sbjct: 788  DNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSVFPLAPVEV 847

Query: 842  LWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMACF 901
            LWIIVVTSCFPAMGLGLEKA+ D+M++PP D+KA +FTWE+I+DM VYGV MAA CMA F
Sbjct: 848  LWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGVWMAASCMATF 907

Query: 902  VTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMMN 961
            VT++YG   GNLG +CN    E+CH VFR R+AAFATMTWCALILAWEV+D+RRSFF M+
Sbjct: 908  VTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVIDLRRSFFRMH 967

Query: 962  PESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIGF 1021
            P+++ P  Q FKDI+ N+FLF+S+V GF SVFPVVYIPVIN  VFLH  I +EWG AI F
Sbjct: 968  PDTDAPVKQFFKDIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKPIGWEWGIAIAF 1027

Query: 1022 SFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT 1066
            S  FW G EL+KY KR Y+  K R  NPENDLE +A   PF+ Y+
Sbjct: 1028 SVCFWIGCELHKYFKRIYYRNKSRAINPENDLENKAGTHPFDAYS 1072

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 1432 bits (3708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1066 (64%), Positives = 835/1066 (78%), Gaps = 20/1066 (1%)

Query: 17   NDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAM 76
            N +H LT  +  + + T + +GL   +   RL  VGENTLGDDTKI+ K +++ Q+CNAM
Sbjct: 15   NAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAM 74

Query: 77   IMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIR 136
            IMVL+ISM I+ A++DWI+GGV++FV+ +NV+IG  QEY A+KTMNSLK+LS+P+AHVIR
Sbjct: 75   IMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134

Query: 137  DGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVY 196
            +G   TI SK++VPGDIC++KVGDT+PADLRL+E+ N +TDE+LLTGESLPV+K  + V+
Sbjct: 135  NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194

Query: 197  --EKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKS 254
              E++T VGDRLNLAF++S V KGRA GIVIKTALN+EIGKIAKSL+ ++  IS+D +KS
Sbjct: 195  GKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKS 254

Query: 255  FGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVA 314
            + QN WI+ K+  G+FLGTNVGTPLHRKLS+                M +QK+ V+K+VA
Sbjct: 255  WLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 315  IYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTL 374
            IYAICVA+SMIPSSLVVVLTITMS GA VM +RNVIVRKLDSLEALGAVNDICSDKTGTL
Sbjct: 315  IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 375  TQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFK 434
            TQGKM+A+Q+WIP+FGTIT+  S++PFNP  G + LIP+FSPY+Y H+++ DVGI+ +FK
Sbjct: 375  TQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFK 434

Query: 435  SKYLAGELGP-LNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMD 493
             +    +L   +++ LF +WL TATLANIATVF+D  T  WKAHGDPTEIAIQVFAT+MD
Sbjct: 435  DRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMD 494

Query: 494  LPRHVLTGEDKDDEKDARANSS------------FEHVAEFPFDSSVKRMSAIYKNTEDP 541
            LP + LTGE   ++ +    SS            FEH+AEFPFDS+VKRMS++Y N  + 
Sbjct: 495  LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE 554

Query: 542  ATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFA 601
                Y ++ KGAFE ++ CC SWY     K +PL+  D+ETI+KNV +LS+EGLRVL FA
Sbjct: 555  T---YNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611

Query: 602  KKSFNESEFNANKDK-LLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660
             KSF + + N ++ K +   R   E  L FLGLIGIYDPPR E+  AVKK HQAGINVHM
Sbjct: 612  SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671

Query: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720
            LTGDF GTAK+IAQEVGILP NLYHY +E+V+ MVM  + FD LS++E+DDL VLPLVIA
Sbjct: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731

Query: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780
            RC+PQTKVRMIEALHRR KFCAMTGDGVNDSPSLK+ANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 732  RCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL++GL F D+ G SVFPLSPVE
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900
            VLWIIVVTSCFPAMGLGLEKA+ D+M++PP D++  +FTWEVIID   YG+IM   CMA 
Sbjct: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911

Query: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960
            F   LYG   G LG DC+     +C  V+R R+AAFATMTWCALILAWEVVDMRRSFF M
Sbjct: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971

Query: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020
            +P++++P  + F+ IW NQFLFWSI+ GF S FPVVYIPVINDKVFLH  I  EWG AI 
Sbjct: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031

Query: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT 1066
            F+ AFW G ELYK GKR YF  + R  N ENDLE+ + HDPFE Y+
Sbjct: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNSENDLERSSKHDPFEAYS 1076

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 1430 bits (3702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1066 (64%), Positives = 833/1066 (78%), Gaps = 20/1066 (1%)

Query: 17   NDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAM 76
            N +H LT  +  + + T + +GL   +   RL  VGENTLGDDTKI+ K +++ Q+CNAM
Sbjct: 15   NAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAM 74

Query: 77   IMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIR 136
            IMVL+ISM I+ A++DWI+GGV++FV+ +NV+IG  QEY A+KTMNSLK+LS+P+AHVIR
Sbjct: 75   IMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134

Query: 137  DGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVY 196
            +G   TI SK++VPGDIC++KVGDT+PADLRL+E+ N +TDE+LLTGESLPV+K  + V+
Sbjct: 135  NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194

Query: 197  --EKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKS 254
              E++T VGDRLNLAF++S V KGRA GIVIKTALN+EIGKIAKSL+ ++  IS+D +KS
Sbjct: 195  GKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKS 254

Query: 255  FGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVA 314
            + QN WI+ K+  G+FLGTNVGTPLHRKLS+                M +QK+ V+K+VA
Sbjct: 255  WLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 315  IYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTL 374
            IYAICVA+SMIPSSLVVVLTITMS GA VM +RNVIVRKLDSLEALGAVNDICSDKTGTL
Sbjct: 315  IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 375  TQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFK 434
            TQGKM+A+Q+WIP+FGTIT+  S++PFNP  G + LIP+FSPY+Y H+++ DVGI+ +FK
Sbjct: 375  TQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFK 434

Query: 435  SKYLAGELGP-LNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMD 493
             +    +L   +++ LF +WL TATLANIATVF+D  T  WKAHGDPTEIAIQVFAT+MD
Sbjct: 435  DRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMD 494

Query: 494  LPRHVLTGEDKDDEKDARANSS------------FEHVAEFPFDSSVKRMSAIYKNTEDP 541
            LP + LTGE   ++ +    SS            FEH+AEFPFDS+VKRMS++Y N  + 
Sbjct: 495  LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE 554

Query: 542  ATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFA 601
                Y ++ KGAFE ++ CC SWY     K +PL+  D+ETI+KNV +LS+EGLRVL FA
Sbjct: 555  T---YNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611

Query: 602  KKSFNESEFNANKDK-LLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660
             KSF + + N ++ K +   R   E  L FLGLIGIYDPPR E+  AVKK HQAGINVHM
Sbjct: 612  SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671

Query: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720
            LTGDF GTAK+IAQEVGILP NLYHY +E+V+ MVM  + FD LS++E+DDL VLPLVIA
Sbjct: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731

Query: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780
            RC+PQTKVRMIEALHRR KFCAMTGDGVNDSPSLK+ANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 732  RCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL++GL F D+ G SVFPLSPVE
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900
            VLWIIVVTSCFPAMGLGLEKA+ D+M++PP D++  +FTWEVIID   YG+IM   CMA 
Sbjct: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911

Query: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960
            F   LYG   G LG DC+     +C  V+R R+AAFATMTWCALILAWEVVDMRRSFF M
Sbjct: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971

Query: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020
            +P++++P  + F+ IW NQFLFWSI+ GF S FPVVYIPVINDKVFLH  I  EWG AI 
Sbjct: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031

Query: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT 1066
            F+ AFW G ELYK GKR YF  + R  NPENDLE     DPFE Y+
Sbjct: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPFEAYS 1076

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 1429 bits (3699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1066 (64%), Positives = 833/1066 (78%), Gaps = 20/1066 (1%)

Query: 17   NDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAM 76
            N +H LTA +  + + T + +GL   +   RL  VGENTLGDDTKI+ K +++ Q+CNAM
Sbjct: 15   NAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAM 74

Query: 77   IMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIR 136
            IMVL+ISM+I+ A+ DWI+GGV++FV+ +NV+IG  QEY A+KTMNSLK+LS+P+AHVIR
Sbjct: 75   IMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134

Query: 137  DGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVY 196
            +G   TI SK++VPGDIC++KVGDT+PADLRL+E+ N +TDE+LLTGESLPV+K  + V+
Sbjct: 135  NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVF 194

Query: 197  --EKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKS 254
              E++T VGDRLNLAF++S V KGRA GIVIKTALN+EIGKIAKSL+ ++  IS+D +KS
Sbjct: 195  GKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKS 254

Query: 255  FGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVA 314
            + QN WI+ K+  G+FLGTNVGTPLHRKLS+                M +QK+ V+K+VA
Sbjct: 255  WLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVA 314

Query: 315  IYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTL 374
            IYAICVA+SMIPSSLVVVLTITMS GA VM +RNVIVRKLDSLEALGAVNDICSDKTGTL
Sbjct: 315  IYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTL 374

Query: 375  TQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFK 434
            TQGKM+A+Q+WIP+FGTIT+  S++PFNP  G + LIP+FSPY+Y H+++ DVGI+ +FK
Sbjct: 375  TQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFK 434

Query: 435  SKYLAGELGP-LNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMD 493
             +    +L   +++ LF +WL TATLANIATVF+D  T  WKAHGDPTEIAIQVFAT+MD
Sbjct: 435  DRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMD 494

Query: 494  LPRHVLTGEDKDDEKDARANSS------------FEHVAEFPFDSSVKRMSAIYKNTEDP 541
            LP + LTGE   ++ +    SS            FEH+AEFPFDS+VKRMS++Y N  + 
Sbjct: 495  LPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNE 554

Query: 542  ATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFA 601
                Y ++ KGAFE ++ CC SWY     K +PL+  D+ETI+KNV +LS+EGLRVL FA
Sbjct: 555  T---YNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA 611

Query: 602  KKSFNESEFNANKDK-LLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660
             KSF + + N ++ K +   R   E  L FLGLIGIYDPPR E+  AVKK HQAGINVHM
Sbjct: 612  SKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHM 671

Query: 661  LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIA 720
            LTGDF GTAK+IAQEVGILP NLYHY +E+V+ MVM  + FD LS++E+DDL VLPLVIA
Sbjct: 672  LTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLPLVIA 731

Query: 721  RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780
            RC+PQTKVRMIEALHRR KFC MTGDGVNDSPSLK+ANVGIAMGINGSDV+K+ASDIVLS
Sbjct: 732  RCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 781  DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840
            DDNFASILNAVEEGRRM+DNIQKFVLQLLAENVAQALYL++GL F D+ G SVFPLSPVE
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 841  VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900
            VLWIIVVTSCFPAMGLGLEKA+ D+M++PP D++  +FTWEVIID   YG+IM   CMA 
Sbjct: 852  VLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMAS 911

Query: 901  FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960
            F   LYG   G LG DC+     +C  V+R R+AAFATMTWCALILAWEVVDMRRSFF M
Sbjct: 912  FTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDMRRSFFRM 971

Query: 961  NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGFAIG 1020
            +P++++P  + F+ IW NQFLFWSI+ GF S FPVVYIPVINDKVFLH  I  EWG AI 
Sbjct: 972  HPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGLAIA 1031

Query: 1021 FSFAFWAGVELYKYGKRHYFGIKDRVDNPENDLEKRAVHDPFEQYT 1066
            F+ AFW G ELYK GKR YF  + R  NPENDLE     DPFE Y+
Sbjct: 1032 FTIAFWIGAELYKCGKRRYFKTQ-RAHNPENDLESNNKRDPFEAYS 1076

>Scas_569.0d
          Length = 468

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/374 (73%), Positives = 318/374 (85%), Gaps = 1/374 (0%)

Query: 694  MVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPS 753
            MVM  + FD L+ ++ID+L VLPLVIARC+PQTKVRMIEALHRR KFCAMTGDGVNDSPS
Sbjct: 80   MVMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPS 139

Query: 754  LKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENV 813
            LK+ANVGIAMGINGSDVAKDASDIVLSDDNFASILNA+EEGRRMSDNIQKFVLQLLAENV
Sbjct: 140  LKMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAENV 199

Query: 814  AQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDA 873
            AQALYL+ GL F DKEG SVFPL+PVEVLWIIVVTSCFPAMGLGLEKA+ D+M++PP D+
Sbjct: 200  AQALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDS 259

Query: 874  KAVVFTWEVIIDMLVYGVIMAACCMACFVTVLYGTGDGNLGSDCNDALGETCHLVFRGRA 933
            K+ +FTWE+I+DM VYG+IMA CCM  F TV+YG   GNLG +CN +  ETCH VFRGR+
Sbjct: 260  KSGIFTWEIIVDMFVYGIIMAGCCMGSFTTVVYGKDGGNLGFNCNKSYNETCHDVFRGRS 319

Query: 934  AAFATMTWCALILAWEVVDMRRSFFMMNPESETPYTQVFKDIWSNQFLFWSIVGGFCSVF 993
            +AFA MTWCALILAWEVVD+RRSFF M PE++TP  + F+DIWSN+FLFWS++ GF S F
Sbjct: 320  SAFAVMTWCALILAWEVVDLRRSFFRMQPETDTPVREFFRDIWSNKFLFWSLIFGFVSTF 379

Query: 994  PVVYIPVINDKVFLHYNISYEWGFAIGFSFAFWAGVELYKYGKRHYF-GIKDRVDNPEND 1052
            PV+YIPVINDKVFLH  I++EWG A  F+  FW G ELYK+ KR YF  + ++  NPE+D
Sbjct: 380  PVIYIPVINDKVFLHKGITFEWGIAFAFTIIFWMGCELYKFMKRRYFRRMMNKAQNPESD 439

Query: 1053 LEKRAVHDPFEQYT 1066
            LEKR   DPFE Y+
Sbjct: 440  LEKRTRRDPFEAYS 453

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%)

Query: 14 YARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKIN 63
          Y  N+FH L + +   LL T  ++GL++ +   R S VGEN+LGDD K N
Sbjct: 26 YEYNEFHTLQSQETANLLQTDASKGLDDEKFQARKSAVGENSLGDDMKSN 75

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score =  361 bits (927), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 286/1012 (28%), Positives = 469/1012 (46%), Gaps = 164/1012 (16%)

Query: 19   FHVLTAPQVEKLLSTHINQGLNNTQ-IAERLSLVGENTLG-DDTKINIKGILISQICNAM 76
            F  L+  +  + L T ++ GL++ + + +R  + G N    DD +  IK  L+S + + +
Sbjct: 48   FCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDESMIKKFLMSFVEDRL 107

Query: 77   IMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIR 136
            I++LI S V++ AI        ++  + I V +G  QEY + K++ +L  L     H+IR
Sbjct: 108  ILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKLVPTKCHLIR 167

Query: 137  DGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAKSHS--- 193
             G +    + ELVPGD+   K+GD +PAD+R++E+++L  DE+ LTGE+ P+ K      
Sbjct: 168  YGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEPLHKDAQTID 227

Query: 194  -EVYE-KDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDE 251
             E Y+ ++ PV +R  +A+  + V +G   GIVI T  NT  G I + + S    I K +
Sbjct: 228  PEEYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNS----IEKPK 283

Query: 252  NKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNK 311
                                     TPL   + +                      R N 
Sbjct: 284  -------------------------TPLQETMDRLGTELSYISFFIIAIISIVGIIRGNS 318

Query: 312  QVAIYAICV--AISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSD 369
             + ++ + V  A++ IP  L +++T+T++ G   M  +N IVR+L S+E LG+VN IC+D
Sbjct: 319  LLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTD 378

Query: 370  KTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGI 429
            KTGTLT   M                        T+ ++  +     Y+     EED   
Sbjct: 379  KTGTLTTNHM------------------------TVSKLFCLDSSGTYENAISPEED--- 411

Query: 430  IPDFKSKYLAGELGPLNVSLFD----QWLYTATLANIATVFQDSETQDWKAHGDPTEIAI 485
                              S FD        T T+ANI    + SE  +    G+PT++A+
Sbjct: 412  ------------------SEFDVHDNDVKETLTIANICNNAKYSEEHNLYI-GNPTDVAL 452

Query: 486  QVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPI 545
                T+  +P          D++D     S E + E  F+S  K M AI  + E     +
Sbjct: 453  IEVLTKFGIP----------DQRD-----SHEKMEELSFNSKRKYM-AIKSSKESGEHVL 496

Query: 546  YEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSF 605
            Y    KGAFER+L    S+Y    G+     +     + +   + +S+GLR +A A K  
Sbjct: 497  Y---IKGAFERILDKS-SYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFKP- 551

Query: 606  NESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDF 665
                   + D ++ E D     LTF GL G+ DPPR    A+++K H+ G+++ M+TGD 
Sbjct: 552  ------TDSDNVISEDDI--NGLTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDS 603

Query: 666  PGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQ 725
              TA SIA+++G+   +            VM       L++ E+  +     + AR  P+
Sbjct: 604  VNTAVSIAEKIGLSVQDRESS--------VMTGDKVSELTEDELSKVIDKVNIFARATPE 655

Query: 726  TKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFA 785
             K+ +++AL +R    AMTGDGVND+P+LK+A++GIAMGI+G+DVAK+ SD++L+DD+F+
Sbjct: 656  NKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMGISGTDVAKEVSDMILTDDDFS 715

Query: 786  SILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWII 845
            SIL A+EEG+ + +NI+ F+   L+ +VA      + L  +        PL+P+++LWI 
Sbjct: 716  SILTAIEEGKGIFNNIRNFLTFQLSISVAT-----LSLIAITTIAKLPAPLNPMQILWIN 770

Query: 846  VVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMACFVTVL 905
            ++    PA  LG+E    DVM+KPP+  +  +    +++ +L     +A C +     + 
Sbjct: 771  IIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLLY----LAICILVGTFYIF 826

Query: 906  YGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMMNPESE 965
                D N  +   D                F    + A+  A       +S F +     
Sbjct: 827  LKGMDENQQTTSKDI------------TMTFTGFVFFAIFNAVACRHTTKSIFQIG---- 870

Query: 966  TPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIPVINDKVFLHYNISYEWGF 1017
                     ++SN+    +I+   C     VYIP      F H   +   GF
Sbjct: 871  ---------LFSNRIFNIAILLSVCGQMCAVYIP-----FFQHIFKTENLGF 908

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score =  359 bits (921), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 275/909 (30%), Positives = 457/909 (50%), Gaps = 126/909 (13%)

Query: 13  PYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAE-RLSLVGEN--TLGDDTKINIKGILI 69
           P    ++  L+  +  + L T  N GL ++  A  R SL G N  T+ DD  +  K  L 
Sbjct: 32  PSPSLEYCTLSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESL-FKKFLS 90

Query: 70  SQICNAMIMVLIISMVITL---AIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKS 126
           + I + MI++LI S V++L    I D +S  +  F+V   V +G  QEY + K++ +L  
Sbjct: 91  NFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIV---VTVGFVQEYRSEKSLEALNK 147

Query: 127 LSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESL 186
           L     H++R G +  + +  LVPGD+   ++GD +PAD+R++E+I+L  DE+ LTGE+ 
Sbjct: 148 LVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENE 207

Query: 187 PVAKSHSEVYEKDT---------PVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIA 237
           PV K+ S+  EK +         P+ +R  +A+  + V +G   GIV+ T  NT  G + 
Sbjct: 208 PVHKT-SQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVF 266

Query: 238 KSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXX 297
           + + +    I K +       L +T+ +             L + LS             
Sbjct: 267 EMMNN----IEKPKTP-----LQLTMDK-------------LGKDLS-----LVSFIVIG 299

Query: 298 XXXXMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSL 357
               +G  + R   ++   ++ +A++ IP  L +++T+T++ G   MA R  IVR+L S+
Sbjct: 300 MICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSV 359

Query: 358 EALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPY 417
           E LG+VN ICSDKTGTLT   M   ++W           SN+                  
Sbjct: 360 ETLGSVNVICSDKTGTLTSNHMTVSKLWCLD------SMSNK------------------ 395

Query: 418 QYKHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAH 477
                    + ++   K+K      G L   L +    T T+ N+      S +Q+    
Sbjct: 396 ---------LNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCN--NASFSQEHAIF 444

Query: 478 -GDPTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYK 536
            G+PT++A+       ++P             D R  ++ + V E PF+S  K M+    
Sbjct: 445 LGNPTDVALLEQLANFEMP-------------DIR--NTVQKVQELPFNSKRKLMATKIL 489

Query: 537 NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLR 596
           N  D    +Y    KGAFER+L+   S+  +   K   L++    TI +  ++++SEGLR
Sbjct: 490 NPVDNKCTVY---VKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLR 546

Query: 597 VLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGI 656
           V  FAK + ++S     +D L+K+       LTF GLIG+ DPPR     A+++  Q G+
Sbjct: 547 VFGFAKLTLSDSSTPLTED-LIKD-------LTFTGLIGMNDPPRPNVKFAIEQLLQGGV 598

Query: 657 NVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLP 716
           ++ M+TGD   TA +IA+++GI        P       V++    D +SD ++ ++    
Sbjct: 599 HIIMITGDSENTAVNIAKQIGI--------PVIDPKLSVLSGDKLDEMSDDQLANVIDHV 650

Query: 717 LVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASD 776
            + AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK++++G++MG  G+DVAK+ASD
Sbjct: 651 NIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASD 710

Query: 777 IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPL 836
           +VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +   F         PL
Sbjct: 711 MVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPN-----PL 765

Query: 837 SPVEVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAAC 896
           + +++LWI ++    PA  LG+E    +VM+KPP+     + T +V+  +L      AAC
Sbjct: 766 NAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLT----TAAC 821

Query: 897 CMACFVTVL 905
            +   V + 
Sbjct: 822 IIVGTVYIF 830

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score =  355 bits (911), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 265/899 (29%), Positives = 436/899 (48%), Gaps = 128/899 (14%)

Query: 13  PYARNDFHVLTAPQVEKLLSTHINQGLNNTQIA-ERLSLVGENTLG-DDTKINIKGILIS 70
           P    ++  L+  +    L T    GL++ + A +R    G N +  DD +  +K  L +
Sbjct: 40  PNPSLEYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSN 99

Query: 71  QICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTP 130
            + + +I++L+ S +I++ + +      +   + I V +G  QEY + K++ +L  L   
Sbjct: 100 FVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQ 159

Query: 131 SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190
             H+IR G +  + +  LVPGD+   ++GD +PAD+R++E  +L  DE+ LTGE+ PV K
Sbjct: 160 ECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHK 219

Query: 191 SHSEVYEKDT---------PVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLK 241
           S+ +   +D+         PV +R N+A+  + V +G   GIV+ T   T  G + + + 
Sbjct: 220 SY-KALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMS 278

Query: 242 SETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXX 301
           S    I K +                         TPL   + +                
Sbjct: 279 S----IEKPK-------------------------TPLQLTMDKLGKDLSLASFVVIGII 309

Query: 302 MGTQKYRVNKQVAIYAICV--AISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEA 359
                 +    + ++ I V  A++ IP  L +++T+T++ G   MA R  IVR+L S+E 
Sbjct: 310 CVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVET 369

Query: 360 LGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQY 419
           LG+VN ICSDKTGTLT   M   ++W    G++  + +    +   G        +   Y
Sbjct: 370 LGSVNVICSDKTGTLTSNHMTVSKIWC--LGSMANKLNVLSLDKNKGG-------NLKNY 420

Query: 420 KHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGD 479
             DD          K+  L G                  L N A+  Q    +  K  G+
Sbjct: 421 LTDD---------VKTTLLCG-----------------NLCNNASYSQ----EHAKYLGN 450

Query: 480 PTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTE 539
           PT++A+     + +L               A   S +  V E  F+S  K M+   ++ E
Sbjct: 451 PTDVALLEQLQKFEL---------------ADVRSEYTKVKELSFNSKRKMMATKIQDNE 495

Query: 540 DPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLA 599
              T    +F KGAFER+L    S Y T  GK   L+    ETI    +TL+SEGLRVLA
Sbjct: 496 KKTT----LFIKGAFERILDKSSS-YLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLA 550

Query: 600 FAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVH 659
           FAK++  +S     +D +          L F GLIG+ DPPR     A+ +  Q GI++ 
Sbjct: 551 FAKRAMTDSSSKLVEDDI--------SDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHII 602

Query: 660 MLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVI 719
           M+TGD   TA +IA+++GI        P       V++    + ++D ++ ++     + 
Sbjct: 603 MITGDSENTAVNIARQIGI--------PVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIF 654

Query: 720 ARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVL 779
           AR  P+ K+ ++ AL RR    AMTGDGVND+P+LK+A++G++MG  G+DVAK+ASD++L
Sbjct: 655 ARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMIL 714

Query: 780 SDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPV 839
           +DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +   F+        PL+ +
Sbjct: 715 TDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN-----PLNAM 769

Query: 840 EVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCM 898
           ++LWI ++    PA  LG+E    +VM+KPP+     + T E     L+  +I  A C+
Sbjct: 770 QILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAE-----LLKRLIGTASCI 823

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score =  349 bits (895), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 294/936 (31%), Positives = 457/936 (48%), Gaps = 138/936 (14%)

Query: 13  PYARNDFHVLTAPQVEKLLSTHINQGLNN-TQIAERLSLVGENTLGDDTKINI-KGILIS 70
           P A  ++  ++       L T  + GL+N ++IA R S+ G N +  D K+++ K  L +
Sbjct: 27  PNASLEYCTVSVEDTIAQLGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLST 86

Query: 71  QICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTP 130
            I + +I++LI S VI+  + +      +A  + I V +G  QEY + K++ +L  L   
Sbjct: 87  FIEDPLILLLIGSAVISFLMGNIDDSISIALAIIIVVTVGFVQEYKSEKSLEALNKLVPA 146

Query: 131 SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190
             H+ R G    + +  LVPGD+   KVGD +PADLR++ESI+L  DE+ LTGE+ PV K
Sbjct: 147 ECHLTRSGQLSHVLASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHK 206

Query: 191 SHSEVYEKD--------TPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS 242
           S   V  K+         PVGDR  + F  + V +G   GIVI T  +T  G + + +  
Sbjct: 207 SSGAVDPKNYSHIPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMM-- 264

Query: 243 ETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHR---KLSQXXXXXXXXXXXXXX 299
             S I K +                         TPL     KL Q              
Sbjct: 265 --SGIDKPK-------------------------TPLQTAMDKLGQDLSYMSFVLIGIIC 297

Query: 300 XXMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEA 359
                Q     +   I A+ +A++ IP  L +++T+T++ G   MA R  IVR+L S+E 
Sbjct: 298 LIGIIQGRSWLEMFQI-AVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVET 356

Query: 360 LGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQY 419
           LG+VN ICSDKTGTLT   M   ++W    G++     N+     + ++    K  P + 
Sbjct: 357 LGSVNVICSDKTGTLTANHMTVSKIWC--LGSM----ENKTNCLALSKV----KERPIKM 406

Query: 420 KHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGD 479
               E+DV                          L    + N  T  Q    +  K  G+
Sbjct: 407 ----EQDVATT-----------------------LRIGNICNNGTYSQ----EHLKYLGN 435

Query: 480 PTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTE 539
           PT+IAI      ++  +H           D R  +S   + E PF+S  K M+    +  
Sbjct: 436 PTDIAI------LESLQHFGI-------NDCR--NSVNKINEIPFNSKRKFMAVKTIDAN 480

Query: 540 DPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLA 599
           D       V+ KGAFE++++   + Y   DGK   L   D   I      L+SEGLR LA
Sbjct: 481 DKVV----VYVKGAFEKIVEKSIN-YIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLA 535

Query: 600 FAKKSFNESEFNA-NKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINV 658
           FA     E E +A + DK   E D VE  LTF GLI + DPPR    +A+++  Q  ++V
Sbjct: 536 FA-----ELEVSATHGDKEFNE-DMVE-GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHV 588

Query: 659 HMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVN--FMVMAATDFDALSDQEIDDLRVLP 716
            M+TGD   TA SIA+++GI           V+N  + V++    D ++D ++  +    
Sbjct: 589 IMITGDAENTAVSIARQIGI----------PVINPEYSVLSGDKLDQMTDDQLASVIDHV 638

Query: 717 LVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASD 776
            V AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G+DVAK+ASD
Sbjct: 639 NVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASD 698

Query: 777 IVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPL 836
           +VL+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +             PL
Sbjct: 699 MVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPN-----PL 753

Query: 837 SPVEVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAAC 896
           + +++LWI ++    PA  LG+E    +VM KPP+       T +++ D ++  V+++AC
Sbjct: 754 NAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKR-----TDKILTDAVLKRVLISAC 808

Query: 897 CM---ACFVTVLYGTGDGNLGSDCNDALGETCHLVF 929
            +     +V V     DG + S  +  +  TC + F
Sbjct: 809 FIIVGTIYVFVKEMAEDGQVTSR-DTTMTFTCFVFF 843

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score =  343 bits (879), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 288/999 (28%), Positives = 475/999 (47%), Gaps = 142/999 (14%)

Query: 13  PYARNDFHVLTAPQVEKLLSTHINQGL-NNTQIAERLSLVGENTLGDDTKINI-KGILIS 70
           P A  ++  +T  +  + L+T   +GL +  Q+       G N +  D +  + K  + +
Sbjct: 38  PNASLEYCTMTVDETLRQLNTDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMST 97

Query: 71  QICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTP 130
            + + +I++LI S V++  + +      +   V I V +G  QEY + K++ +L  L   
Sbjct: 98  FVEDPLILLLIGSAVLSFLMGNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPA 157

Query: 131 SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190
           S H+IR G +  + +  LVPGD+   KVGD +PAD+R++ES +L  DE+ LTGE+ PV K
Sbjct: 158 SCHLIRFGAETHVLASCLVPGDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHK 217

Query: 191 S--------HSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS 242
           S        +S+V     P+G+R ++A+  + V +G   GIV+ T  +T  G + + + S
Sbjct: 218 SCTPVNSATYSDVPGGIIPIGERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNS 277

Query: 243 ETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXM 302
                  ++ K+  Q    TL+                R LS                 +
Sbjct: 278 ------IEKPKTPLQMAMDTLR----------------RDLS-----YVRFVLSGIIFLL 310

Query: 303 GTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGA 362
           G  + R   ++   ++ +A++ IP  L +++T+T++ G   MA R  IVR+L S+E LG+
Sbjct: 311 GVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKAIVRRLPSVETLGS 370

Query: 363 VNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHD 422
           VN ICSDKTGTLT   M A ++W    G++                              
Sbjct: 371 VNVICSDKTGTLTANHMTASKIWC--LGSMA----------------------------- 399

Query: 423 DEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTE 482
           ++ +V  +    S  L G+L  L   L D    T  + +I      S  +  K  G+PT+
Sbjct: 400 NKNNVLSLEAKSSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSH-EHGKYLGNPTD 458

Query: 483 IAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPA 542
           IA+     + DL              D R  ++   V E  F+S  K M+    +  +  
Sbjct: 459 IALLEVLQKFDL-------------VDERPTTT--RVDELTFNSKRKYMAVKVDSPANSG 503

Query: 543 TPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAK 602
             I  ++ KGAFER+L+   S+     GK   LS      I     +L+SEGLR LAFA 
Sbjct: 504 KHI--IYVKGAFERILERSASFIGGA-GKVEKLSDSHKSLINDCAKSLASEGLRTLAFA- 559

Query: 603 KSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLT 662
               + E + NK       D     LTF+GLIG+ DPPR     A+++  Q G++V M+T
Sbjct: 560 ----QLECSTNKPM----NDSTIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMIT 611

Query: 663 GDFPGTAKSIAQEVGILPHNLYHYPKEVVN--FMVMAATDFDALSDQEIDDLRVLPLVIA 720
           GD   TA +IA+++GI           V+N    V+     D ++D ++  +     + A
Sbjct: 612 GDAENTAVNIARQIGI----------PVINPEISVLTGDRLDQMTDDQLAGVIDHVNIFA 661

Query: 721 RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780
           R  P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G+AMG  G+DVAK+ASD+VL+
Sbjct: 662 RATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLT 721

Query: 781 DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVE 840
           DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +   F  +      PL+ ++
Sbjct: 722 DDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQN-----PLNAMQ 776

Query: 841 VLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCMAC 900
           +LWI ++    PA  LG+E    +VM KPP+     + T +V+  +L+    +    +  
Sbjct: 777 ILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIYV 836

Query: 901 FVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTWCALILAWEVVDMRRSFFMM 960
           F+  +  T DG +                    A   TMT+   +      DM  +    
Sbjct: 837 FIKEM--TEDGQV-------------------TARDTTMTFTCFVF----FDMFSALACR 871

Query: 961 NPESETPYTQVFKDIWSNQFLFWSIVGGFCSVFPVVYIP 999
           +         +F +   N  + +S++G  C+    +YIP
Sbjct: 872 HATKSIFEIGIFNNKMFNYAVGFSLLGQLCA----IYIP 906

>Kwal_14.1498
          Length = 939

 Score =  340 bits (873), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 266/912 (29%), Positives = 441/912 (48%), Gaps = 124/912 (13%)

Query: 13  PYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAE-RLSLVGENTLGDDTKINIKGILISQ 71
           P    +F  L+  +  + L T    GL    + E R +  G+N +  +    +    ++ 
Sbjct: 27  PQPSLEFCSLSVEETAQSLGTDTQNGLPTMSVVEERRAQYGKNEISSEEDEPLWWKFVTT 86

Query: 72  -ICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTP 130
            + + +I++LI S VI+  + +      +   + I V +G  QEY + K++ +L  L   
Sbjct: 87  FVGDPLILLLIGSAVISFIMGNIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPD 146

Query: 131 SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190
             H+IR G +  + +  LVPGD+   +VGD +PADLR++E+++L  +E+ LTGE+ PV K
Sbjct: 147 QCHLIRCGQESKLLASVLVPGDVVRFRVGDRIPADLRIIEAVDLSIEESNLTGENEPVHK 206

Query: 191 S----HSEVYEKD----TPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS 242
           S    + E Y+++     PV +R  +AF  + V +G   GIVI TA NT  GK+ + + +
Sbjct: 207 STATVNKEFYKENLGSIVPVSERSCIAFMGTLVREGHGRGIVIGTAKNTAFGKVFEMMNA 266

Query: 243 ETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXX-- 300
               I K +                         TPL   + +                 
Sbjct: 267 ----IEKPK-------------------------TPLQTAMDKLGKDLSFMSFIVIGIIC 297

Query: 301 XMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEAL 360
            +G  + R   ++   ++ +A++ IP  L +++T+T++ G   MA R  I+R+L S+E L
Sbjct: 298 LIGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRAIIRRLPSVETL 357

Query: 361 GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYK 420
           G+VN ICSDKTGTLT   M   +VW    G+++  +SN         I  + K +   +K
Sbjct: 358 GSVNVICSDKTGTLTANHMSVNKVWC--LGSMS-NKSN---------ILKLDKATSGSFK 405

Query: 421 HDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDP 480
            +  ED+                          L T  L N +T       +  K  G+P
Sbjct: 406 KNLTEDL-----------------------RATLRTGNLCNNSTYSH----EHAKYLGNP 438

Query: 481 TEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTED 540
           T+IA+     +  L          +DE+     S      E  F+S  K M+   K    
Sbjct: 439 TDIALLEVLHKFGL----------EDERPQVTRSD-----EISFNSKRKFMAVKVKE--- 480

Query: 541 PATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAF 600
            A   + V  KGA+E++L+   + +   + K   L     + I  + D L+S+GLR LAF
Sbjct: 481 -ANGKFVVHVKGAYEKILEKS-THFINAENKVVKLDSNLRQAITDSADALASDGLRTLAF 538

Query: 601 AKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHM 660
           A     + E +    K L E D     LTF GL+G+ DPPR    AAV++  +  +++ M
Sbjct: 539 A-----QLELSNGNSKKLTEDDI--NGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIM 591

Query: 661 LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVN--FMVMAATDFDALSDQEIDDLRVLPLV 718
           +TGD   TA SIA+++GI           VVN    V+     D +S+ ++  +     +
Sbjct: 592 ITGDAENTAVSIARQIGI----------PVVNPETAVLTGDKLDHMSEDQLASIIDHVNI 641

Query: 719 IARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIV 778
            AR  P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G+DVAK+ASD+V
Sbjct: 642 FARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMV 701

Query: 779 LSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSP 838
           L+DD+F++IL A+EEG+ + +NIQ F+   L+ +VA    + +   F         PL+ 
Sbjct: 702 LTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAFKLPN-----PLNA 756

Query: 839 VEVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCM 898
           +++LWI ++    PA  LG+E    +VM+KPP+     + T  V   +L    ++    +
Sbjct: 757 MQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRADKILTKAVFQRLLQSAALIIIGTI 816

Query: 899 ACFVTVLYGTGD 910
             F+  +   G+
Sbjct: 817 YVFIKEMAEDGE 828

>Scas_707.48*
          Length = 741

 Score =  333 bits (854), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 255/804 (31%), Positives = 403/804 (50%), Gaps = 114/804 (14%)

Query: 13  PYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLV-GENTLGDDTKINI-KGILIS 70
           P A  ++  ++  +  + L T    GL +   A R  LV G N +  +   ++ K  L S
Sbjct: 32  PNASLEYCTMSVDETLRKLETDPKSGLGSIAEASRRKLVYGANEIVIEEDESLWKKFLSS 91

Query: 71  QICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTP 130
            + + +I++LI S V++  + +      +   + I V +G  QEY + K++ +L  L   
Sbjct: 92  FVEDRLILLLIGSAVVSFIMGNIDDAVSITLAIVIVVSVGFVQEYRSEKSLEALNKLVPA 151

Query: 131 SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190
             H+IR G +  + +  LVPGD+   K+GD +PADLR++E+++L  DE+ LTGE+ PV K
Sbjct: 152 ECHLIRCGQESHVLASGLVPGDLVHFKIGDRIPADLRIIEAVDLSIDESNLTGENEPVHK 211

Query: 191 SHSEVYEKDT---------PVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLK 241
           S  EV  KD+         P+ DR  +A+  + V +G   GIV+    NT  G I + L 
Sbjct: 212 SAKEV-NKDSFNDQPNSIIPISDRTCVAYMGTLVKEGHGKGIVVGIGKNTSFGAIFEML- 269

Query: 242 SETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXX 301
              S I K   K+  QN    L + +  F    +G                         
Sbjct: 270 ---SNIEKP--KTPLQNAMDKLGKDLSLFSFIVIG---------------------LICL 303

Query: 302 MGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALG 361
           +G  + R   ++   ++ +A++ IP  L +++T+T++ G   MA R  IVR+L S+E LG
Sbjct: 304 VGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLG 363

Query: 362 AVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKH 421
           +VN ICSDKTGTLT   M A ++W                                  K 
Sbjct: 364 SVNVICSDKTGTLTSNHMTASKIWC---------------------------LDSMANKA 396

Query: 422 DDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPT 481
           +      ++   KSK      G L   L +    T T+ NI      S+ +  K  G+PT
Sbjct: 397 N------VLSLEKSKS-----GSLKNYLTEDVKSTLTIGNICNNASFSQ-EHGKYLGNPT 444

Query: 482 EIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDP 541
           +IA+    ++ DL              D R   +F+ V E PF+S  K M+    N+E  
Sbjct: 445 DIALLEQLSKFDL-------------SDIRP--TFKKVQEIPFNSKRKFMAVKIVNSEGK 489

Query: 542 ATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFA 601
               Y +  KGAFE+VL  C S Y    GK   L++   + I +  ++L+SEGLR+LAFA
Sbjct: 490 ----YSLCVKGAFEKVLSQC-SHYLNQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFA 544

Query: 602 KKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHML 661
           K +  +S        LL E    +  L F GLIG+ DPPR     A+++  Q G+++ M+
Sbjct: 545 KTTLPDSP------TLLTEESVGD--LIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMI 596

Query: 662 TGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIAR 721
           TGD   TA +IA+++GI        P       V++    + +SD ++ ++     + AR
Sbjct: 597 TGDSENTAVNIARQIGI--------PVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFAR 648

Query: 722 CAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSD 781
             P+ K+ ++ AL +R    AMTGDGVND+P+LK+A++G++MG  G+DVAK+ASD+VL+D
Sbjct: 649 ATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTD 708

Query: 782 DNFASILNAVEEGRRMSDNIQKFV 805
           D+F++IL A+EEG+ + +NIQ F+
Sbjct: 709 DDFSTILTAIEEGKGIFNNIQNFL 732

>Kwal_47.17547
          Length = 1240

 Score =  227 bits (578), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 241/954 (25%), Positives = 413/954 (43%), Gaps = 144/954 (15%)

Query: 29  KLLSTHINQGLN----NTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISM 84
           K L T  N GL     +    ER  L G+N +      +   +      + ++++L ++ 
Sbjct: 59  KFLKTDRNAGLTIADEDITQTERYQLYGDNRIPQRKPKSFLQLAWIAFQDRIMILLTVAA 118

Query: 85  VITLAIK---------------------DWISGGVLAFVVGINVVIGAYQEYNASKTMNS 123
           V++ A+                      DW+ G  +   V + +++G+  +Y      + 
Sbjct: 119 VVSFALGLYEVLGQPPEHDAEGKKITKVDWVEGVAIMIAVLVVILVGSANDYQKELQFSK 178

Query: 124 LKSLSTP-SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLT 182
           L          V+R+G++  I   +++ GDI  ++ GD VPAD  L++  + E DE+ LT
Sbjct: 179 LNDKKNDREVIVLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVKG-SCECDESALT 237

Query: 183 GESLPVAKSHSEV-YEK-------------DTPVGDRLN--LAFAASTVTKGRATGIVIK 226
           GES  + K+  +V YEK              TP  +++   +  + S +  G    +V  
Sbjct: 238 GESATIKKAAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTS 297

Query: 227 TALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQX 286
             +N+  G+   +LK E       E          +L  +I S  G+     L   L   
Sbjct: 298 VGVNSMHGRTLMALKVEAETTPLQERLD-------SLANSI-SVYGSAAALLLFFILFMR 349

Query: 287 XXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMAT 346
                             +  R    + I  I V +  +P  L + +T+ ++     MA 
Sbjct: 350 FLANLKKGGELHDLTPAQKGSRF-MNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAK 408

Query: 347 RNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIG 406
              +VR L + E +G+   +CSDKTGTLT+ +M      +  F   T  +  E   P+  
Sbjct: 409 DGNLVRVLRACETMGSATAVCSDKTGTLTENRMTV----VKGFLGSTFFDEAESVGPSDS 464

Query: 407 EI--------------------HLIPKFSPYQYKHDDEEDVGIIPDFKSKYLAGELGPLN 446
           E                     ++    + ++ K ++E+ V     F             
Sbjct: 465 ETDVDLAIANECSEELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKP---------R 515

Query: 447 VSLFDQWLYTATLANIATVFQDSETQDWKAHGDP-----TEIAIQVFATRMDLPRHVLTG 501
            SLF  W         AT  +  E        +P     TE A+  FA + +L    L  
Sbjct: 516 KSLF-PWSRNNKSKKPATAKELVENAAADQPKEPFLGSKTETALLAFAQK-NLGMQNL-- 571

Query: 502 EDKDDEKDARANSSFEHVAEFPFDSSVKRMSAI--YKNTEDPATPIYEVFTKGAFERVLQ 559
               DE D         +   PF+SS K    +  YKN       ++  + KGA E +L+
Sbjct: 572 HHYRDEPDCLGIEKIVQI--IPFESSRKWGGIVVKYKNG------LHRFYIKGAAELLLR 623

Query: 560 CCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSF------------NE 607
            C     + D K + +S++D +   + +  L++E LR ++ A + +            +E
Sbjct: 624 RCMQKRAS-DSKLTLISQKDFDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDE 682

Query: 608 SEFNANKDKLL-----KERDFVE-------CKLTFLGLIGIYDPPRQESLAAVKKCHQAG 655
            E  A    LL        D V          +   G++GI DP R+    +V++C +AG
Sbjct: 683 VEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAG 742

Query: 656 INVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVL 715
           + V M+TGD   TA +IA++  IL       P+       M    F  LS++E   +R+L
Sbjct: 743 VTVRMVTGDNILTATAIAKKCSILSEEQAENPESS-----MEGPRFRKLSNKE--RVRIL 795

Query: 716 P--LVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKD 773
           P   V+AR +P+ K  ++E L +     A+TGDG ND+P+LK+A+VG +MGI G++VA++
Sbjct: 796 PNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVARE 855

Query: 774 ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSV 833
           ASDI+L  D+F++I+NA++ GR +S +I+KF+   L  NV   +   V      +E  SV
Sbjct: 856 ASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEEA-SV 914

Query: 834 FPLSPVEVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAV---VFTWEVII 884
             L+ V++LW+ ++     A+ L  +K   +++E+ PK  +AV   V TW++I+
Sbjct: 915 --LTAVQLLWVNLIMDTLAALALATDKPDENILERKPKGREAVLITVSTWKMIL 966

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  194 bits (494), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 167/596 (28%), Positives = 285/596 (47%), Gaps = 71/596 (11%)

Query: 326  PSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVW 385
            P  L + +T+ ++     M     +VR L + E +G+   ICSDKTGTLT+ +M   + +
Sbjct: 442  PEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATAICSDKTGTLTENRMTVVKGF 501

Query: 386  IPQFG-------------TITVQESN---EPFNPTIGEIHL-IPKFSPYQYKHDDEEDVG 428
                G             +  V  SN         +  I L    F   + +H D+ DV 
Sbjct: 502  AGNLGFDDTTHAENKEIKSAVVLRSNCDASLLTDILSNISLNSTAFENKESQHKDK-DVD 560

Query: 429  IIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVF 488
              P  KS+           SLF       T   IA   ++++ Q     G  TE A+  F
Sbjct: 561  ENPYHKSRK----------SLFPWSRNNRTSQLIADAMKENDEQFL---GSKTETALLAF 607

Query: 489  ATRMDLPRHVLTGEDKDDEKDARANSSFEHVAE-FPFDSSVKRMSAIYKNTEDPATPIYE 547
            A +       L  +D    +   ++   + V +  PF+SS ++  AI     D     Y 
Sbjct: 608  AQKS------LGMKDVHKLRTKPSDLGIDKVVQVIPFESS-RKWGAIAVQLADNKG--YR 658

Query: 548  VFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNE 607
             + KGA E +L+ C +   + D    P++++  +   K +  ++S  LR ++   + F E
Sbjct: 659  FYAKGAAEILLKVCSNQRNS-DNSIVPMNQDLYDESFKKIQDMASHALRTISLVHRDFKE 717

Query: 608  ---SEFNANKDKLLKERDFVECK-----------LTFLGLIGIYDPPRQESLAAVKKCHQ 653
                EF  + D  +   D V              +T   ++G+ DP R+    +V++C +
Sbjct: 718  WPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQR 777

Query: 654  AGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLR 713
            AG+ V M+TGD   TA++I++   IL    Y+ P+       M    F  L  +++  LR
Sbjct: 778  AGVTVRMVTGDNILTARAISRNCNILSEEGYNDPE-----CAMEGPTFRKLPYKKM--LR 830

Query: 714  VLP--LVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVA 771
            V+P   V+AR +P+ K  ++E L +  +  A+TGDG ND+P+LK+A+VG +MGI+G++VA
Sbjct: 831  VIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGISGTEVA 890

Query: 772  KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGF 831
            ++ASDI+L  D+F +I+NA++ GR +S +I+KF+   L  N+   +   V       E  
Sbjct: 891  REASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTFVS-AVASAEET 949

Query: 832  SVFPLSPVEVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKA---VVFTWEVII 884
            SV  L+ V++LW+ ++     A+ L  +K    ++++ PK   A    V TW++I+
Sbjct: 950  SV--LTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKGRDAPLIAVSTWKMIL 1003

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 67/128 (52%), Gaps = 18/128 (14%)

Query: 134 VIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGES-------- 185
           VIR+G++  I   +L+ GD+  ++ GD VPAD  L+ S + E DE+ LTGES        
Sbjct: 243 VIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLI-SGSCECDESALTGESDTIKKVAL 301

Query: 186 LPVAKSHSEVYEKDTP-------VGDRL--NLAFAASTVTKGRATGIVIKTALNTEIGKI 236
            P  + + +++EKD         VG+++   L  + S +  G    ++     N+  G+I
Sbjct: 302 KPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRI 361

Query: 237 AKSLKSET 244
             +LK+E+
Sbjct: 362 MMALKTES 369

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score =  181 bits (460), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 214/407 (52%), Gaps = 38/407 (9%)

Query: 519 VAEFPFDSSVKRMSAIYKNTEDP-ATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSK 577
           V   PF+SS K    + K  E     P Y  F KGA E V + C S+    D     +++
Sbjct: 610 VQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNC-SYKRNSDDTLEEINE 668

Query: 578 EDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERD----------FVECK 627
           ++ +     +  L+S+ LR ++ A K F   E ++   + L+++D          F   K
Sbjct: 669 DNKKETDDEIKNLASDALRAISVAHKDF--CECDSWPPEQLRDKDSPNIAALDLLFNSQK 726

Query: 628 -LTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHY 686
            L   GL+GI DP R     +V++C +AG+ V M+TGD   TAK+IA+   IL  ++   
Sbjct: 727 GLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDISSE 786

Query: 687 PKEVVNFMVMAATDFDALSDQEIDDLRVLP--LVIARCAPQTKVRMIEALHRRSKFCAMT 744
                 +  M  T+F  L+  E   +R+LP   V+AR +P+ K  ++E L       A+T
Sbjct: 787 A-----YSAMEGTEFRKLTKNE--RIRILPNLRVLARSSPEDKRLLVETLKGMGDVVAVT 839

Query: 745 GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKF 804
           GDG ND+P+LK+A+VG +MGI+G++VA++ASDI+L  D+F++I+NA++ GR +S +I+KF
Sbjct: 840 GDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRCVSVSIKKF 899

Query: 805 V-LQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGLEKASV 863
           +  QL+    A  L  +  +   D+       L+ V++LWI ++     A+ L  +K   
Sbjct: 900 IQFQLIVNITAVILTFVSSVASSDETSV----LTAVQLLWINLIMDTLAALALATDKPDP 955

Query: 864 DVMEKPPKDAKA---VVFTWEVIIDMLVYGVIMAACCMACFVTVLYG 907
           ++M++ P+        V TW++I+      +I+       F+   YG
Sbjct: 956 NIMDRKPRGRSTSLISVSTWKMILSQATLQLIVT------FILHFYG 996

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 123/313 (39%), Gaps = 35/313 (11%)

Query: 92  DWISGGVLAFVVGINVVIGAYQEYNASKTMNSL-KSLSTPSAHVIRDGNDITIQSKELVP 150
           DWI G  +   V + V++ A  +Y        L K        VIR+  +I I    ++ 
Sbjct: 153 DWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIHHVLV 212

Query: 151 GDICIIKVGDTVPADLRLLESINLETDEALLTGES-----LPVAKS----------HSEV 195
           GD+  ++ GD VPAD  ++ S   E DE+ +TGES      PV  S           S  
Sbjct: 213 GDVISLQTGDVVPADCVMI-SGKCEADESSITGESNTIQKFPVDNSLRDFKKFNSIDSHN 271

Query: 196 YEKDTPVGDRLN---------LAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSF 246
           + K   +GD +N         +  + S +  G   G++    +N+  G+   SL +E   
Sbjct: 272 HSKPLDIGD-VNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAEP-- 328

Query: 247 ISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQK 306
                 +S    L ++      S  G      L   L                     QK
Sbjct: 329 ------ESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQK 382

Query: 307 YRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDI 366
                 + I +I V +  +P  L + +T+ ++     M     +VR L S E +G+   +
Sbjct: 383 GSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAV 442

Query: 367 CSDKTGTLTQGKM 379
           CSDKTGTLT+  M
Sbjct: 443 CSDKTGTLTENVM 455

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  169 bits (429), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 121/383 (31%), Positives = 204/383 (53%), Gaps = 32/383 (8%)

Query: 522 FPFDSSVKRMSAIYK---NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKE 578
            PF+SS K  + + K   N E+     + ++ KGA E V + C       +G  S + ++
Sbjct: 564 IPFESSRKWSAIVVKLNSNKENEGKK-FRLYVKGAAEIVAKACTLKNVCNEGI-SEIDQK 621

Query: 579 DLETIQKNVDTLSSEGLRVLAFAKKSFN------------ESEFNANKDKLLKERDFVEC 626
             + I++ + +L+ + LR ++ A   F+            E+   A   KL+  +     
Sbjct: 622 SKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPHLE 681

Query: 627 KLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHY 686
            LT   ++GI DP R+    +V +C +AG+ V M+TGD   TAK+IA+  GIL     + 
Sbjct: 682 GLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLND 741

Query: 687 PKEVVNFMVMAATDFDALSDQEIDDLRVLP--LVIARCAPQTKVRMIEALHRRSKFCAMT 744
                +   M    F  LSD E    R+LP   V+AR +P+ K  ++ AL    +  A+T
Sbjct: 742 -----SACAMEGPAFRKLSDSERK--RILPKLRVLARSSPEDKKILVRALKEMGEVVAVT 794

Query: 745 GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKF 804
           GDG ND+P+LK+A+VG +MGI G++VA++ASDI+L  D+F++I+NA++ GR ++ +I+KF
Sbjct: 795 GDGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKF 854

Query: 805 VLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGLEKASVD 864
           +   L  NV   L   V    +  +  SV  L+ V++LW+ ++     A+ L  +K   +
Sbjct: 855 IQFQLIVNVTAVLLTFV-TSVISSDVKSV--LTAVQLLWVNLIMDTLAALALATDKPDPN 911

Query: 865 VMEKPPKDAKAVVF---TWEVII 884
           +M++ PK     +    TW++II
Sbjct: 912 IMDRKPKGRSTPLITPSTWKMII 934

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 85/312 (27%), Positives = 125/312 (40%), Gaps = 35/312 (11%)

Query: 92  DWISGGVLAFVVGINVVIGAYQEYNASKTMNSL-KSLSTPSAHVIRDGNDITIQSKELVP 150
           DWI G  +   V + V++ A  +Y        L +        V+RD  +  I    L+ 
Sbjct: 118 DWIEGLAIMMAVLVVVLVSAANDYQKELQFQQLNRKREDRQVVVVRDAAESLISIHNLLV 177

Query: 151 GDICIIKVGDTVPADLRLLESINLETDEALLTGES-----LPVAKS---HSEVYEKDTPV 202
           GD+  ++ GD VPAD  L+     ETDE+ LTGES     LP+A +   HS    +D  +
Sbjct: 178 GDLLKLQTGDVVPADCVLVRG-ECETDESALTGESNTIKKLPLADALEYHSAHGGRD--I 234

Query: 203 GDRLN---------------LAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFI 247
           GD                  +  + S V  G A+ IV    +N+  GK   SLK      
Sbjct: 235 GDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLK------ 288

Query: 248 SKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKY 307
            +D   +  Q     L + I S  G      L   L                     +K 
Sbjct: 289 -EDSEDTPLQMRLSQLTDNI-SVYGCVAAITLFVVLFARYLSYILPSGGKYHDLPPAEKG 346

Query: 308 RVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDIC 367
                + I AI V +  +P  L + +T+ ++     M     +VR L S E +G+   +C
Sbjct: 347 SKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVC 406

Query: 368 SDKTGTLTQGKM 379
           SDKTGTLT+  M
Sbjct: 407 SDKTGTLTENIM 418

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  161 bits (407), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 121/406 (29%), Positives = 206/406 (50%), Gaps = 45/406 (11%)

Query: 519 VAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDG--KPSPLS 576
           V   PF+SS K    + +  +      Y  F KGA E + + C    ++ D   K SP  
Sbjct: 575 VQMIPFESSRKWAGLVVRLVDGN----YRFFIKGASETIFKSCHYMRSSNDDVIKLSPQK 630

Query: 577 KEDLETIQKNVDTLSSEGLRVLAFAKKSFNE------------SEFNANKDKLLKERDFV 624
             ++  +   ++ L+S+ LR ++ A K F +            S+ +     LL   ++V
Sbjct: 631 HGEIFGL---INNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYV 687

Query: 625 -------------ECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKS 671
                           L   G++GI+DP R     +VK C Q+G+ V M+TGD   T ++
Sbjct: 688 PTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRA 747

Query: 672 IAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMI 731
           IA+  GIL  + Y       +   M    F  LS +++ D      V+AR +P+ K   +
Sbjct: 748 IARACGILSESEY-----ADHECAMEGPVFRKLSRRQMMDAAPKLKVLARSSPEDKRIFV 802

Query: 732 EALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAV 791
           + L + ++  A+TGDG ND+P+L +A+VG +MGI+G+ VA++ASDI+L  D+F SI+NA+
Sbjct: 803 DILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDDFTSIVNAI 862

Query: 792 EEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCF 851
           + GR +S +I+KF+   L  N+  A+ L         E   V  L+ V++LW+ ++    
Sbjct: 863 KWGRCVSLSIKKFIQFQLTVNIT-AVTLTCVTAVTSTEENPV--LTAVQLLWVNLIMDTL 919

Query: 852 PAMGLGLEKASVDVMEKPP--KDAKAV-VFTWEVIIDMLVYGVIMA 894
            A+ L  +K    ++E+ P  +D+  + V TW++I+   V  +I+A
Sbjct: 920 AALALATDKPDPHILERIPTGRDSPLIAVSTWKMILGQAVLQLIIA 965

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%)

Query: 326 PSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMI 380
           P  L + +T+ ++     M     +VR L + E +G+   +CSDKTGTLTQ KM+
Sbjct: 387 PEGLPLAVTLALAFATTRMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQNKMV 441

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 59/128 (46%), Gaps = 19/128 (14%)

Query: 134 VIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK--- 190
           V+R+G+   I   +L+ GD+  ++ GD VP D  L+E    E DE+ +TGES  + K   
Sbjct: 187 VVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEG-KCECDESGITGESDTIKKVSL 245

Query: 191 -SHSEVYE---KDTP---VGDRLN--------LAFAASTVTKGRATGIVIKTALNTEIGK 235
               +VY     D P   +G   N        +  + S +  G    +V     ++  GK
Sbjct: 246 AMSLQVYRTVAADNPSADIGSSDNGHSLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGK 305

Query: 236 IAKSLKSE 243
           +  +LKSE
Sbjct: 306 MMLALKSE 313

>Kwal_47.17522
          Length = 899

 Score =  130 bits (327), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 106/359 (29%), Positives = 176/359 (49%), Gaps = 48/359 (13%)

Query: 25  PQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISM 84
           P  E+LL T  + GL + ++ +R    G N + ++++  +   L+  I   +  V+  + 
Sbjct: 55  PVPEELLQTDPSYGLTSDEVTKRRKKYGLNQMAEESESLVVKFLMFFI-GPIQFVMEAAA 113

Query: 85  VITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQ 144
           ++   ++DW+  GV+  ++ +N  +G  QEY A   ++ LK     SA V+RDGN + I 
Sbjct: 114 ILAAGLEDWVDFGVILGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIP 173

Query: 145 SKELVPGDICIIKVGDTVPADLRLL-ESINLETDEALLTGESLPVAKSHSEVYEKDTPVG 203
           + E+VPGDI  ++ G  + AD RL+ E   L+ D++ +TGESL V K + +         
Sbjct: 174 ANEVVPGDIMQLEDGVVICADGRLVTEECFLQIDQSAITGESLAVDKHYGDT-------- 225

Query: 204 DRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFG-QNLWIT 262
                 F++STV +G    IV  T  NT +G+ A  +           N++ G Q  +  
Sbjct: 226 -----TFSSSTVKRGEGFMIVTATGDNTFVGRAAALV-----------NQAAGDQGHFTE 269

Query: 263 LKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAI--YAICV 320
           +   IG+ L   V   L    +                      YR ++ V I  Y + +
Sbjct: 270 VLNGIGTILLVLVIVTLLLVWTACF-------------------YRTDRIVRILRYTLGI 310

Query: 321 AISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
            I  +P  L  V+T TM+ GA  +A +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 311 TIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/306 (26%), Positives = 143/306 (46%), Gaps = 40/306 (13%)

Query: 523 PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLET 582
           PFD   K+++A+ ++ E        +  KGA   VL+  +        +  P+ ++  E 
Sbjct: 431 PFDPVSKKVTAVVESPEGERI----ICVKGAPLFVLKTVE--------EDHPIPEDVHEN 478

Query: 583 IQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQ 642
            +  V  L+S G R L  A+K                     E     LG++   DPPR 
Sbjct: 479 YENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMPCMDPPRD 519

Query: 643 ESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFD 702
           ++   V +  + G+ V MLTGD  G AK   +++G L  N+Y+  +       +      
Sbjct: 520 DTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAER-------LGLGGGG 571

Query: 703 ALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIA 762
            +   E+ D        A   PQ K  ++E L +R    AMTGDGVND+PSLK A+ GIA
Sbjct: 572 DMPGSELADFVENADGFAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIA 631

Query: 763 MGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVG 822
           +    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++   ++L + 
Sbjct: 632 VE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLW 690

Query: 823 LCFVDK 828
           +  +++
Sbjct: 691 IAILNQ 696

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 169/355 (47%), Gaps = 46/355 (12%)

Query: 28  EKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVIT 87
           E+ L T  + GL + ++A R    G N + D+ +  I   ++      +  V+  + ++ 
Sbjct: 61  EEYLQTDPSYGLTSDEVAHRRKKYGLNQMADERESMIVKFVMF-FVGPIQFVMEAAAILA 119

Query: 88  LAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKE 147
             + DW+  GV+  ++ +N  +G  QE+ A   ++ LK      A VIRDG  + + + E
Sbjct: 120 AGLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRDGQLVEVPANE 179

Query: 148 LVPGDICIIKVGDTVPADLRLL-ESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRL 206
           +VPGDI  ++ G  +PAD RL+ E+  L+ D++ +TGESL V K +          GD+ 
Sbjct: 180 VVPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAVDKGY----------GDQ- 228

Query: 207 NLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKET 266
              F++STV +G A  +V  T  NT +G+ A  +           NK+ G          
Sbjct: 229 --TFSSSTVKRGEAFMVVTATGDNTFVGRAAALV-----------NKASGGQ-------- 267

Query: 267 IGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMI- 325
            G F  T V       L+                      YR +  V I    + I++I 
Sbjct: 268 -GHF--TEV-------LNGIGILLLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIG 317

Query: 326 -PSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
            P  L  V+T TM+ GA  +A +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 318 VPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 372

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 87/302 (28%), Positives = 141/302 (46%), Gaps = 41/302 (13%)

Query: 519 VAEF-PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSK 577
           V EF PFD   K+++A+ ++ E        V  KGA   VL+  +        +  P+ +
Sbjct: 429 VIEFHPFDPVSKKVTAVVESPEGERI----VCVKGAPLFVLKTVE--------EDHPIPE 476

Query: 578 EDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIY 637
           +  E  +  V  L+S G R L  A+K                     E     LG++   
Sbjct: 477 DVHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMPCM 517

Query: 638 DPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMA 697
           DPPR ++   V +  + G+ V MLTGD  G AK   +++G L  N+Y+  +       + 
Sbjct: 518 DPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAER-------LG 569

Query: 698 ATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIA 757
                 +   E+ D        A   PQ K +++E L  R    AMTGDGVND+PSLK A
Sbjct: 570 LGGGGDMPGSELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKA 629

Query: 758 NVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQAL 817
           + GIA+    SD A+ A+DIV      ++I++A++  R++   +  +V+  +A ++   L
Sbjct: 630 DTGIAVE-GASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEL 688

Query: 818 YL 819
           +L
Sbjct: 689 FL 690

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  130 bits (326), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 107/373 (28%), Positives = 178/373 (47%), Gaps = 52/373 (13%)

Query: 11  DSPYARNDFHVLTAPQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTK-INIKGILI 69
           D P A  +      P  E+ L T  + GL + ++ +R    G N + D+ + + +K ++ 
Sbjct: 64  DGPVAAGE----ARPVPEEYLQTDPSYGLTSDEVLKRRKKYGLNQMADEKESLVVKFVMF 119

Query: 70  SQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLST 129
                 +  V+  + ++   + DW+  GV+  ++ +N  +G  QE+ A   ++ LK    
Sbjct: 120 --FVGPIQFVMEAAAILAAGLSDWVDFGVICGLLMLNAGVGFVQEFQAGSIVDELKKTLA 177

Query: 130 PSAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLL-ESINLETDEALLTGESLPV 188
            +A VIRDG  + I + E+VPGDI  ++ G  +P D R++ E   L+ D++ +TGESL V
Sbjct: 178 NTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAV 237

Query: 189 AKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFIS 248
            K +          GD+    F++STV +G    +V  T  NT +G+ A       + ++
Sbjct: 238 DKHY----------GDQ---TFSSSTVKRGEGFMVVTATGDNTFVGRAA-------ALVN 277

Query: 249 KDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYR 308
           K    + GQ  +  +   IG  L   V   L    +                      YR
Sbjct: 278 K---AAGGQGHFTEVLNGIGIILLVLVIATLLLVWTACF-------------------YR 315

Query: 309 VNKQVAI--YAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDI 366
            N  V I  Y + + I  +P  L  V+T TM+ GA  +A +  IV+KL ++E+L  V  +
Sbjct: 316 TNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEIL 375

Query: 367 CSDKTGTLTQGKM 379
           CSDKTGTLT+ K+
Sbjct: 376 CSDKTGTLTKNKL 388

 Score =  109 bits (273), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 87/310 (28%), Positives = 144/310 (46%), Gaps = 41/310 (13%)

Query: 519 VAEF-PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSK 577
           V EF PFD   K+++A+ ++ E        V  KGA   VL+  +        +  P+ +
Sbjct: 445 VLEFHPFDPVSKKVTAVVESPEGERI----VCVKGAPLFVLKTVE--------EDHPIPE 492

Query: 578 EDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIY 637
           +  E  +  V  L+S G R L  A+K                     E     LG++   
Sbjct: 493 DVHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMPCM 533

Query: 638 DPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMA 697
           DPPR ++   V +    G+ V MLTGD  G AK   +++G L  N+Y+  +       + 
Sbjct: 534 DPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAER-------LG 585

Query: 698 ATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIA 757
                 +   E+ D        A   PQ K R++E L  R    AMTGDGVND+PSLK A
Sbjct: 586 LGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKA 645

Query: 758 NVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQAL 817
           + GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++   +
Sbjct: 646 DTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEI 704

Query: 818 YLMVGLCFVD 827
           +L + +  +D
Sbjct: 705 FLGLWIAILD 714

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  129 bits (324), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 110/371 (29%), Positives = 175/371 (47%), Gaps = 49/371 (13%)

Query: 15  ARNDFHVLTA---PQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQ 71
           + +D HV      P  E+LL T  + GL + ++ +R    G N + ++T+ N+    +  
Sbjct: 42  SEDDEHVAAGSARPVPEELLQTDPSYGLTSDEVTKRRKKYGLNQMSEETE-NLFVKFLMF 100

Query: 72  ICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPS 131
               +  V+  + ++   ++DW+  GV+  ++ +N  +G  QEY A   ++ LK     S
Sbjct: 101 FIGPIQFVMEAAAILAAGLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANS 160

Query: 132 AHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLL-ESINLETDEALLTGESLPVAK 190
           A VIRDGN + + S E+VPGDI  ++ G  +PAD RL+ E   ++ D++ +TGESL V  
Sbjct: 161 AVVIRDGNLVEVPSNEVVPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAV-- 218

Query: 191 SHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKD 250
                   D   GD     F++STV   R    +I TA              +++F+   
Sbjct: 219 --------DKRFGDS---TFSSSTVK--RGEAFMIVTA------------TGDSTFV--- 250

Query: 251 ENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVN 310
                G+   +  K   GS   T V       L+                      YR N
Sbjct: 251 -----GRAAALVNKAAAGSGHFTEV-------LNGIGTILLILVIVTLLLVWVASFYRTN 298

Query: 311 KQVAI--YAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICS 368
           K V I  Y + + I  +P  L  V+T TM+ GA  +A +  IV+KL ++E+L  V  +CS
Sbjct: 299 KIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCS 358

Query: 369 DKTGTLTQGKM 379
           DKTGTLT+ K+
Sbjct: 359 DKTGTLTKNKL 369

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 149/320 (46%), Gaps = 41/320 (12%)

Query: 510 ARANSSFEHVAEF-PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTP 568
           A+A  +   + EF PFD   K+++AI ++ E        +  KGA   VL+  +      
Sbjct: 417 AKAALTKYKLLEFHPFDPVSKKVTAIVESPEGERI----ICVKGAPLFVLKTVE------ 466

Query: 569 DGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKL 628
             +  P+ ++  E  +  V  L+S G R L  A+K                     E   
Sbjct: 467 --EEHPIPEDVRENYENKVAELASRGFRALGVARKRG-------------------EGHW 505

Query: 629 TFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK 688
             LG++   DPPR ++   V +    G+ V MLTGD  G AK   +++G L  N+Y+  +
Sbjct: 506 EILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAER 564

Query: 689 EVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGV 748
                  +       +   E+ D        A   PQ K  ++E L +R    AMTGDGV
Sbjct: 565 -------LGLGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGV 617

Query: 749 NDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQL 808
           ND+PSLK A+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  
Sbjct: 618 NDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYR 676

Query: 809 LAENVAQALYLMVGLCFVDK 828
           +A ++   ++L + +  +++
Sbjct: 677 IALSLHLEIFLGLWIAILNR 696

>Scas_297.1
          Length = 800

 Score =  125 bits (315), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 87/285 (30%), Positives = 151/285 (52%), Gaps = 28/285 (9%)

Query: 663 GDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLP--LVIA 720
           GD   TA++IA+   IL    Y  P+       +    F  L+ QE   +++LP   V+A
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPE-----CAIEGPKFRTLTKQE--RIKMLPNLRVMA 53

Query: 721 RCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780
           R +P+ K  ++E L       A+TGDG ND+P+LK+A+VG +MGI+G++VA++ASDI+L 
Sbjct: 54  RSSPEDKRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILM 113

Query: 781 DDNFASILNAVEEGRRMSDNIQKFV-LQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPV 839
            D+FA+I++A++ GR +S +I+KF+  QL+    A  L  +  +   D+       L+ V
Sbjct: 114 TDDFAAIVDAIKWGRCVSISIKKFIQFQLIVNITAVILAFVSSIASEDETSV----LTAV 169

Query: 840 EVLWIIVVTSCFPAMGLGLEKASVDVMEKPPK-DAKAVVF--TWEVIIDMLVYGVIMAAC 896
           ++LWI ++     A+ L  +K   ++M++ P+  +  ++F  TW+         +I++  
Sbjct: 170 QLLWINLIMDTLAALALATDKPDPNIMDRKPRGRSTPLIFPSTWK---------MILSQS 220

Query: 897 CMACFVTVLYGTGDGNLGSDCNDALGETCHLVFRGRAAAFATMTW 941
           C+   VT +       +     D +  T H   +  A  F T  W
Sbjct: 221 CLQLIVTFILHFNGKEIFFRGRDEI--TGHEQQQLNAMTFNTFVW 263

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 74/174 (42%), Gaps = 23/174 (13%)

Query: 92  DWISGGVLAFVVGINVVIGAYQEYNASKTMNSL-KSLSTPSAHVIRDGNDITIQSKELVP 150
           DWI G  +   V + V +GA  +Y        L K        VIR+  ++      L+ 
Sbjct: 559 DWIEGIAIMIAVIVVVFVGAVNDYQKELQFARLNKKKENRKIIVIRNSQELLTSIHNLLV 618

Query: 151 GDICIIKVGDTVPADLRLLESINLETDEALLTGESLPV-----------------AKSHS 193
           GDI  ++ GD +PAD  L+E    E DE+ +TGES  +                  KS+ 
Sbjct: 619 GDIITLQTGDVIPADGVLVEG-QCEVDESSITGESDTIKKVKVFNALKTFDVINEGKSND 677

Query: 194 EVYEK--DTPVGDRLN--LAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSE 243
           ++ +    TP GD++   +  + S +  G    I+     N+  G+   +LK E
Sbjct: 678 QILDIGFKTPNGDKIPDCMLISGSKLLSGLGKAIITSVGTNSIHGRTMMALKVE 731

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  126 bits (316), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 106/355 (29%), Positives = 168/355 (47%), Gaps = 46/355 (12%)

Query: 28  EKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVIT 87
           EK LST    GL + ++A R    G N + ++ +  I   L+      +  V+  + ++ 
Sbjct: 106 EKDLSTDPAYGLTSDEVARRRKKYGLNQMAEENESLIVKFLMF-FVGPIQFVMEAAAILA 164

Query: 88  LAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKE 147
             + DW+  GV+  ++ +N  +G  QE+ A   ++ LK     +A VIRDG  I I + E
Sbjct: 165 AGLSDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANE 224

Query: 148 LVPGDICIIKVGDTVPADLRLL-ESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRL 206
           +VPG+I  ++ G   PAD R++ E   L+ D++ +TGESL   K +          GD +
Sbjct: 225 VVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKHY----------GDEV 274

Query: 207 NLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKET 266
              F++STV  G A  +V  T  NT +G+ A +L  + S +     +       I L   
Sbjct: 275 ---FSSSTVKTGEAFMVVTATGDNTFVGR-AAALVGQASGVEGHFTEVLNGIGIILLVLV 330

Query: 267 IGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAI--YAICVAISM 324
           I + L   V T                             YR    V+I  Y + + I  
Sbjct: 331 IATLL--LVWTACF--------------------------YRTVGIVSILRYTLGITIIG 362

Query: 325 IPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           +P  L  V+T TM+ GA  +A +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 363 VPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 417

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 140/302 (46%), Gaps = 41/302 (13%)

Query: 519 VAEF-PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSK 577
           V EF PFD   K+++A+ ++ E        V  KGA   VL+  +        +  P+ +
Sbjct: 474 VLEFHPFDPVSKKVTAVVESPEGERI----VCVKGAPLFVLKTVE--------EDHPIPE 521

Query: 578 EDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIY 637
           +  E  +  V  L+S G R L  A+K                     E     LG++   
Sbjct: 522 DVHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMPCM 562

Query: 638 DPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMA 697
           DPPR ++   + +    G+ + MLTGD  G AK   +++G L  N+Y+  +       + 
Sbjct: 563 DPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLG-LGTNIYNAER-------LG 614

Query: 698 ATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIA 757
                 +   E+ D        A   PQ K R++E L  R    AMTGDGVND+PSLK A
Sbjct: 615 LGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKA 674

Query: 758 NVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQAL 817
           + GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++   +
Sbjct: 675 DTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEI 733

Query: 818 YL 819
           +L
Sbjct: 734 FL 735

>Scas_688.1
          Length = 913

 Score =  124 bits (311), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 102/356 (28%), Positives = 169/356 (47%), Gaps = 48/356 (13%)

Query: 28  EKLLSTHINQGLNNTQIAERLSLVGENTLGDDTK-INIKGILISQICNAMIMVLIISMVI 86
           E +L T    GL++ ++A R    G N + ++ + + +K I+       +  V+  + ++
Sbjct: 72  ESMLQTDPAYGLSSDEVARRRKKYGLNQMSEENESLVVKFIMF--FVGPIQFVMEAAAIL 129

Query: 87  TLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSK 146
              + DW+  GV+  ++ +N  +G  QE+ A   +  LK     SA VIRDG  + + + 
Sbjct: 130 AAGLSDWVDFGVICGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPAN 189

Query: 147 ELVPGDICIIKVGDTVPADLRLL-ESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDR 205
           E+VPGDI  ++ G  +PAD R++ E   ++ D++ +TGESL   K +          GD+
Sbjct: 190 EVVPGDILQLEDGVIIPADGRIVTEDCFVQIDQSAITGESLAADKHY----------GDQ 239

Query: 206 LNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKE 265
               F++STV +G A  ++  T  NT +G+ A  +           NK+ G         
Sbjct: 240 ---TFSSSTVKRGEAFMVITATGDNTFVGRAAALV-----------NKASGGQ------- 278

Query: 266 TIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAI--YAICVAIS 323
             G F  T V       L+                      YR +  V I  Y + + I 
Sbjct: 279 --GHF--TEV-------LNGIGIILLVLVIVTLLLVWTASFYRTDGIVRILRYTLGITIV 327

Query: 324 MIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
            +P  L  V+T TM+ GA  +A +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 328 GVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 383

 Score =  108 bits (271), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 89/303 (29%), Positives = 143/303 (47%), Gaps = 43/303 (14%)

Query: 519 VAEF-PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSK 577
           V EF PFD   K+++A+ ++ E        +  KGA   VL+      T  +  P P   
Sbjct: 440 VLEFHPFDPVSKKVTAVVESPEGERI----ICVKGAPLFVLK------TVEEDHPIP--- 486

Query: 578 EDL-ETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGI 636
           ED+ E  +  V  L+S G R L  A+K                     E     LG++  
Sbjct: 487 EDIHENYENKVAELASRGFRALGVARKRG-------------------EGHWEILGVMPC 527

Query: 637 YDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVM 696
            DPPR ++   V +  + G+ V MLTGD  G AK   +++G L  N+Y+  +       +
Sbjct: 528 MDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKETCRQLG-LGTNVYNAER-------L 579

Query: 697 AATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKI 756
             +    +   E+ D        A   PQ K R++E L  R    AMTGDGVND+PSLK 
Sbjct: 580 GLSGGGDMPGSELADFVENADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLKK 639

Query: 757 ANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQA 816
           A+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+  +A ++   
Sbjct: 640 ADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSIHLE 698

Query: 817 LYL 819
           ++L
Sbjct: 699 IFL 701

>Scas_710.41
          Length = 904

 Score =  124 bits (311), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 166/355 (46%), Gaps = 46/355 (12%)

Query: 28  EKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVIT 87
           E  L T    GL   ++  R    G N + ++ +  I   L+      +  V+  + ++ 
Sbjct: 64  ESQLKTDPGIGLTTDEVVRRRKKYGLNQMKEENENFIVKFLM-YFVGPIQFVMEAAAILA 122

Query: 88  LAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKE 147
             + DW+  GV+  ++ +N  +G  QE+ A   +  LK     +A VIRDG    I + E
Sbjct: 123 AGLSDWVDFGVICGLLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPANE 182

Query: 148 LVPGDICIIKVGDTVPADLRLL-ESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRL 206
           +VPGDI  +  G  +PAD RL+ E+  L+ D++ +TGESL V K++ +V           
Sbjct: 183 IVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKNYGDV----------- 231

Query: 207 NLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKET 266
              F++STV  G +  +V  T  NT +G+ A +L  E          S GQ  +  +   
Sbjct: 232 --TFSSSTVKTGTSVMVVTATGDNTFVGR-AAALVGEA---------SGGQGHFTDILND 279

Query: 267 IGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMI- 325
           IG+ L   V   L    +                      YR +  V I    + I++I 
Sbjct: 280 IGTILLVLVIITLLLVWTACF-------------------YRTDGIVMILRFTLGITIIG 320

Query: 326 -PSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
            P  L  V+T TM+ GA  +A +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 321 VPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 375

 Score =  103 bits (256), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 144/312 (46%), Gaps = 43/312 (13%)

Query: 519 VAEF-PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSK 577
           + EF PFD   K+++A+ K+ E           KGA   VL+      T  +  P P   
Sbjct: 432 ILEFHPFDPVSKKVTAVVKSPEGETITC----VKGAPLFVLK------TVEEDHPVP--- 478

Query: 578 EDL-ETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGI 636
           ED+ E  +  V  L+S G R L  A+K                     E     LG++  
Sbjct: 479 EDVHENYENKVAELASRGFRSLGVARKRG-------------------EGYWEILGVMPC 519

Query: 637 YDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVM 696
            DPPR ++   + +    G+ V MLTGD  G AK  ++++G L  N+Y+  K       +
Sbjct: 520 MDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLG-LGVNIYNAEK-------L 571

Query: 697 AATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKI 756
                  +   E+ D        A   PQ K +++E L  R    AMTGDGVND+PSLK 
Sbjct: 572 GLGGGGDMPGSELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKK 631

Query: 757 ANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQA 816
           A+ GIA+    +D A+ A+DIV      ++I++ ++  R++   +  +V+  +A ++   
Sbjct: 632 ADTGIAVE-GATDAARSAADIVFLAPGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLE 690

Query: 817 LYLMVGLCFVDK 828
           ++  + +  +++
Sbjct: 691 IFFGLWIAILNR 702

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  119 bits (299), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 101/358 (28%), Positives = 171/358 (47%), Gaps = 46/358 (12%)

Query: 25  PQVEKLLSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISM 84
           P  E+LL T  + GL + +++ R    G N + +  +  I   ++      +  V+  + 
Sbjct: 55  PVPEELLQTDPSYGLTSDEVSRRRKKYGLNQMSEANESMILKFVMF-FVGPIQFVMEAAA 113

Query: 85  VITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQ 144
           ++   +++WI  G++  ++ +N  +G  QE+ A   +  LK     SA VIRDG+ + I 
Sbjct: 114 ILAAGLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRDGSLVEIP 173

Query: 145 SKELVPGDICIIKVGDTVPADLRLL-ESINLETDEALLTGESLPVAKSHSEVYEKDTPVG 203
           + E+VPGDI  ++ G  +PAD R++ E   ++ D++ +TGESL V K + +         
Sbjct: 174 ANEVVPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKRYGDA-------- 225

Query: 204 DRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITL 263
                 F++STV +G    IV  T  +T +G+ A       + ++K    S G   +  +
Sbjct: 226 -----TFSSSTVKRGEGFMIVTATGDSTFVGRAA-------ALVNK---ASAGSGHFTEV 270

Query: 264 KETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAIS 323
              IG+ L   V   L                           YR    V I    +AI+
Sbjct: 271 LNGIGTILLILVILTLLVVYVACF-------------------YRSIDIVTILRYTLAIT 311

Query: 324 M--IPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           +  +P  L  V+T TM+ GA  +A +  IV+KL ++E+L  V  +CSDKTGTLT+ K+
Sbjct: 312 VVGVPVGLPAVVTTTMAVGAAYLAKKKAIVQKLSAIESLAGVEILCSDKTGTLTKNKL 369

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 90/321 (28%), Positives = 149/321 (46%), Gaps = 43/321 (13%)

Query: 510 ARANSSFEHVAEF-PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTP 568
           A+A  +   V EF PFD   K+++AI ++ E        V  KGA   VL+  +  +  P
Sbjct: 417 AKAALTKYKVLEFHPFDPVSKKVTAIVESPEGERI----VCVKGAPLFVLKTVEENHLIP 472

Query: 569 DGKPSPLSKEDL-ETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECK 627
                    ED+ E  +  V  L+S G R L  A+K                     E  
Sbjct: 473 ---------EDVKENYENKVAELASRGYRALGVARKRG-------------------EGH 504

Query: 628 LTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYP 687
              LG++   DPPR ++   V +    G+ V MLTGD  G AK   +++G L  N+Y+  
Sbjct: 505 WEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLG-LGTNIYNAE 563

Query: 688 KEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDG 747
           +       +       +   E+ D        A   PQ K  ++E L +R    AMTGDG
Sbjct: 564 R-------LGLGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDG 616

Query: 748 VNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 807
           VND+PSLK A+ GIA+    +D A+ A+DIV      ++I++A++  R++   +  +V+ 
Sbjct: 617 VNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVY 675

Query: 808 LLAENVAQALYLMVGLCFVDK 828
            +A ++   ++L + +  +++
Sbjct: 676 RIALSLHLEIFLGLWIAILNQ 696

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 177/819 (21%), Positives = 328/819 (40%), Gaps = 149/819 (18%)

Query: 58   DDTKINIK-----GILISQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAY 112
            D  +IN+K      IL  ++ +   +  ++S+++    + +   G +  +  ++++    
Sbjct: 463  DKNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGCIFLISLLSILDTLI 522

Query: 113  QEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDT--VPADLRLLE 170
            +    S+T+  +   +     V+R+G   +I S ELVPGDI  I   +   +P D  LL 
Sbjct: 523  ETKKISRTLAEMSHFNC-EVRVLREGFWSSIHSSELVPGDIYEISDPNLNLLPCDSILL- 580

Query: 171  SINLETDEALLTGESLPVAK---SHSEVYE-----KDTPVGDRLNLAFAASTVTKGRAT- 221
            S +   +E++LTGES+PV+K   S   + +     + T +   L+ +F  +  T  RA  
Sbjct: 581  SGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKI 640

Query: 222  --------GIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKETIGSFLGT 273
                     + ++T  +T  G + +S+     F      K +  +        I +F G 
Sbjct: 641  PNGGSVALAMAVRTGFSTTKGSLIRSM----VFPKPSGFKFYSDSFKYIGFMAIIAFFGF 696

Query: 274  NVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMIPSSLVVVL 333
            ++      KL                   G  K    + + + A+ +   ++P +L   L
Sbjct: 697  SISCINFIKL-------------------GLDK----RTMILRALDIITIVVPPALPATL 733

Query: 334  TITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTIT 393
            TI  S     +  + +       +   G ++ +C DKTGTLT+  +    V +    +  
Sbjct: 734  TIGTSFALNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRV----SCA 789

Query: 394  VQESNEPFNPTIGEIH-LIPKFS------PYQYKHDDEEDVGIIPDFKSKYLAGEL--GP 444
               +   F+  I + H + PKFS      P  YK  +   + ++     + + GEL   P
Sbjct: 790  ATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFL-ISLLTCHSLRVVDGELLGDP 848

Query: 445  LNVSLFD--QWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGE 502
            L+  +F    W Y     N     Q     + +  G       Q F    D+   ++   
Sbjct: 849  LDFKMFQFTGWSYEEDFQN----HQFHSLYEERHEG-------QNFPENNDIIPAIVHPN 897

Query: 503  DKDDEK---DARANSSFEHVAEFPFDSSVKRMSAIYK-NTEDPATPIYEVFTKGAFERVL 558
            D D+         N+    +  F F S ++RMS I K N E+    +Y  +TKGA E ++
Sbjct: 898  DSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNEN----VYWAYTKGAPEVII 953

Query: 559  QCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLL 618
              C+     P   PS     D + I   ++  +  G RV+A A K+  ++ +  ++    
Sbjct: 954  DICN-----PATLPS-----DYDDI---LNFYTHSGYRVIACAGKTLPKNTWLYSQKV-- 998

Query: 619  KERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGI 678
              R+ VE  + FLG I   +  +  +   + K   A I   M TGD   TA S+ +E  +
Sbjct: 999  -RREEVESNMEFLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQL 1057

Query: 679  LPHNLYHYP---------------KEVVN-------FMVMAATDF--------------- 701
            +  +  + P                E+ N       F +    D+               
Sbjct: 1058 ITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRI 1117

Query: 702  -----DALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKI 756
                 D  S++ ++++ +   + AR +P  K  ++E L +        GDG ND  +LK 
Sbjct: 1118 IFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKA 1177

Query: 757  ANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 795
            A+VGI++    + VA   +  +    +   +L+ ++EGR
Sbjct: 1178 ADVGISLSEAEASVAAPFTSKIF---DITCVLDVIKEGR 1213

>Scas_665.30
          Length = 1439

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 177/830 (21%), Positives = 338/830 (40%), Gaps = 169/830 (20%)

Query: 58   DDTKINIK-----GILISQICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAY 112
            D  +IN++      +L +++ +   +  I S+++    + +   G + F++ I  ++   
Sbjct: 251  DSNQINLRVKTVAELLFNEVLHPFYVFQIFSIILWSLDEYYYYAGCI-FLISILSIVDTL 309

Query: 113  QEYNASKTMNSLKSLS--TPSAHVIRDGNDITIQSKELVPGDICIIKVGD----TVPADL 166
             E    +T  SL  +S       V RD     + S +LVPGDI   ++ D      P D 
Sbjct: 310  VE--TRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDI--YEISDPSLTVFPCD- 364

Query: 167  RLLESINLETDEALLTGESLPVAKSHSEVYE--------KDTPVGDRLN--LAFAASTVT 216
             LL S +   +E++LTGES+PV+K  +E           ++T +   L+    F  +T+ 
Sbjct: 365  SLLLSGDCIVNESMLTGESVPVSKFPAEPETMLQLLDDFQNTQISSYLSKSFLFNGTTII 424

Query: 217  KGR-------ATGIVIKTALNTEIGKIAKSL--KSETSF-ISKDENKSFGQNLWITLKET 266
            + R       A  +V++T  +T  G + +S+     T F   +D  K  G    I L   
Sbjct: 425  RARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIAL--- 481

Query: 267  IGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMIP 326
                 G ++      K+                   G  K    + + + A+ +   ++P
Sbjct: 482  ----FGFSISCIQFIKI-------------------GLDK----RTMILRALDIITIVVP 514

Query: 327  SSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKM--IAKQV 384
             +L   LTI        +  + +       +   G ++ +C DKTGTLT+  +  +  Q+
Sbjct: 515  PALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGVQL 574

Query: 385  WIPQFGTITVQESNEPFNPTIGEIH-LIPKFS------PYQYKHDDEEDVGIIPDFKSKY 437
             +P         ++  F   + ++H L PKFS      P  Y+  +   + ++     + 
Sbjct: 575  CVPS------SHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFF-ISLLTCHSLRV 627

Query: 438  LAGEL--GPLNVSLFD--QWLYTATLANIATVFQDSE---TQDWKAHGDPTEIAIQVFAT 490
            +  EL   PL+  +F   +W Y          FQ+ E   T + + H +     I +   
Sbjct: 628  VDNELIGDPLDFKMFQFTKWSYEED-------FQEKEFHSTYEERRHDNALPENIDIIPA 680

Query: 491  RMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYK-NTEDPATPIYEVF 549
             +    H  + + ++   D   ++    +  F F S ++RMS I K + ED    +Y  F
Sbjct: 681  VV----HPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNED----VYWAF 732

Query: 550  TKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESE 609
            TKGA E + Q C+           P + E++      ++  + +G RV+A A +    + 
Sbjct: 733  TKGAPEVITQICNK-------ATLPANFEEM------LNYYTHKGYRVIACAGRVLPRNT 779

Query: 610  FNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTA 669
            +  ++      R+ VE  + FLG I   +  ++E+   ++   +A I   M TGD   TA
Sbjct: 780  WLYSQKV---SREEVESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTA 836

Query: 670  KSIAQEVGILPHNLYHYP---------------KEVVN---------------------- 692
             S+ ++  ++     + P               ++V N                      
Sbjct: 837  ISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYT 896

Query: 693  -------FMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTG 745
                   F ++   + +++S+  I+ + +   + AR +P  K  ++E L R +      G
Sbjct: 897  LAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCG 956

Query: 746  DGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 795
            DG ND  +LK A+VGI++    + VA   +  V    + + +L+ ++EGR
Sbjct: 957  DGANDCGALKAADVGISLSEAEASVAAPFTSQVF---DISCVLDVIKEGR 1003

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 179/834 (21%), Positives = 327/834 (39%), Gaps = 151/834 (18%)

Query: 35   INQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVITLAIKDWI 94
            +  GL ++   +R    G+N++    K  +  IL  +  +   +  I S+++ LA   + 
Sbjct: 445  VQHGLTSSIQEDRTLAFGKNSVNLKQK-TVTEILFDEALHPFYVFQIFSIILWLADDYYY 503

Query: 95   SGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGDIC 154
              G +  +  ++++    +    S+ +  +   +     V +D     + S +LVPGD+ 
Sbjct: 504  YAGCIFLISVLSIIDTVIETKKNSEKLADISHFNC-EVRVYKDRFWTQVNSSDLVPGDLF 562

Query: 155  IIKVGDTV--PADLRLLESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLAFAA 212
             I     V  P D  L+ S +   +E++LTGES+PV+K     Y        +L   F +
Sbjct: 563  EISDPSLVVLPCDAVLI-SGDCIVNESMLTGESVPVSK-----YAATEATMAQLLQDFKS 616

Query: 213  STVT----------------------KGRATGIVIKTALNTEIGKIAKSLKSETSFISKD 250
            S V+                      +G A  +VI+T  +T  G + +S+        K 
Sbjct: 617  SQVSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMVFPKPVGFKF 676

Query: 251  ENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVN 310
               SF    ++TL    G  +                              +G + Y+V 
Sbjct: 677  YEDSFKYIGFMTLIAMFGFSISC-----------------------IQFIRLGLE-YKV- 711

Query: 311  KQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDK 370
              + + A+ +   ++P +L   LTI  S     +  + +       +   G V+ +C DK
Sbjct: 712  --MILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNVGGKVDMMCFDK 769

Query: 371  TGTLTQGKM--IAKQVWIPQFGTITVQESNEPFN-PTIGEIHLIPKFSPYQYKHDDEEDV 427
            TGTLT+  +  +      P+  +  +Q S+   +   + + H +   +  +        V
Sbjct: 770  TGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLV 829

Query: 428  GIIPDFKSKYLAGEL--GPLNVSLFD--QWLYTATLANIATVFQDSETQDWKAHGDPTEI 483
             ++     K++ GEL   PL++ +F+  +W Y           +  E+  +K   D T I
Sbjct: 830  SLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYE----------EGYESWKFKNAEDKTGI 879

Query: 484  AIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPAT 543
            +  V       P       + D +       SFE ++E      ++RMS I K  ++   
Sbjct: 880  SPAVVH-----PTSNCNFIENDPDNLIGVIRSFEFLSE------LRRMSVIVKGFKENT- 927

Query: 544  PIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKK 603
              Y  FTKGA E +   C+         P+ + K+  E +       +  G R++A A K
Sbjct: 928  --YWSFTKGAPEVIADICN---------PATIPKDFHELLHH----YTHNGFRIIACAGK 972

Query: 604  SFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTG 663
            +  +S +  ++      R+ VE  L FLG I   +  +  + AA+K+   A I   M TG
Sbjct: 973  TLPKSSWLYSQK---VSREEVEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTG 1029

Query: 664  DFPGTAKSIAQEVGILPHNLYHYP------KEVVNFM----------VMAATDFDALSDQ 707
            D   TA S+ ++ G++       P      +E  + +          V+ A     L+D 
Sbjct: 1030 DNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDP 1089

Query: 708  EI--------DDLRVL------------------PLVIARCAPQTKVRMIEALHRRSKFC 741
            E         D  R+L                    + AR +P  K  ++E L +     
Sbjct: 1090 EKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQKLDYNV 1149

Query: 742  AMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 795
               GDG ND  +LK AN+GI++    + VA   +  V    + + +L+ ++EGR
Sbjct: 1150 GFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---DISCVLDVIKEGR 1200

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score =  100 bits (248), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 188/861 (21%), Positives = 330/861 (38%), Gaps = 178/861 (20%)

Query: 31   LSTHINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVITLAI 90
            LST ++ GL      +R    G+N +    K   + IL +++ +   +  + S +I   I
Sbjct: 455  LST-VSNGLTKGVQEDRELAFGKNQINLRMKTTSE-ILFNEVLHPFYVFQVFS-IILWGI 511

Query: 91   KDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLST--PSAHVIRDGNDITIQSKEL 148
             ++       F++ +  +  +  E    K   +L  +S       V+RD    TI S EL
Sbjct: 512  DEYYYYAACIFLISVLSIFDSLNE--QKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSEL 569

Query: 149  VPGDICIIKVGD----TVPADLRLLESINLETDEALLTGESLPVAK---SHSEVYE---- 197
            VPGDI   +V D     +P D  LL S +   +E++LTGES+PV+K   +   +Y+    
Sbjct: 570  VPGDI--YEVSDPNITILPCDSILLSS-DCIVNESMLTGESVPVSKFPATEETMYQLCDD 626

Query: 198  -KDTPVGDRLNLAFA--ASTVTKGR-------ATGIVIKTALNTEIGKIAKSLKSETSFI 247
             + T +   ++ +F    + + + R       A  +V++T  +T  G + +S+       
Sbjct: 627  FQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTG 686

Query: 248  SKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKY 307
             K    SF    +I     I  F G  V      KL                   G  K 
Sbjct: 687  FKFYRDSFK---YIGFMSLIAIF-GFCVSCVQFIKL-------------------GLDK- 722

Query: 308  RVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDIC 367
               K + + A+ +   ++P +L   LTI  +     +  + +       L   G ++ +C
Sbjct: 723  ---KTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMC 779

Query: 368  SDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEI-HLIPKFSPYQYKHDDEED 426
             DKTGTLT+  +    V I +   +  Q+    F   + +I  + PKFS          D
Sbjct: 780  FDKTGTLTEDGLDVLGVQISEPNGVRGQK----FGELLSDIRQVFPKFS--------LND 827

Query: 427  VGIIPDFKSKYLAGEL---------------GPLNVSLFD--QWLYTATLANIA--TVFQ 467
                 DFKS+     L                PL+  +F    W +       A  ++++
Sbjct: 828  CSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYE 887

Query: 468  DSETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDDEK---DARANSSFEHVAEFPF 524
                 D             VF    ++   V+  +  + E    D   ++    V  F F
Sbjct: 888  GRHEDD-------------VFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEF 934

Query: 525  DSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQ 584
             S ++RMS I K   D    +Y  FTKGA E + + C+   T P          D E + 
Sbjct: 935  LSELRRMSVIVKTNNDD---VYWSFTKGAPEVISEICNK-STLP---------ADFEEVL 981

Query: 585  KNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQES 644
            +     +  G RV+A A K+  +  +  ++      R+ VE  L FLG I   +  ++E+
Sbjct: 982  R---CYTHNGYRVIACAGKTLPKRTWLYSQKV---SREEVESNLEFLGFIIFQNKLKKET 1035

Query: 645  LAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK---------------- 688
               +K    A I   M TGD   TA S+ +E G++  +  + P                 
Sbjct: 1036 SETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRD 1095

Query: 689  --------------------------EVVNFMVMAATDF--------DALSDQEIDDLRV 714
                                         N+ +  + D         + + ++ ++++ +
Sbjct: 1096 VNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILL 1155

Query: 715  LPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDA 774
               + AR +P  K  ++  L +        GDG ND  +LK A+VGI++    + VA   
Sbjct: 1156 NSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPF 1215

Query: 775  SDIVLSDDNFASILNAVEEGR 795
            +  +    N + +L+ + EGR
Sbjct: 1216 TSKIF---NISCVLDVIREGR 1233

>Kwal_26.9207
          Length = 1469

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 182/842 (21%), Positives = 325/842 (38%), Gaps = 152/842 (18%)

Query: 33   THINQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVITLAIKD 92
            + I +GL  + + +R+   G N +    K +++ IL  ++ +   +  I S+++ LA  +
Sbjct: 462  SSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLE-ILFDEVLHPFYVFQIFSILLWLA-DN 519

Query: 93   WISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGD 152
            +       F++ +  +I    E   +    +  S S     V RDG  + + S ELVPGD
Sbjct: 520  YYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHCEVRVYRDGFWVQVSSSELVPGD 579

Query: 153  ICIIK--VGDTVPADLRLLESINLETDEALLTGESLPVAK---SHSEVYE-----KDTPV 202
            +  I      T P D  LL S +   +E++LTGES+PV+K   S   +Y+     + T +
Sbjct: 580  VYEISDPSLSTFPCD-SLLLSGDCIVNESMLTGESVPVSKIPASDETIYQLLEDFQKTQI 638

Query: 203  GDRL--NLAFAASTVTKGR-------ATGIVIKTALNTEIGKIAKSLKSETSFISKDENK 253
             + L  +  F  + + + R       A  +V++T  +T  G + +S+        K    
Sbjct: 639  SNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYED 698

Query: 254  SFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQV 313
            SF    ++TL    G  +                              +G   Y+V   +
Sbjct: 699  SFKYIGFMTLIALAGFSISC-----------------------INFIRLGL-AYKV---M 731

Query: 314  AIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGT 373
             + A+ +   ++P +L   L+I  S     +  + +       +   G ++ +C DKTGT
Sbjct: 732  ILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVSGKIDVMCFDKTGT 791

Query: 374  LTQGKM--IAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIP 431
            LT+  +  +   V  PQ         N  F   I  +  +  F+ Y        D G   
Sbjct: 792  LTEDGLDVLGVHVAEPQ------GHQNFRFGALITNVRGL--FNKYSLN-----DCGSPI 838

Query: 432  DFKS-------------KYLAGEL--GPLNVSLFD--QWLYTATLANIATVFQDSETQDW 474
            DFKS             + + GEL   PL+  +F    W Y     +      + E  + 
Sbjct: 839  DFKSRNFLVSLLTCHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNK 898

Query: 475  KAHGDPTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAI 534
                +   IA  V     +      + E+K  E D   ++    +  F F S ++RMS I
Sbjct: 899  STLPENAGIAPAVVHPNAE------STENKFTEND--PHNLLGVIRSFEFVSELRRMSVI 950

Query: 535  YKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEG 594
             K   +    ++  FTKGA E + + C+          S L     + +Q+     +  G
Sbjct: 951  VKPYGE---NVFWGFTKGAPEVISEICNK---------STLPANYEQILQQ----YTHNG 994

Query: 595  LRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQA 654
             RV+A A K+  +  +   +      R+ VE  + FLG +   +  +  +   +     A
Sbjct: 995  YRVIACAGKTLPKRTWRFAQK---VSREEVESNMEFLGFVVFENKLKPSTTPTLASLQDA 1051

Query: 655  GINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK-------------------------- 688
            GI   M TGD   TA S+ +E G++  +    P+                          
Sbjct: 1052 GIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDG 1111

Query: 689  ---EVVN----FMVMAATDF--------DALSDQEIDDLRVLPLVIARCAPQTKVRMIEA 733
               E +N    + +    D         + L +  I+ + +   + AR +P  K  ++  
Sbjct: 1112 VTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQ 1171

Query: 734  LHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEE 793
            L          GDG ND  +LK A+VG+++    + VA   +  V      + IL+ ++E
Sbjct: 1172 LQGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSSVF---EISCILDVIKE 1228

Query: 794  GR 795
            GR
Sbjct: 1229 GR 1230

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 127/504 (25%), Positives = 210/504 (41%), Gaps = 99/504 (19%)

Query: 323 SMIPSSLVVVLTITMSAGAKVM----ATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378
           ++IP SL V L +  S  A  +         IVR     E LG +  + SDKTGTLTQ  
Sbjct: 453 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 512

Query: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438
           M  K++ +      TV  ++E  +     +      S    K+D   +  +        L
Sbjct: 513 MQLKKIHLG-----TVSYTSETLDIVSDYVQ-----SLVSSKNDSLNNSKVA-------L 555

Query: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP--- 495
           +     ++  + D  L  A   N+   F+D E     A   P EIAI  F   + L    
Sbjct: 556 STTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLSLFK 613

Query: 496 --RHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGA 553
             RH ++   +   K      ++E +  FPF+S  KRM  I ++ +              
Sbjct: 614 RDRHSISLLHEHSGKTL----NYEILQVFPFNSDSKRMGIIVRDEQ-------------- 655

Query: 554 FERVLQCCDSWYTTPDGKPSPLSK--EDLETIQKNVDTLSSEGLRVLAFAKKSFN----- 606
                   D ++    G  + +SK  E  + +++    ++ EGLR L   +K  N     
Sbjct: 656 -------LDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYE 708

Query: 607 --ESEFN------ANKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGI 656
             + E+N       N+D+ + +    ++E  L  LGL G+ D  +++  ++++    AGI
Sbjct: 709 QFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGI 768

Query: 657 NVHMLTGDFPGTAKSIAQEVGILPHNLY-HYPKEV--------------VNFMVMAATDF 701
            + MLTGD   TA+ ++    ++    Y H   +V              +N       D 
Sbjct: 769 KIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDG 828

Query: 702 DALS------DQEIDDLRV-LPLVIA-RCAPQTKVRMIEALHRRS--KFCAMTGDGVNDS 751
           ++L       +QE  D+ V LP VIA RC PQ K  +   + + +  + C + GDG ND 
Sbjct: 829 ESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI-GDGGNDV 887

Query: 752 PSLKIANVGIAMGINGSDVAKDAS 775
             ++ A+VG+  GI G +  K AS
Sbjct: 888 SMIQCADVGV--GIVGKE-GKQAS 908

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 133 HVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLES 171
           HVI      +I SK+L  GD+  +  GD +PADL LL+S
Sbjct: 257 HVITRNR--SIPSKDLKVGDLIKVHKGDRIPADLVLLQS 293

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 130/550 (23%), Positives = 223/550 (40%), Gaps = 101/550 (18%)

Query: 323 SMIPSSLVVVLTITMSAGAKVMATR----NVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378
           ++IP SL V L +  S  A+ + +     + IVR     E LG +  + SDKTGTLTQ  
Sbjct: 470 TIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 529

Query: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438
           M  +++     GT++          T+  + ++  +        +    G+      K +
Sbjct: 530 MQLRKI---HLGTVSY---------TMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEV 577

Query: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP--- 495
           +  +  L V+L       AT  N+   F+D+E     A   P EIAI  F  R+ L    
Sbjct: 578 SQRVRDLVVTL-------ATCHNVTPNFEDNELAYQAA--SPDEIAIVKFTERVGLSLFK 628

Query: 496 --RHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGA 553
             RH LT       + +  N  ++ +  FPF S  KRM  I ++         +      
Sbjct: 629 RDRHSLTLF----HEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTV 684

Query: 554 FERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA- 612
             +++Q  D W                  +++ V  ++ EGLR L  A+K  +   +   
Sbjct: 685 MSKIVQSND-W------------------LEEEVSNMAREGLRTLVIARKKLSTRLYEQF 725

Query: 613 ------------NKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINV 658
                       N+D+ + E  +  +E  L  LGL G+ D  +++   +++    AG+ +
Sbjct: 726 SKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKI 785

Query: 659 HMLTGDFPGTAKSIAQEVGILPHNLY-----------------HYPKEVVNFMVMAATDF 701
            MLTGD   TA+ +     ++    Y                  Y K   N  ++   D 
Sbjct: 786 WMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDS 845

Query: 702 DA--LSDQEIDDLRV---LPLVIA-RCAPQTKVRMIEALHRRS--KFCAMTGDGVNDSPS 753
            A  +S    +   +   LP+VIA RC PQ K  +   +   +  + C + GDG ND   
Sbjct: 846 LAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCI-GDGGNDVSM 904

Query: 754 LKIANVGIAM-GINGSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL- 808
           ++ A+VG+ + G  G   +  A   +    +   +L  +  GR   + S  + +FV+   
Sbjct: 905 IQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLL--LWHGRNSYKRSAKLSQFVIHRG 962

Query: 809 LAENVAQALY 818
           L  +V QA+Y
Sbjct: 963 LLISVCQAVY 972

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 174/713 (24%), Positives = 283/713 (39%), Gaps = 153/713 (21%)

Query: 143 IQSKELVPGDICIIKVGDTVPADLRLLESIN------LETDEALLTGES---LPVAKSHS 193
           + SK+L  GD+  I  G  +PADL LL+S        ++TD+  L GE+   L VA S +
Sbjct: 261 VPSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQ--LDGETDWKLRVACSLT 318

Query: 194 EVYEKDTPVGDRLN-LAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKSETSFISKDEN 252
           +    D    D LN ++  AS+  K          +++  +GK+     S  +       
Sbjct: 319 QNLSTD----DLLNKISITASSPEK----------SIHRFLGKLTYKDSSSNAL------ 358

Query: 253 KSFGQNLWI-TLKETIGSFLGTNV--GTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRV 309
            S    +W  T+  ++GS +G  V  GT   + ++                  G  +  +
Sbjct: 359 -SVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMN----------TTMSSVKTGLLELEI 407

Query: 310 NKQVAIYAICVAI----------------------------SMIPSSLVVVLTITMSAGA 341
           N    I   CV +                            ++IP SL V L +  S  A
Sbjct: 408 NSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYA 467

Query: 342 KVM----ATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQES 397
           + +       + IVR     E LG +  + SDKTGTLTQ  M  K++     GT++    
Sbjct: 468 RQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKL---HLGTVSY--- 521

Query: 398 NEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKY-LAGELGPLNVSLFDQWLYT 456
                 T+  + ++   + Y  +         +P   +K  L   +  L V+L       
Sbjct: 522 ------TMDTMDIV---TDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTL------- 565

Query: 457 ATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDD----EKDARA 512
           A   N+   F+D E     A   P EIAI  F   + L    L   D+       + +  
Sbjct: 566 AICHNVTPTFEDGELTYQAA--SPDEIAIVKFTESVGLS---LFKRDRHSVSLFHQHSAT 620

Query: 513 NSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGA---FERVLQCCDSWYTTPD 569
           N  ++ +  FPF+S  KRM  I     D     +    KGA     R++Q  D W    D
Sbjct: 621 NFEYDILQVFPFNSDTKRMGII---VYDKVKGEHWFMQKGADTVMARIVQSND-WL---D 673

Query: 570 GKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKE--RDFVECK 627
            +   +++E L T+      LS +      F K+  + S    N+D+ +    +  +E  
Sbjct: 674 EEVGNMAREGLRTLVIGRKKLSPKSYE--QFRKEYHDASLSMLNRDETMSSVIKKHLEHN 731

Query: 628 LTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHY- 686
           L  LGL G+ D  + +  ++++    AG+ + MLTGD   TA+ ++    ++    Y + 
Sbjct: 732 LELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHT 791

Query: 687 ------PKEVVNFMVMAATD--------------FDALSDQEIDDLRV-LPLVIA-RCAP 724
                 P+  +N +     +              F     QE  D+ V LP VIA RC P
Sbjct: 792 VTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTP 851

Query: 725 QTKVRMIEALHRRS--KFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDAS 775
           Q K  +   +   +  + C + GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 852 QQKADVALLIREITGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 900

>Kwal_23.5789
          Length = 1133

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 139/540 (25%), Positives = 223/540 (41%), Gaps = 84/540 (15%)

Query: 323 SMIPSSLVVVLTITMSAGAKVMATRNVI----VRKLDSLEALGAVNDICSDKTGTLTQGK 378
           ++IP SL V L +  S  A  +   + I    VR     E LG +  + SDKTGTLTQ  
Sbjct: 439 TIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 498

Query: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438
           M  K++     GT++          T+  + ++   + Y     D  +   +P    K L
Sbjct: 499 MELKKL---HLGTVSY---------TMDTMDIV---TDYVRAMSDNLNSSAVPSASKKDL 543

Query: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP--- 495
            G +  L ++L       A    +   F+D E     A   P EIAI  F   + L    
Sbjct: 544 PGRVRDLVLTL-------ALCHQVTPTFEDGELTYQAA--SPDEIAIVKFTESVGLTLFR 594

Query: 496 --RHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMS-AIYKNTEDPATPIYEVFTKG 552
             RH +T         +  N  ++ +  FPF+S  KRM   I+   +D     Y    KG
Sbjct: 595 RDRHSITLL----HDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDE----YWFLQKG 646

Query: 553 A---FERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESE 609
           A     +++Q  D W     G    L++E L T+      LS + L+   F K   + S 
Sbjct: 647 ADVVMSKIVQKND-WLEEETGN---LAREGLRTLVIGRKRLSKKLLQ--TFTKDYEDASL 700

Query: 610 FNANKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPG 667
              N++  +       +E  L  LGL G+ D  +++  ++++    AGI + MLTGD   
Sbjct: 701 MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760

Query: 668 TAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALS---------------------D 706
           TA+ ++    ++    Y +    VN    A T  + L                       
Sbjct: 761 TARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYR 820

Query: 707 QEIDDLRV-LPLVIA-RCAPQTKVRMIEALHRRS--KFCAMTGDGVNDSPSLKIANVGIA 762
           Q+  ++ V LP VIA RC PQ K  +   +   +  + C + GDG ND   ++ A+VG+ 
Sbjct: 821 QQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVG 879

Query: 763 MGINGSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL-LAENVAQALY 818
           +       A  A+D  ++     S L  +  GR   + S  + +FV+   L  +V QA+Y
Sbjct: 880 IVGKEGKQASLAADFSITQFCHLSKL-LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVY 938

>Scas_704.38
          Length = 1161

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 127/492 (25%), Positives = 204/492 (41%), Gaps = 75/492 (15%)

Query: 323 SMIPSSLVVVLTITMSAGAKVMATRNVI----VRKLDSLEALGAVNDICSDKTGTLTQGK 378
           ++IP SL V L +  S  A  +   + I    VR     E LG +  + SDKTGTLTQ  
Sbjct: 463 TIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 522

Query: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438
           M  K++ +      TV  ++E  +     +  +   S     +        +P    K L
Sbjct: 523 MQLKKIHLG-----TVSYTSETLDIVSDYVDALVNSS-----NSANPSGKSVPSTSRKDL 572

Query: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLPRHV 498
           +  +  + V+L       A   N+   F+D E     A   P EIAI  F   + L    
Sbjct: 573 SARVRDMVVTL-------AICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLS--- 620

Query: 499 LTGEDKDDEKDARANS----SFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGA- 553
           L   D+        +S    ++E +  FPF+S  KRM  I     D     Y    KGA 
Sbjct: 621 LFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGII---VHDEQKDEYWFMQKGAD 677

Query: 554 --FERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFN 611
               R+++  D W     G    +++E L T+      LS     +    KK ++++  +
Sbjct: 678 TVMARIVENND-WLEEETGN---MAREGLRTLVVGRKKLSRN---IYDQFKKDYDDASLS 730

Query: 612 -ANKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGT 668
             N+D+ +      ++E  L  LGL G+ D  + +  ++++    AGI + MLTGD   T
Sbjct: 731 MVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVET 790

Query: 669 AKSIAQEVGILPHNLYHY-------PKEVVNFMVMAATDFDA--LSDQE----------- 708
           A+ ++    ++    Y +       P+  +N +     +  A  L D E           
Sbjct: 791 ARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKR 850

Query: 709 --IDDLRVLPLVIA-RCAPQTK--VRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAM 763
              D +  LP V+A RC PQ K  V ++       + C + GDG ND   ++ A+VG+  
Sbjct: 851 EFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCI-GDGGNDVSMIQCADVGV-- 907

Query: 764 GINGSDVAKDAS 775
           GI G +  K AS
Sbjct: 908 GIVGKE-GKQAS 918

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query: 74  NAMIMVLIISMVITLAIKDWISGGV--LAFVVGINVVIGAYQEYNASKTMNSLKSLSTPS 131
           N   +V+ +S  I      ++S  V  LAFV+ + +   A  +    +  N   S     
Sbjct: 209 NLYFLVVALSQAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNS---EL 265

Query: 132 AHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLES 171
            HV+       + SK+L  GD+  I  GD +PADL LL+S
Sbjct: 266 YHVLNQSK--LVPSKDLKVGDLIKISKGDRLPADLVLLQS 303

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 132/493 (26%), Positives = 206/493 (41%), Gaps = 78/493 (15%)

Query: 323 SMIPSSLVVVLTITMSAGAKVM----ATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGK 378
           ++IP SL V L +  S  A  +         IVR     E LG +  + SDKTGTLTQ  
Sbjct: 447 TIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 506

Query: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438
           M  K+V +    + T + ++   +   G I         + K+D   ++G  P   ++  
Sbjct: 507 MQLKKVHLGNV-SYTTETADIVSDYIQGMI---------ESKNDSVTNLG--PRSTTRKD 554

Query: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLPRHV 498
           A         + D     A   N+   F+D E     A   P EIAI  F   + L    
Sbjct: 555 AA------THVIDLITTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLS--- 603

Query: 499 LTGEDKDDEKDARANS----SFEHVAEFPFDSSVKRMSAI-YKNTEDPATPIYEVFTKGA 553
           L   D+        +S    +++ +  FPF+S  KRM  I Y   +D     Y    KGA
Sbjct: 604 LFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQ----YWFLQKGA 659

Query: 554 ---FERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNE--- 607
                R++   D W     G    +++E L T+      L+    ++    KK + E   
Sbjct: 660 DTVMNRIVANND-WLEEETGN---MAREGLRTLVIGRKKLTK---KIYEQFKKEYEEVSA 712

Query: 608 SEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPG 667
           S +N  ++       ++E  L  LGL G+ D  +++  ++++    AGI + MLTGD   
Sbjct: 713 SMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVE 772

Query: 668 TAKSIAQEVGILPHNLYHY-------PKEVVNFMVMAATDFDA--LSD------------ 706
           TA+ ++    ++    Y +       P+   N +     + +A  L D            
Sbjct: 773 TARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYR 832

Query: 707 QEIDDLRV-LPLVIA-RCAPQTK--VRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIA 762
           QE  D+ V LP VIA RC PQ K  V +I       + C + GDG ND   ++ A+VG+ 
Sbjct: 833 QEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCI-GDGGNDVSMIQCADVGV- 890

Query: 763 MGINGSDVAKDAS 775
            GI G +  K AS
Sbjct: 891 -GIVGKE-GKQAS 901

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 127/503 (25%), Positives = 203/503 (40%), Gaps = 103/503 (20%)

Query: 323 SMIPSSLVVVLTITMSAGA-KVMATRNV---IVRKLDSLEALGAVNDICSDKTGTLTQGK 378
           ++IP SL V L +  S  A K+   + +   IVR     E LG +  + SDKTGTLTQ  
Sbjct: 456 TIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQND 515

Query: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438
           M  K++     GT++   +NE  +     I  +           +       P    K +
Sbjct: 516 MQLKKI---HLGTVSY--TNETMDIVTDFIQSM-----------NSRTSNSTPTTTRKNI 559

Query: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP--- 495
           +  +  L  +L       A   N+   F+D E     A   P EIAI  F   + L    
Sbjct: 560 SDRVIDLVTTL-------AICHNVTPTFEDGELTYQAA--SPDEIAIVKFTESVGLSLFR 610

Query: 496 --RHVLT-GEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKG 552
             RH ++   D    K       ++    FPF+S  KRM  I     D     Y    KG
Sbjct: 611 RDRHSISLFHDHSGMK-----LEYDIKILFPFNSDSKRMGVI---IFDKLKQEYWFLQKG 662

Query: 553 AFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFN------ 606
           A + V+              S + + D   +++    +++EGLR L   +K  +      
Sbjct: 663 A-DTVMS-------------SIVVRNDW--LEEETSNMATEGLRTLVIGRKKLSTNLFEQ 706

Query: 607 -ESEFNANKDKLLKE--------RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGIN 657
            E E++     ++          R F+E  L  LGL G+ D  +++  ++++    AGI 
Sbjct: 707 FEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 766

Query: 658 VHMLTGDFPGTAKSIAQEVGILPHN---------------LYHYPKEVVNFMVMAATDFD 702
           + MLTGD   TA+ ++    ++                  L+H     VN       D +
Sbjct: 767 IWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGE 826

Query: 703 ALS-------DQEIDDLRVLPLVIA-RCAPQTKVRMIEALHRRS--KFCAMTGDGVNDSP 752
           +L        D+  D +  LP V+A RC PQ K  +   + + +  + C + GDG ND  
Sbjct: 827 SLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCI-GDGGNDVS 885

Query: 753 SLKIANVGIAMGINGSDVAKDAS 775
            ++ A+VG+  GI G +  K AS
Sbjct: 886 MIQCADVGV--GIVGKE-GKQAS 905

>Scas_583.14*
          Length = 875

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 124/296 (41%), Gaps = 51/296 (17%)

Query: 538 TEDPATPIYEVFTKGAFERVLQCC-------DSWYTTPDGKPSPLSKEDLETIQKNVD-- 588
           T  P T   ++  +  F   L+         D  +T   G P  + +E L  + KN D  
Sbjct: 220 TSRPKTGKLQILRRFQFSSALKRSSSVASHKDKLFTAVKGAPETI-RERLAVVPKNYDEI 278

Query: 589 --TLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLA 646
             + +  G RVLA A KS      +   D L  +RD +E  LTF G +  + P + +++ 
Sbjct: 279 YKSFTRSGSRVLALASKSLPNLS-SKQLDDL--DRDEIETGLTFNGFLVFHCPLKPDAVE 335

Query: 647 AVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHN---------------LYHYPKEVV 691
            +K  +++     M+TGD P TA  +A+EV I+                  L+   +E +
Sbjct: 336 TIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLILDKSETVGDGKLLFFNVEETI 395

Query: 692 NFMVMAATD-------FDA------------LSDQ-EIDDLRVLPLVIARCAPQTKVRMI 731
                 A+D       FD             L D  ++ DL     V AR +P  K  ++
Sbjct: 396 KIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQLKDLIRHTWVYARVSPSQKEFIL 455

Query: 732 EALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASI 787
             L        M GDG ND  +LK A+VG+A+ +NG++ +  A      D+N  S+
Sbjct: 456 NNLKEMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTEESMTAMAQKRRDENMKSM 510

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 37/73 (50%)

Query: 303 GTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGA 362
           GT+  R+  ++ +  I +   ++P  L + LT+ +++    ++   V   +   +   G 
Sbjct: 75  GTKMGRIQSKLILDCILIITYVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPLAGR 134

Query: 363 VNDICSDKTGTLT 375
           ++  C DKTGTLT
Sbjct: 135 IDVCCFDKTGTLT 147

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 164/728 (22%), Positives = 278/728 (38%), Gaps = 183/728 (25%)

Query: 108 VIGAYQEYNASKTMNSLKSLST----PSA-HVIRDGNDITIQSKELVPGD-ICIIKVGD- 160
           +I A +  +  + + +LK   T    P A +V RDG  + +Q+ +L P D + I +  + 
Sbjct: 226 MIVAMEATSVFQRLTTLKEFRTMGIKPYAINVFRDGKWVEMQTDKLFPMDLVSITRTAED 285

Query: 161 -TVPADLRLLESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNL----------- 208
             +P DL L++   +  +EA+L+GES P+ K   ++     P  D+L L           
Sbjct: 286 SAIPCDLLLIDGSCI-VNEAMLSGESTPLLKESIKL----RPANDQLQLDGVDKNAVLHG 340

Query: 209 AFAASTVTK------------GRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFG 256
              A  VT             G A  +V KT   T  G + + +      +     ++  
Sbjct: 341 GTKALQVTAPENRTGVITPPDGGALAVVTKTGFETSQGSLVRVMIFSAERVDVGNKEALY 400

Query: 257 QNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIY 316
             L++ +   + S+     GT                        MG    R+  ++ + 
Sbjct: 401 FILFLLIFAIVASWYVWKEGT-----------------------RMG----RIQSKLILD 433

Query: 317 AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376
            I +  S++P  L + LT+ +++    ++   V   +   +   G ++  C DKT     
Sbjct: 434 CILIITSVVPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCFDKT----- 488

Query: 377 GKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSK 436
                        GT+T ++             L+  F      HD  +    I   KS 
Sbjct: 489 -------------GTLTAED-------------LV--FEGLAGLHDGSD----IRTLKSA 516

Query: 437 YLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLPR 496
             A +                 L+ I       +  D +  GDP E A         L  
Sbjct: 517 NDASQ---------------EVLSAIGAAHALVKLDDGEIVGDPMEKAT--------LKA 553

Query: 497 HVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFER 556
              T + KD  K A A++    +  F F SS+KR ++I   +       +    KGA E 
Sbjct: 554 SSWTVDFKDVVKRAGADN-IRILRRFQFSSSLKRSASIASQSNR-----FFAAVKGAPET 607

Query: 557 VLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDK 616
           + +  +S        PS     D + I K   + +  G RVLA A K   +   N+  D 
Sbjct: 608 IRERLNS-------VPS-----DYDDIYK---SFTRSGSRVLALAYKDLPKMS-NSQIDN 651

Query: 617 LLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEV 676
           +  +RD +E  LTF   +  + P + +++  +K  +++     M+TGD P TA  +A+EV
Sbjct: 652 I--DRDEIETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEV 709

Query: 677 GILPHNLYHYPKEV-----------VNFMVMAA--TDFDALSDQEI---DDLRV----LP 716
           GI+        + +           VN  ++     D D   ++EI    DL V    L 
Sbjct: 710 GIVDRETLILDEPIDGSSHALVMRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALK 769

Query: 717 L---------------VIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGI 761
           L               + AR +P  K  ++  L        M GDG ND  +LK A+VGI
Sbjct: 770 LLQGHKQLRDVIRHTWIYARVSPSQKEFILITLKDMGYQTLMCGDGTNDVGALKQAHVGI 829

Query: 762 AMGINGSD 769
           A+ +NG++
Sbjct: 830 AL-LNGTE 836

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 128/305 (41%), Gaps = 74/305 (24%)

Query: 511 RANSSFEH-------VAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDS 563
           R NS++         +  F F S++KR ++I  +                        D+
Sbjct: 562 RKNSNYREGTGKLDIIRRFQFSSALKRSASIASHN-----------------------DA 598

Query: 564 WYTTPDGKPSPLSKEDLETIQKNVD----TLSSEGLRVLAFAKKSFNESEFNANKDKLLK 619
            +    G P  + +E L  I KN D    + +  G RVLA A KS  +    +  D L  
Sbjct: 599 LFAAVKGAPETI-RERLSDIPKNYDEIYKSFTRSGSRVLALASKSLPKMS-QSKIDDL-- 654

Query: 620 ERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGIL 679
            RD VE +LTF G +  + P + +++  +K  +++     M+TGD P TA  +A+EVGI+
Sbjct: 655 NRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV 714

Query: 680 ---------------PHNLYHYPKEVVNFMVMAATD-FD--ALSDQ-------------- 707
                             L+   +E V+     + D FD   L D+              
Sbjct: 715 FGETLILDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIAVTGYALNALE 774

Query: 708 ---EIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMG 764
              ++ DL     V AR +P  K  ++  L        M GDG ND  +LK A+VGIA+ 
Sbjct: 775 GHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMCGDGTNDVGALKQAHVGIAL- 833

Query: 765 INGSD 769
           +NG++
Sbjct: 834 LNGTE 838

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 115/290 (39%), Gaps = 59/290 (20%)

Query: 112 YQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGD-ICIIKVGD--TVPADLRL 168
           +Q   A K   ++  +   + +V R+   + +Q+ EL+P D + I +  +   +P DL L
Sbjct: 237 FQRLTALKEFRTM-GIKPYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLIL 295

Query: 169 LESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNL-----------AFAASTVTK 217
           L+   +  +EA+L+GES P+ K   ++     P  D L L              A  VT 
Sbjct: 296 LDGSAI-VNEAMLSGESTPLLKESIKL----RPSEDNLQLDGVDKIAVLHGGTKALQVTP 350

Query: 218 ------------GRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKE 265
                       G A  IV KT   T  G + + +      +S D  ++    L++ +  
Sbjct: 351 PEHKSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFA 410

Query: 266 TIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMI 325
            I S+                                GT+  R+  ++ +  I +  S++
Sbjct: 411 VIASWY---------------------------VWVEGTKMGRIQSKLILDCILIITSVV 443

Query: 326 PSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLT 375
           P  L + LT+ +++    +A   V   +   +   G ++  C DKTGTLT
Sbjct: 444 PPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGRIDVCCFDKTGTLT 493

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 148/702 (21%), Positives = 260/702 (37%), Gaps = 184/702 (26%)

Query: 133 HVIRDGNDITIQSKELVPGDICIIKVGD---TVPADLRLLESINLETDEALLTGESLPVA 189
           +V RD     +Q+ EL+P D+  +   D    +  D+ L++   +  +EA+L+GES P+ 
Sbjct: 257 NVFRDSKWQLLQTNELLPMDLISVTRTDEDSALSCDMILVDGTCI-VNEAMLSGESTPLL 315

Query: 190 KSHSEVYEKDTPVG----DRLNLAFAASTVTK----------------GRATGIVIKTAL 229
           K   ++   +  +     D+ ++    + V +                G A  +V KT  
Sbjct: 316 KESVKLRSSEEKLQVEGLDKNSVLHGGTKVLQVTAPEKGSSSIPAPPDGGALAVVSKTGF 375

Query: 230 NTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXX 289
            T  G + + +   +  +S    ++    L++ +     S+                   
Sbjct: 376 ETSQGALVRVMIYSSERVSVGNKEALYFILFLLIFAIAASW------------------- 416

Query: 290 XXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNV 349
                        GT+  RV  ++ +  I +  S++PS L + LT+ ++    V++   V
Sbjct: 417 --------YVWVEGTRMGRVQSKLILDCILIITSVVPSELPMELTMAVNNSLAVLSKFYV 468

Query: 350 IVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIH 409
              +   +   G ++  C DKTGTLT   ++ +       G   +   N+P N      H
Sbjct: 469 YCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFE-------GLAGLAGKNQPVN------H 515

Query: 410 LIPKFSPYQYKHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDS 469
           L                      FK     G   PL+ +L            I       
Sbjct: 516 L----------------------FK-----GTEVPLDTNLV-----------IGAAHALV 537

Query: 470 ETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVA---EFPFDS 526
              D +  GDP E A               TG  K   KD+ +N     ++    F F S
Sbjct: 538 RLDDDEVVGDPMEKATL-----------AATGW-KVGVKDSLSNEKVGDISILRRFQFSS 585

Query: 527 SVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKN 586
           ++KR S I  + +   + +     KGA E +                   +E L  +  +
Sbjct: 586 ALKRSSTIAVHNKQHYSAV-----KGAPETI-------------------RERLSQVPTD 621

Query: 587 VD----TLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQ 642
            D    + +  G RVLA A K           +KL  ER+ VE  L F G +  + P + 
Sbjct: 622 YDQVYKSFTRAGSRVLALASKKLPSMSIK-QIEKL--EREAVESDLEFKGFLVFHCPLKD 678

Query: 643 ESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGIL----------------------- 679
           +++  +K  +++     M+TGD P TA  +A+EV I+                       
Sbjct: 679 DAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFRNI 738

Query: 680 ------PHN----LYHYPKEVVNF-MVMAATDFDALSDQ-EIDDLRVLPLVIARCAPQTK 727
                 P N     + + K    + + +       LS   ++++L     V AR +P  K
Sbjct: 739 EETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGHSQLNELIRHTWVYARVSPAQK 798

Query: 728 VRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSD 769
             ++ +L        M GDG ND  +LK A+VGIA+ +NG++
Sbjct: 799 EFIMNSLKDMGYQTLMCGDGTNDVGALKQAHVGIAL-LNGTE 839

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 135/581 (23%), Positives = 230/581 (39%), Gaps = 119/581 (20%)

Query: 323  SMIPSSLVVVLTITMSAGAKVMAT----------RNVIVRKLDSLEALGAVNDICSDKTG 372
            +++P SL V + +     A ++A+             +VR    +E LG +  I SDKTG
Sbjct: 500  NLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTG 559

Query: 373  TLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPD 432
            TLTQ  M  K   I   G   +Q               IP+        D   D GI   
Sbjct: 560  TLTQNVMEFKSCSIA--GRCYIQS--------------IPE------DKDAAFDEGIEVG 597

Query: 433  FKSKYLAGEL----GPLNVSLFDQWLYTATLAN-IATVFQDSETQDWKAHGDPTEIAIQV 487
            +++     EL    G  + ++ D++L   ++ + +   FQ++ +  ++A   P E A+  
Sbjct: 598  YRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQA-ASPDEGALVQ 656

Query: 488  FATRMDLPRHVLTGEDKDD---EKDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATP 544
             A   DL    +  +        +D      +E +    F+S+ KRMSAI++  ++    
Sbjct: 657  GAA--DLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSI-- 712

Query: 545  IYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKS 604
               +  KGA   +L+           + +  S   +    ++++  ++EGLR L  A ++
Sbjct: 713  --RLLCKGADTVILE-----------RLAATSNPYVAATLRHLEDYAAEGLRTLCIASRT 759

Query: 605  FNESEF--------------NANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKK 650
              ESE+              +   ++L K  + +E  L  LG   I D  +      +  
Sbjct: 760  IPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHT 819

Query: 651  CHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAAT------DFDAL 704
              QAGI V +LTGD   TA +I     +L  ++      +VN     +T         A+
Sbjct: 820  LQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLL---IVNEDTKESTRNNLIDKLRAI 876

Query: 705  SDQEI--DDLRVLPLVI-----------------------------ARCAPQTKVRMIEA 733
            +D +I   D+  L LVI                              R +P  K  +++ 
Sbjct: 877  NDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKM 936

Query: 734  LHRRSKFCAMT-GDGVNDSPSLKIANVGIAM-GINGSDVAKDASDIVLSDDNFASILNAV 791
            + RR+K   +  GDG ND   ++ A+VG+ + G+ G   A+ A D  L    +   L  V
Sbjct: 937  VKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA-DFALGQFKYLKKLLLV 995

Query: 792  EEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFS 832
              G      I + +L    +N+  ALY M    +V    FS
Sbjct: 996  -HGSWSYQRISQAILYSFYKNI--ALY-MTQFWYVLYNAFS 1032

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 122/510 (23%), Positives = 203/510 (39%), Gaps = 133/510 (26%)

Query: 350 IVRKLDSLEALGAVNDICSDKTGTLTQGKM------IAKQVWI---PQFGTITVQESNEP 400
           +VR    +E LG +  I SDKTGTLT+  M      IA   +I   P+  T TV++  E 
Sbjct: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIE- 599

Query: 401 FNPTIGEIHLIPKFSPYQYKHDD--EEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTAT 458
               +G      KF   + K +D  +ED  II DF +                     AT
Sbjct: 600 ----VG----YRKFDDLKKKLNDPSDEDSPIINDFLT-------------------LLAT 632

Query: 459 LANIATVFQDSETQDWKAHGDPTEIAI--------QVFATRMDLPRHVL---TGEDKDDE 507
              +   FQ   +  ++A   P E A+          F  R      VL   TGE+K+  
Sbjct: 633 CHTVIPEFQSDGSIKYQA-ASPDEGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKE-- 689

Query: 508 KDARANSSFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTT 567
                   ++ +    F+S+ KRMSAI++    P   I ++F KGA   +L+  D     
Sbjct: 690 --------YQLLNICEFNSTRKRMSAIFRF---PDGSI-KLFCKGADTVILERLDD---- 733

Query: 568 PDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEF--------------NAN 613
                   + + +E   ++++  +SEGLR L  A +  +E E+              +  
Sbjct: 734 -------EANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNR 786

Query: 614 KDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIA 673
            +KL +  + +E  L  +G   I D  +      +    +AGI + +LTGD   TA +I 
Sbjct: 787 AEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIG 846

Query: 674 QEVGILPHNLYHYPKEVVNFMVMAATD------FDALSDQEID--DLRVLPLVI------ 719
               +L  ++      ++N      T+       +AL++ ++   D++ L LVI      
Sbjct: 847 MSCRLLSEDMNLL---IINEETRDDTERNLLEKINALNEHQLSTHDMKSLALVIDGKSLG 903

Query: 720 -----------------------ARCAPQTKVRMIEALHRRSKFCAMT-GDGVNDSPSLK 755
                                   R +P  K  +++ + R+S    +    G ND   ++
Sbjct: 904 FALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGANDVSMIQ 963

Query: 756 IANVGIAM-GINGSDVAKDASDIVLSDDNF 784
            A+VG+ + G+ G   A+ A DI L    F
Sbjct: 964 AAHVGVGISGMEGMQAARSA-DIALGQFKF 992

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 117/489 (23%), Positives = 191/489 (39%), Gaps = 111/489 (22%)

Query: 350 IVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGE-I 408
           +VR    +E LG +  I SDKTGTLT+  M  K V I   G   ++   E    T+ + I
Sbjct: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSVSIA--GRCYIETIPEDRRATVEDGI 602

Query: 409 HL-IPKFSPYQYKHDDEED--VGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATV 465
            +    F   + K  D ED   GI+ +F +                     AT   +   
Sbjct: 603 EIGFHSFESLKDKMTDPEDDEAGIVIEFLT-------------------LLATCHTVIPE 643

Query: 466 FQDSETQDWKAHGDPTEIAIQVFAT----RMDLPRHVLTGEDKDDEKDARANSSFEHVAE 521
            Q   T  ++A   P E A+   A     R D+ R                ++ F    E
Sbjct: 644 TQSDGTIKYQA-ASPDEGALVQGAADLGFRFDIRR----------PNSVSISTPFSEQLE 692

Query: 522 F------PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPL 575
           +       F+S+ KRMSAI++    P   I ++F KGA   +L+  DS +       +P 
Sbjct: 693 YQLLNICEFNSTRKRMSAIFRM---PDGSI-KLFCKGADTVILERLDSEF-------NPY 741

Query: 576 SKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLKER 621
            +  L    ++++  ++EGLR L  A ++  E E+                  ++L +  
Sbjct: 742 VQSTL----RHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAA 797

Query: 622 DFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPH 681
           + +E  L FLG   I D  ++     +    +AG+ V +LTGD   TA +I     +L  
Sbjct: 798 ELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSE 857

Query: 682 --NLYHYPKEVV-NFMVMAATDFDALSDQEI--DDLRVLPLVI----------------- 719
             NL    +E   +      +  +A+   +I   D+  L LVI                 
Sbjct: 858 DMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQF 917

Query: 720 ------------ARCAPQTKVRMIEALHRR-SKFCAMTGDGVNDSPSLKIANVGIAM-GI 765
                        R +P  K  +++ + R+ S      GDG ND   ++ A+VG+ + G+
Sbjct: 918 LTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGM 977

Query: 766 NGSDVAKDA 774
            G   A+ A
Sbjct: 978 EGMQAARSA 986

>Kwal_26.7070
          Length = 1315

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 130/550 (23%), Positives = 217/550 (39%), Gaps = 145/550 (26%)

Query: 311 KQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMAT----------RNVIVRKLDSLEAL 360
           K +  Y I  + +++P SL V + +     A ++A+             +VR    +E L
Sbjct: 492 KDILTYWILFS-NLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEEL 550

Query: 361 GAVNDICSDKTGTLTQGKM------IAKQVWI---PQFGTITVQESNEPFNPTIGEIHLI 411
           G +  I SDKTGTLT+  M      IA + +I   P+    T ++  E     IG     
Sbjct: 551 GQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIE-----IG----F 601

Query: 412 PKFSPYQYKHDDEED--VGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDS 469
            KF   +   +D +D    II DF             ++L       AT   +   FQ+ 
Sbjct: 602 RKFDSMKETLNDTQDPDSHIINDF-------------LTLL------ATCHTVIPEFQED 642

Query: 470 ETQDWKAHGDPTEIAIQVFATRMDL------PRHV-LTGEDKDDEKDARANSSFEHVAEF 522
            +  ++A   P E A+   A  +        P  V +  ED   E++      ++ +   
Sbjct: 643 GSIKYQA-ASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQE------YQLLNIC 695

Query: 523 PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLET 582
            F+S+ KRMSAI++    P   I ++F KGA   +L+   +         +P     +E 
Sbjct: 696 EFNSTRKRMSAIFRL---PNGEI-KLFCKGADTVILERLKA-------GENPY----IEA 740

Query: 583 IQKNVDTLSSEGLRVLAFAKKSFNESEFNANKD--------------KLLKERDFVECKL 628
             ++++  ++EGLR L  A ++  ESE+   KD              KL    + +E  L
Sbjct: 741 TLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDL 800

Query: 629 TFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK 688
             LG   I D  +      +     AGI V +LTGD   TA +I     +L  ++     
Sbjct: 801 FLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDM----- 855

Query: 689 EVVNFMVMAATD-----------FDALSDQEI--DDLRVLPLVI---------------- 719
              N +++   D             A+SD +I   D+  L LVI                
Sbjct: 856 ---NLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFALEADLEDY 912

Query: 720 -------------ARCAPQTKVRMIEALHRRSKFCAMT-GDGVNDSPSLKIANVGIAM-G 764
                         R +P  K  +++ + R++    +  GDG ND   ++ A+VG+ + G
Sbjct: 913 LLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISG 972

Query: 765 INGSDVAKDA 774
           + G   A+ A
Sbjct: 973 MEGMQAARSA 982

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 81/337 (24%), Positives = 137/337 (40%), Gaps = 76/337 (22%)

Query: 472 QDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRM 531
           +D +  GDP E A     T   L   V  G+   +EK+ +       +  F F S++KR 
Sbjct: 537 EDGEIVGDPMEKA-----TLKALKWTVEKGDKVFNEKNGQVTI----LRRFQFSSALKRS 587

Query: 532 SAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVD--- 588
           S++   T D                        Y+   G P  + +E L TI  N D   
Sbjct: 588 SSV--ATHD---------------------GKLYSAVKGAPETI-RERLFTIPANYDEIY 623

Query: 589 -TLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAA 647
            + +  G RVLA A K   +   +  +D    +R+  E  L F G +  + P + +++  
Sbjct: 624 KSFTRSGSRVLALASKKLEKMSQSQIEDA---DREHFERDLEFNGFLIFHCPLKHDAIET 680

Query: 648 VKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHN---------------LYHYPKEVVN 692
           ++  +++     M+TGD P TA  +A+EVGI+                  ++   +E ++
Sbjct: 681 IQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETLS 740

Query: 693 FMVMAATD-------FDAL-------------SDQEIDDLRVLPLVIARCAPQTKVRMIE 732
           F  + + D       FD                  ++ DL     + AR +P  K  ++ 
Sbjct: 741 FEFVVSKDSFEKYGIFDKYDLAVTGHALEALKGHHQLQDLIRHAWIYARVSPAQKEFILN 800

Query: 733 ALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSD 769
            L        M GDG ND  +LK A+VG+A+ +NG++
Sbjct: 801 NLKDMGYQTLMCGDGTNDVGALKQAHVGVAL-LNGTE 836

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 120/284 (42%), Gaps = 55/284 (19%)

Query: 119 KTMNSLKSLST----PSA-HVIRDGNDITIQSKELVPGDIC-IIKVGD--TVPADLRLLE 170
           + + +LK   T    P A +V+RDG  + +Q+ EL+P D+  +++  +   +P DL L++
Sbjct: 236 QRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTAEDSALPCDLILVD 295

Query: 171 SINLETDEALLTGESLPVAKSHSEVYEKDTPVG----DRLNLAFAASTVTK--------- 217
              +  +EA+L+GES P+ K    +   +  +     D++++    + V +         
Sbjct: 296 GTCI-VNEAMLSGESTPLLKESIRLRPGNEELQIEGTDKISVLHGGTKVLQVTTPEKTGK 354

Query: 218 ------GRATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKETIGSFL 271
                 G A  IV KT   T  G + + +   +  +  D  ++    L++ +   + S+ 
Sbjct: 355 VPSPPDGGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKEALYFILFLLIFAVVASWY 414

Query: 272 GTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMIPSSLVV 331
                                          GT+  RV  ++ +  I +  S++P  L +
Sbjct: 415 ---------------------------VWVEGTKMGRVQSKLILDCILIITSVVPPELPM 447

Query: 332 VLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLT 375
            LT+ +++    ++   V   +   +   G ++  C DKTGTLT
Sbjct: 448 ELTMAVNSSLSALSKFYVYCTEPFRIPFAGRIDVCCFDKTGTLT 491

>Scas_615.9
          Length = 942

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 81/181 (44%), Gaps = 39/181 (21%)

Query: 602 KKSFNESEFNANKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVH 659
           K    +S F++N D    +  + +V    T +G   I D  +++    ++       +++
Sbjct: 664 KALMTDSMFDSNSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIY 723

Query: 660 MLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVI 719
           M+TGD  G A  +AQ+VGI  +N+Y                                   
Sbjct: 724 MVTGDSHGAAMKVAQQVGIAANNVY----------------------------------- 748

Query: 720 ARCAPQTKVRMIEALHRRS-KFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIV 778
           +   P  K  ++E+L   S    A  GDG+NDSP L  +++G+A+   G+D+A +A+DIV
Sbjct: 749 SGVTPSGKCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVALS-TGTDIAMEAADIV 807

Query: 779 L 779
           +
Sbjct: 808 V 808

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 116/275 (42%), Gaps = 32/275 (11%)

Query: 118 SKTMNSLKSLSTPSAHVIRDGNDIT-----IQSKELVPGDICIIKVGDTVPADLRLLESI 172
           S +++ L  L+     +++D N+I      I++  L   DI  IK G  +PAD  +++  
Sbjct: 344 SSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRNDIIEIKPGMKIPADGIIIQG- 402

Query: 173 NLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTE 232
             E DE+L+TGES+ V K      +K + V        A S    G      I    +T+
Sbjct: 403 ESEIDESLMTGESILVHK------QKGSQV-------IAGSLNGPGHFYFKAINIGDDTK 449

Query: 233 IGKIAKSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXX 292
           + +I +++KS         NK+  QN    L      F+ T +   +   ++        
Sbjct: 450 LAQIIQTMKS------AQLNKAPIQNNADYLASI---FVPTILCLSIITFITWITLSNLL 500

Query: 293 XXXXXXXXXMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVR 352
                        K+  + Q+AI  I VA    P +L +     +  G  + A   V+++
Sbjct: 501 TKPPVIFTNNNNGKFYTSFQIAISVIVVAC---PCALGLATPTAIMVGTGIGAQHGVLIK 557

Query: 353 KLDSLEALGAVNDICSDKTGTLTQGKMIAKQVWIP 387
             D LE    +  I  DKTGT+T G+M   Q +IP
Sbjct: 558 GGDILERFNTITKIVFDKTGTITTGQMTV-QRFIP 591

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 123/329 (37%), Gaps = 83/329 (25%)

Query: 519  VAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKE 578
            V  F F S+++RMS I K   +    ++  FTKGA E + + C         +  PL  E
Sbjct: 913  VRSFEFLSNLRRMSVIVKPFSEN---VFMSFTKGAPEVIFELCSK-------QTLPLDYE 962

Query: 579  DLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYD 638
             L      +   +  G RV+A A K      +  ++      R+ +E  L FLG I   +
Sbjct: 963  AL------LHHYTHNGYRVIACAGKKLTRQSWLYSQKV---SREEIESNLEFLGFIIFEN 1013

Query: 639  PPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAA 698
              +  +   ++  H+A I   M TGD   TA S+ +E G++         E     V   
Sbjct: 1014 KLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLV---------ESPRVFVSVI 1064

Query: 699  TDFD-------------ALSDQEIDDLRVLPL---------------------------- 717
             D D             A S   +D + + PL                            
Sbjct: 1065 NDIDTSQEGDIITWQNVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIE 1124

Query: 718  -----------VIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGIN 766
                       + AR +P  K  ++E L          GDG ND  +LK A++GI++   
Sbjct: 1125 EVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEA 1184

Query: 767  GSDVAKDASDIVLSDDNFASILNAVEEGR 795
             + VA   +  +      + +L+ ++EGR
Sbjct: 1185 EASVAAPFTSRLF---EISCVLDVMKEGR 1210

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 78/364 (21%), Positives = 142/364 (39%), Gaps = 55/364 (15%)

Query: 35  INQGLNNTQIAERLSLVGENTLGDDTKINIKGILISQICNAMIMVLIISMVITLAIKDWI 94
           +++GL N    +R+   G+N++    K   + IL  +  +   +  I S+++ +    + 
Sbjct: 446 VSRGLPNNIHEDRMIAFGKNSINLRQKTTSQ-ILFDEALHPFYIFQIFSIILWM-FDAYY 503

Query: 95  SGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDITIQSKELVPGDIC 154
                 F++ +  VI    E   S    S  S       V RDG    + S +LVPGDI 
Sbjct: 504 YYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWSQVPSSDLVPGDIY 563

Query: 155 IIK--VGDTVPADLRLLESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLN----- 207
            +       +P D  +L S +   +E++LTGES+PV+K  +        + D ++     
Sbjct: 564 ELTDPSLSLLPCD-SILISGDCLVNESMLTGESVPVSKVAATRETMLQLLDDFMDTQLSS 622

Query: 208 -----LAFAASTVTKGRAT-------GIVIKTALNTEIGKIAKSL--KSETSF-ISKDEN 252
                  F  + + + RAT       G+V +T  +T  G + +S+     T F   +D  
Sbjct: 623 FVSKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSF 682

Query: 253 KSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQ 312
           K  G    I L     SF+                              +G  K    + 
Sbjct: 683 KYIGYISIIALFGFAVSFI--------------------------QFLRLGLDK----RT 712

Query: 313 VAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTG 372
           + + A+ +   ++P +L   L+I        +  + +       +   G ++ +C DKTG
Sbjct: 713 MILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTG 772

Query: 373 TLTQ 376
           TLT+
Sbjct: 773 TLTE 776

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/301 (22%), Positives = 129/301 (42%), Gaps = 65/301 (21%)

Query: 524 FDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETI 583
           F+S+ KRMSAI++  +D      ++  KGA   +L+           + S      ++  
Sbjct: 679 FNSTRKRMSAIFRFPDDSI----KLLCKGADSVILE-----------RLSETGNFYVDAT 723

Query: 584 QKNVDTLSSEGLRVLAFAKKSFNESEFNA-NK-------------DKLLKERDFVECKLT 629
            ++++  ++EGLR L  A K   E E+NA NK             +KL    + +E  LT
Sbjct: 724 TRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLT 783

Query: 630 FLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNL-----Y 684
            +G   I D  ++     ++   +AGI + +LTGD   TA +I     +L  ++      
Sbjct: 784 LIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIIS 843

Query: 685 HYPKEVVNFMV---MAATDFDALSDQEIDDLRVL-------------------------- 715
              KE     +   +AA    +LS+ +++ L ++                          
Sbjct: 844 EETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCK 903

Query: 716 PLVIARCAPQTKVRMIEALHRRSKFCAMT-GDGVNDSPSLKIANVGIAM-GINGSDVAKD 773
            ++  R +P  K  +++ + R++    +  GDG ND   ++ A+VG+ + G+ G   A+ 
Sbjct: 904 AVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 963

Query: 774 A 774
           A
Sbjct: 964 A 964

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 123/284 (43%), Gaps = 31/284 (10%)

Query: 107 VVIGAYQEYNA-SKTMNSLKSL--STPSAHVIRDGNDITIQSK---ELVP-GDICIIKVG 159
           + IG Y E  A SKT  +L  L   TPS+ +I D +D +I  +   EL+  GDI ++K G
Sbjct: 384 ISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPG 443

Query: 160 DTVPADLRLLESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGR 219
             +P+D  + + I+ E DE+L+TGE+  V K    V    T  G  L + F  ++V    
Sbjct: 444 AKIPSDGIVTKGIS-EVDESLMTGETNLVVKEIGSVVTGGTINGSGL-IYFEVTSVGDDT 501

Query: 220 ATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPL 279
               +IK   N ++ K   S++  T +++      F   + I       S L   V T L
Sbjct: 502 KLANIIKVMKNAQLKK--ASIQRYTDYVA----SIFVPTVLIL------SLLTFIVWTSL 549

Query: 280 HRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSA 339
            R                        ++ +  Q+A   + VA    P +L +     +  
Sbjct: 550 TRS-------EKIISKLSIFGETSESRFYMCLQIATSVVIVA---CPCALGLATPTAIMV 599

Query: 340 GAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQ 383
           G  V +   V+++  D LE    VN    DKTGTLT G M  +Q
Sbjct: 600 GTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 83/201 (41%), Gaps = 49/201 (24%)

Query: 626 CKLTFL-------GLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGI 678
           C +T+L       G   + D  + ++   ++        V M+TGD   +A  +A+ V I
Sbjct: 744 CTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDI 803

Query: 679 LPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRS 738
            P+N+Y                                   +   P  K + +E L    
Sbjct: 804 PPNNVY-----------------------------------SEVTPDGKSQTVEYLREEG 828

Query: 739 KFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDD------NFASILNAVE 792
           +  A  GDG+NDS +L  +++GIA+  +G++VA +A+ IV+ +D          ++NA++
Sbjct: 829 RVIAFIGDGINDSLALVTSDLGIAIS-SGTEVAIEAAGIVILNDPDTDEPTLKGVVNALD 887

Query: 793 EGRRMSDNIQKFVLQLLAENV 813
              R    ++  +   L  NV
Sbjct: 888 LSIRTFRRVKLNLFWALCYNV 908

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 87/191 (45%), Gaps = 44/191 (23%)

Query: 631 LGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEV 690
            GL  I D  + +S A V+   + G   +M+TGD    AK +A+EVGI   N+Y      
Sbjct: 756 FGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVAREVGISFENVY------ 809

Query: 691 VNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRR--SKFCAMTGDGV 748
                                        +  +P  K  +++ +  +  +   A+ GDG+
Sbjct: 810 -----------------------------SDVSPTGKCDLVKKIQDKEGNNKVAVVGDGI 840

Query: 749 NDSPSLKIANVGIAMGINGSDVAKDASDIV------LSDDNFASILNAVEEGRRMSDNIQ 802
           ND+P+L ++++GIA+   G+++A +A+DIV      L+ ++   + NA++   +    I+
Sbjct: 841 NDAPALALSDLGIAIS-TGTEIAIEAADIVILCGNDLNTNSLRGLANAIDISLKTFKRIK 899

Query: 803 KFVLQLLAENV 813
             +   L  N+
Sbjct: 900 LNLFWALCYNI 910

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%)

Query: 317 AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376
           A  V I   P +L +     +  G  V A   V+++  + LE   ++     DKTGTLT 
Sbjct: 575 ATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGGEVLEKFNSITTFVFDKTGTLTT 634

Query: 377 GKMIAKQ 383
           G M+ K+
Sbjct: 635 GFMVVKK 641

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 50/119 (42%), Gaps = 20/119 (16%)

Query: 110 GAYQEYNA-SKTMNSLKSLSTPSAHVIRDGNDITIQSKELVP------GDICIIKVGDTV 162
           G Y E  A S+T  +L  L   +  V    +D+     + +P       DI  IK G  +
Sbjct: 386 GKYLETLAKSQTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKI 445

Query: 163 PADLRLLESINLETDEALLTGESLPVAKSH------------SEVYEKDTPVGDRLNLA 209
           PAD  ++     E DE+L+TGES+ V K                 Y + T VG+   LA
Sbjct: 446 PAD-GIITRGESEIDESLMTGESILVPKKTGFPVIAGSVNGPGHFYFRTTTVGEETKLA 503

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 117/292 (40%), Gaps = 64/292 (21%)

Query: 570  GKPSPLSKED--LETIQKNVDTLSSEGLRVLAFAKKSFNESEF-------NANKDKLLKE 620
            G P  ++ E+  +E   +++D  ++EGLR L ++ K     E+       +A K  L+  
Sbjct: 926  GSPDLITNEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNR 985

Query: 621  RD-------FVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIA 673
            R+        +E  LT LG IGI D  ++    A+ K  +AGI + MLTGD   TA +I 
Sbjct: 986  REQMDTVGEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIG 1045

Query: 674  QEVGILPHNLYHYPKEVVNFMVMAATDFDALSD-----QEID------------------ 710
                     L H    V+   ++A  D +  S      QEI+                  
Sbjct: 1046 YSC-----RLIHDYSTVI---ILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTI 1097

Query: 711  ---DLRVLPLVIARC-----------APQTKVRMIEALHRRSK--FCAMTGDGVNDSPSL 754
               +L ++ L I  C           +P  K  M+  + +  K       GDG ND   +
Sbjct: 1098 FEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMI 1157

Query: 755  KIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVL 806
            + A++G+ +       A  +SD  ++   +   L  V  GR       KFVL
Sbjct: 1158 QSADIGVDITGKEGLQASRSSDYSIAQFRYLLKLLLV-HGRYNYIRTSKFVL 1208

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 10/71 (14%)

Query: 323 SMIPSSLVVVLTITMSAGAKVM----------ATRNVIVRKLDSLEALGAVNDICSDKTG 372
           ++IP SL V + I     +++M                 R    LE LG V+ I SDKTG
Sbjct: 451 TLIPLSLYVTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTG 510

Query: 373 TLTQGKMIAKQ 383
           TLT  +MI ++
Sbjct: 511 TLTDNRMIFRK 521

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 69/149 (46%), Gaps = 45/149 (30%)

Query: 638  DPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMA 697
            D  R E+   +K+  ++GI   M++GD   TA+++AQE+                     
Sbjct: 929  DEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQEL--------------------- 967

Query: 698  ATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRS-------KFCAMTGDGVND 750
                      +ID+      VIA   P+ K   ++ +   +       K  AM GDG+ND
Sbjct: 968  ----------DIDN------VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGIND 1011

Query: 751  SPSLKIANVGIAMGINGSDVAKDASDIVL 779
            +P+L  A+VGIA+  +GS++A  + D VL
Sbjct: 1012 APALAAADVGIALA-SGSELAMTSCDFVL 1039

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 48/97 (49%), Gaps = 6/97 (6%)

Query: 99  LAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVIRDGNDI-----TIQSKELVPGDI 153
           L F + I  ++ +  +   +  +++L S    +A +++   D      T+Q + L  GD 
Sbjct: 518 LTFFLLIGRLLESLAKTKTASAISNLSSFKQETATLMQKVGDQYQEVETVQIQYLELGDY 577

Query: 154 CIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190
             I  G + P D  +LE    E DE+ LTGES+P+ +
Sbjct: 578 IKISPGQSPPLDSIILEG-ETEFDESALTGESIPMVR 613

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 83/182 (45%), Gaps = 36/182 (19%)

Query: 602 KKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHML 661
           KK F +   +      L E  +V    + +G   I D  ++++   V+     GI   M+
Sbjct: 714 KKLFPDESLSDIASSTLTES-YVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772

Query: 662 TGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIAR 721
           TGD   +A  +AQ++GI  ++++                             V P     
Sbjct: 773 TGDAHQSALKVAQQLGISANDVFS---------------------------EVTP----- 800

Query: 722 CAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSD 781
              Q +  +I+  +  ++  A  GDG+NDSP+L  A++GI++  +G+D+A +A+DIV+ D
Sbjct: 801 --EQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISIS-SGTDIAIEAADIVILD 857

Query: 782 DN 783
            +
Sbjct: 858 SD 859

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 108/270 (40%), Gaps = 42/270 (15%)

Query: 118 SKTMNSLKSLSTPSAH--VIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLE 175
           S  M+ L SL TPS+   V+ DG+   I  + L P DI  +  G  +PAD  ++ +   E
Sbjct: 395 STAMSKLISL-TPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIRN-ETE 452

Query: 176 TDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGK 235
            DE+L+TGES+ V K           VG ++      S    G      I+   +T++  
Sbjct: 453 VDESLITGESMLVEK----------IVGSQV---IGGSVNGPGHFYFRAIRVGEDTKLAN 499

Query: 236 IAKSLKSETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXX 295
           I  ++K     +SK   + +   +               +  P    LS           
Sbjct: 500 IIATMKKAQ--LSKAPIQKYADKM-------------AGIFVPFVISLS----AITFITW 540

Query: 296 XXXXXXMGTQKYRVNKQVAIYAICVAISM------IPSSLVVVLTITMSAGAKVMATRNV 349
                 M T     N +   + +C+ +S+       P +L +     +  G  V A+  V
Sbjct: 541 MLVSYTMKTPPLIFNSENGKFFMCMQMSISVIIVACPCALGLAAPTAIMVGTGVGASHGV 600

Query: 350 IVRKLDSLEALGAVNDICSDKTGTLTQGKM 379
           +++  D LE   A+     DKTGTLT G+M
Sbjct: 601 LIKGGDVLEKCSALQTFLFDKTGTLTTGRM 630

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 65/150 (43%), Gaps = 41/150 (27%)

Query: 633  LIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVN 692
             + + D  R E+   V+  H+ GI   M++GD    A ++A EVGI  H           
Sbjct: 1013 FLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI-KH----------- 1060

Query: 693  FMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSK---FCAMTGDGVN 749
                                     VIA   P+ K   I+ +   S      AM GDG+N
Sbjct: 1061 -------------------------VIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMN 1095

Query: 750  DSPSLKIANVGIAMGINGSDVAKDASDIVL 779
            D+P++  A+VGI++  +GSD+A  + D VL
Sbjct: 1096 DAPAIAAADVGISLA-SGSDLAMISCDFVL 1124

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 316 YAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGA-VNDICSDKTGTL 374
           +AI V +   P  + +     +  GA + A   ++ R   +   +G+ V  +C DKTGTL
Sbjct: 807 FAIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTGTL 866

Query: 375 TQG 377
           T+G
Sbjct: 867 TKG 869

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 7/76 (9%)

Query: 119 KTMNSLKSLSTPSAHVIR-DG-----NDITIQSKELVPGDICIIKVGDTVPADLRLLESI 172
           KT+ SL SL   +  +++ DG      + ++ ++ L  GD  +IK G +   D  +++  
Sbjct: 629 KTLESLTSLKQRTGILMQADGARDFKKETSVSAEMLELGDHILIKPGASPAVDALIVQG- 687

Query: 173 NLETDEALLTGESLPV 188
             E DE+ LTGES P+
Sbjct: 688 ETEFDESSLTGESRPI 703

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 74/158 (46%), Gaps = 34/158 (21%)

Query: 638  DPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHY--PKEVVNFM- 694
            D  R ++++ +    Q GI++H+L+GD  G  +S+A  +GI   N+  +  P E   ++ 
Sbjct: 1024 DSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSEYIK 1083

Query: 695  -VMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPS 753
             ++   + D+ S  +       P+V+                    FC   GDG ND+  
Sbjct: 1084 DIVEGRNCDSSSQSK------RPVVV--------------------FC---GDGTNDAIG 1114

Query: 754  LKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAV 791
            L  A +G+ +   GS+VAK A+D+V+      +IL  +
Sbjct: 1115 LTQATIGVHIN-EGSEVAKLAADVVMLKPKLNNILTMI 1151

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%)

Query: 312 QVAIYAICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEALGAVNDICSDKT 371
           Q  IYAI V I   P  + + + I     + V A R VI +  +S+E     + +  DKT
Sbjct: 846 QAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHVVFDKT 905

Query: 372 GTLTQGKM 379
           GTLT+GK+
Sbjct: 906 GTLTEGKL 913

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 95  SGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTPSAHVI-RDGNDITIQSKELVPGDI 153
           +  +L  ++ +   +     + A K++ S++SL   SA ++ + G +  I  + L  GDI
Sbjct: 661 TSSLLVTLIMVGRFVSELARHRAVKSI-SVRSLQASSAILVDKTGKETEINIRLLQYGDI 719

Query: 154 CIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190
             +     +P D  ++ S + E DEAL+TGES+PV K
Sbjct: 720 FKVLPDSRIPTDGTVI-SGSSEVDEALITGESMPVPK 755

>Scas_89.1
          Length = 271

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 108/252 (42%), Gaps = 37/252 (14%)

Query: 600 FAKKSFNESEFNANKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGIN 657
           F K+  + S    N D+ +    +  +E  L  LGL G+ D  + +  ++++    AG+ 
Sbjct: 5   FEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVK 64

Query: 658 VHMLTGDFPGTAKSIAQEVGILPHNLYHY-------PKEVVNFMVMAATD---------- 700
           + MLTGD   TA+ ++    ++    Y +       P+  +N +     +          
Sbjct: 65  IWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGE 124

Query: 701 ----FDALSDQEIDDLRV-LPLVIA-RCAPQTKVR---MIEALHRRSKFCAMTGDGVNDS 751
               F     QE  D+ V LP VIA RC PQ K     +I  +  +   C   GDG ND 
Sbjct: 125 SLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCC--IGDGGNDV 182

Query: 752 PSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVE-EGR---RMSDNIQKFVLQ 807
             ++ A+VG+  GI G +  + +     S   F  +   +   GR   + S  + +FV+ 
Sbjct: 183 SMIQCADVGV--GIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIH 240

Query: 808 L-LAENVAQALY 818
             L  +V QA+Y
Sbjct: 241 RGLIISVCQAVY 252

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 116/293 (39%), Gaps = 66/293 (22%)

Query: 570  GKPSPLSKED--LETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKL------LKER 621
            G  + +S E+  LE   +++++ S+EGLR L FA K  +  +F   + +       L ER
Sbjct: 946  GSDALISNEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSER 1005

Query: 622  DF--------VECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIA 673
                      +E +L  LG   I D  ++    A++K  +AGI + MLTGD   TA +I 
Sbjct: 1006 KQKIDEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIG 1065

Query: 674  QEVGILPHNLYHYPKEVVNFMVMAATDFDALS-----DQEIDDLRVLPLVI--------- 719
                ++     H    VV   ++  +D + +S      QE+D   V   VI         
Sbjct: 1066 YSCKLI-----HDYSTVV---ILTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAM 1117

Query: 720  -----------------------ARCAPQTKVRMIEALHR--RSKFCAMTGDGVNDSPSL 754
                                    R +P  K  M+  +    +S      GDG ND   +
Sbjct: 1118 FEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMI 1177

Query: 755  KIANVGIAMGINGSDVAKDASDIVLSDDNFASILN-AVEEGRRMSDNIQKFVL 806
            + A++G+  GI G +  + +     S   F  IL   +  GR       KF+L
Sbjct: 1178 QSADIGV--GIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAKFIL 1228

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (45%), Gaps = 22/120 (18%)

Query: 323 SMIPSSLVVVLTITMSAGAKVM----------ATRNVIVRKLDSLEALGAVNDICSDKTG 372
           ++IP SL V + +   A +++M          +     VR    LE LG V+ I SDKTG
Sbjct: 473 TIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTG 532

Query: 373 TLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPD 432
           TLT  KM+ +++     GT  V  + +           I +F P Q  + ++ DV  I D
Sbjct: 533 TLTDNKMLFRKLSF--CGTSWVHNATQD----------ISEFKPAQLSNKNDIDVISIDD 580

>Kwal_55.21575
          Length = 989

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 78/169 (46%), Gaps = 40/169 (23%)

Query: 623 FVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHN 682
           +V+     +G   I D  ++++   V+   + G  V M+TGD   +A  +A E+GI  +N
Sbjct: 732 YVKINGELVGRFEISDFIKKDAAEVVQYLTEKGHRVCMVTGDNHKSAMKVALELGIEANN 791

Query: 683 LYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRS-KFC 741
           +Y                                   +   P  K ++++ L     K  
Sbjct: 792 VY-----------------------------------SELTPADKNQLVQDLQDGGRKNV 816

Query: 742 AMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVL---SDDNFASI 787
           A  GDG+NDSP+L  +++G+++   G+D+A +A+D+++   S++N  S+
Sbjct: 817 AFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVIILNRSENNHVSL 864

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 114/283 (40%), Gaps = 35/283 (12%)

Query: 107 VVIGAYQEYNA-SKTMNSLK---SLSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTV 162
           + +G   E  A SKT NSL    SL+  +  +I +G    I  + L  GD   IK G  +
Sbjct: 382 ISVGKLLENKAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKI 441

Query: 163 PADLRLLESINLETDEALLTGESLPVAKSHSEVYEKDTPVGDRLNLAFAASTVTKGRATG 222
           P D  ++E    E DE+L+TGESL V +       K  PV        A S     R   
Sbjct: 442 PTDGVIIEG-ESEVDESLITGESLMVPRY------KGFPV-------IAGSINGPNRFLL 487

Query: 223 IVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLWITLKET--IGSFLGTNVGTPLH 280
                  +T++ +I +++K     +SK   + +   L      +  + + +     T L 
Sbjct: 488 TATSVGDDTKLAQIIQTMKQAQ--LSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILS 545

Query: 281 RKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICVAISMIPSSLVVVLTITMSAG 340
           R LS                     K+ +  ++ I  I VA    P +L +     +  G
Sbjct: 546 RVLSNPPSIFDSP----------NGKFFICLEMTISVIVVA---CPCALGLAAPTAIMVG 592

Query: 341 AKVMATRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQ 383
             + A   V+++  D LE   ++     DKTGTLT G M  +Q
Sbjct: 593 TGLGAKHGVLIKGGDILEKCSSLETFLFDKTGTLTTGHMTVEQ 635

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 90/222 (40%), Gaps = 49/222 (22%)

Query: 594 GLRVLAFAKKSFNESEFNANKDKLLKER---------DFVECKLTFLGLIGIYDPPRQES 644
           GL V    +    E        +LL ER          FV      LG   + D  R+++
Sbjct: 534 GLGVRCVLQLDGVEHRITIGSARLLPERPSKFSGSTASFVAVNDVLLGRFDLSDSLREDA 593

Query: 645 LAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDAL 704
              V+     G  V M+TGD    A  ++  +GI  +N++                    
Sbjct: 594 YEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIPLNNVF-------------------- 633

Query: 705 SDQEIDDLRVLPLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMG 764
           S++                P+ K  ++  L ++  + A  GDG+NDS +L  +++GI++ 
Sbjct: 634 SER---------------LPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAESDLGISLS 678

Query: 765 INGSDVAKDASDIVLSDDNFA----SILNAVEEGRRMSDNIQ 802
            N SD+  DA+ IV+ D + A     IL A++  R   + ++
Sbjct: 679 GN-SDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 50/88 (56%), Gaps = 5/88 (5%)

Query: 107 VVIGAYQEYNA-SKTMNSLKSL--STPSAHVIRD-GNDITIQSKELVPGDICIIKVGDTV 162
           + +G   E  A ++  +SL  +  S PS   IR+ G+D  ++ + L  GD+ +++ G  +
Sbjct: 225 ICVGKLLESRARARAADSLARMVSSAPSMCTIRESGSDREVEVELLQAGDVVVMRPGTKL 284

Query: 163 PADLRLLESINLETDEALLTGESLPVAK 190
           PAD  +LE    E DE+L+TGES  V K
Sbjct: 285 PADGTVLEG-EAEVDESLMTGESTLVPK 311

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 153/659 (23%), Positives = 240/659 (36%), Gaps = 133/659 (20%)

Query: 127  LSTPSAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLL-----------ESINLE 175
            L  PS  V+ D        K +  GDI  +   D +PAD+ LL           E+ NL+
Sbjct: 425  LLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLD 484

Query: 176  TDEALLTGESLPVAK-------------------SHSEVY---------------EKDTP 201
             +  L   +SL  +                     HS +Y               EK+ P
Sbjct: 485  GETNLKVRQSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEP 544

Query: 202  VGDRLNLAFAASTVTKGR-ATGIVIKTALNTEIGKIAKSLKSETSFISKDENKSFGQNLW 260
            V    NL     T+   + A GIV+ T  +T+I   A    ++ S IS++ N S   N  
Sbjct: 545  VNIN-NLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFA 603

Query: 261  ITLKETIGSFLGTNVGTPLHRKLSQXXXXXXXXXXXXXXXXMGTQKYRVNKQVAIYAICV 320
            +     +  F    V    +R  +                  G   + V       A+ +
Sbjct: 604  LLF---VLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWV-------ALIL 653

Query: 321  AISMIPSSLVVVLTITMSAGAK-VMATRNVIVRKLDS---------LEALGAVNDICSDK 370
              S++P SL + + I  +A A  +     +   +LD           + LG +  I SDK
Sbjct: 654  YQSVVPISLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDK 713

Query: 371  TGTLTQGKMIAKQVWIP--QFGT--------------ITVQESNEPFNPTIG---EIHLI 411
            TGTLTQ  M  K+  I    +G               I V+E        I    EI L 
Sbjct: 714  TGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLA 773

Query: 412  PKFSPYQYKHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQ---D 468
                  +      E+V  +     +  AG  G       + ++    L +   V +   D
Sbjct: 774  NLKILGENSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDD 833

Query: 469  SETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKD----DEKDARANSSFEHVAEFPF 524
             E  D+KA   P E A+   A  M        G  K+    D +  +      +V EF  
Sbjct: 834  PEIMDFKAQS-PDEAALVGTARDMGFS---FVGRTKNGVIVDIQGVQKEYRLLNVLEF-- 887

Query: 525  DSSVKRMSAIYK-NTEDP-ATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKED--- 579
            +S+ KRMS I K  +E+P   P   +  KGA   +               S LSK +   
Sbjct: 888  NSTRKRMSCILKIPSENPNEEPRALLICKGADSIIY--------------SRLSKNNDEK 933

Query: 580  -LETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLKERDFV 624
             LE    +++  ++EGLR L  A++  +  E+                 +D++ K  D +
Sbjct: 934  LLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVI 993

Query: 625  ECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNL 683
            E +LT LG   I D  +     ++    +AGI + +LTGD   TA +I     +L + +
Sbjct: 994  ERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEM 1052

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 98/426 (23%), Positives = 162/426 (38%), Gaps = 91/426 (21%)

Query: 516  FEHVAEFPFDSSVKRMSAIYK----NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGK 571
            FE +    F+SS KRMS I K    N  D   P   +  KGA   +       Y+    +
Sbjct: 834  FEILNILEFNSSRKRMSCIVKIPGLNPGD--EPRALLICKGADSII-------YSRLSRQ 884

Query: 572  PSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFN-------------ANK-DKL 617
                S+  LE    +++  ++EGLR L  A++  + SE+              AN+ D+L
Sbjct: 885  SGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDEL 944

Query: 618  LKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIA---- 673
                D +E +L  LG   I D  +      ++   +AGI + +LTGD   TA +I     
Sbjct: 945  EVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCN 1004

Query: 674  ------------------QEVGILPHN-----LYHYPKEVVNFMVMAATDFDALSDQEI- 709
                              +E G  P       L  Y KE  N        F+A  D E  
Sbjct: 1005 LLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFP 1064

Query: 710  -------------------DDLRVLPLVI---------ARCAPQTKVRMIEALHRRSKFC 741
                               +D+R   L++          R +P  K  +++ +  +    
Sbjct: 1065 KGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLV--KDSLD 1122

Query: 742  AMT---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMS 798
             MT   GDG ND   ++ A+VGI +       A   SD  +    + + L  V  GR   
Sbjct: 1123 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLV-HGRWSY 1181

Query: 799  DNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGL 858
              + + + +   +N+  AL L     + D +G  ++  + + + + +  TS  P + LG+
Sbjct: 1182 KRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYM-MFYNLAFTS-LPVIFLGI 1239

Query: 859  EKASVD 864
                V+
Sbjct: 1240 LDQDVN 1245

>Kwal_23.3556
          Length = 1597

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 102/280 (36%), Gaps = 62/280 (22%)

Query: 580  LETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLKERDFVE 625
            LE   + ++  S+ GLR L ++ K     ++                 K+K+    + VE
Sbjct: 957  LERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSVGELVE 1016

Query: 626  CKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYH 685
              L  LG   I D  ++    A+ K  +AGI + MLTGD   TA +I         NL H
Sbjct: 1017 TSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSC-----NLIH 1071

Query: 686  YPKEVVNFMVMAATDFDALS-----DQEIDDLRVLPLVI--------------------- 719
                VV   +++A D +  S      QEI+   +   V+                     
Sbjct: 1072 DYSTVV---ILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMSVFV 1128

Query: 720  -----------ARCAPQTKVRMIEALHRRSK--FCAMTGDGVNDSPSLKIANVGIAMGIN 766
                        R +P  K  M+  +    K       GDG ND   ++ A++G+ +   
Sbjct: 1129 ELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGIAGK 1188

Query: 767  GSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVL 806
                A  +SD  ++   F   L  V  GR       KFVL
Sbjct: 1189 EGLQASRSSDYSIAQFRFLLKLLLV-HGRYNYVRTTKFVL 1227

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 40/83 (48%), Gaps = 16/83 (19%)

Query: 323 SMIPSSLVVVLTITMSAGAKVM--------ATRNVIV--RKLDSLEALGAVNDICSDKTG 372
           ++IP SL V + I  +  +K+M        A  N     R    LE LG V+ I SDKTG
Sbjct: 474 TLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTG 533

Query: 373 TLTQGKMIAKQV------WIPQF 389
           TLT  KM+ + +      WI  F
Sbjct: 534 TLTDNKMVFRALSVCGSSWIHDF 556

>Scas_669.3
          Length = 1638

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 70/158 (44%), Gaps = 28/158 (17%)

Query: 581  ETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLKERDFVEC 626
            +TIQ  +D  S+EGLR L ++ K  +  E+                 K K+ +  + +E 
Sbjct: 994  KTIQA-IDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIEQ 1052

Query: 627  KLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHY 686
             L  LG   I D  ++    A++K  +AGI + MLTGD   TA +I     +    +Y Y
Sbjct: 1053 DLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKL----IYDY 1108

Query: 687  PKEVVNFMVMAATDFDALS-----DQEIDDLRVLPLVI 719
               V    ++A  D + +S      QE+D   V   VI
Sbjct: 1109 STVV----ILAKGDENIISKMNAISQEVDSGNVAHCVI 1142

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 36/74 (48%), Gaps = 10/74 (13%)

Query: 323 SMIPSSLVVVLTITMSAGAKVM----------ATRNVIVRKLDSLEALGAVNDICSDKTG 372
           ++IP SL V + I  +  +K+M                 R    LE LG V+ + SDKTG
Sbjct: 496 TIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTG 555

Query: 373 TLTQGKMIAKQVWI 386
           TLT  KMI ++  I
Sbjct: 556 TLTDNKMIFRKFSI 569

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 75/335 (22%), Positives = 128/335 (38%), Gaps = 70/335 (20%)

Query: 580  LETIQKNVDTLSSEGLRVLAFAKKSFNESEFNANKDKL------LKERD--------FVE 625
            LE     +D  S+EGLR L ++ K     E+ A + K       L  R          +E
Sbjct: 937  LEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEVGGHIE 996

Query: 626  CKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYH 685
              L  LG   I D  ++    A++K  +AGI + MLTGD   TA +I     +    +Y 
Sbjct: 997  TDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKL----IYD 1052

Query: 686  YPKEVVNFMVMAATDFDALSD-----QEIDDLRVLPLVI--------------------- 719
            Y   V    ++   D + +S      +E+D  ++   V+                     
Sbjct: 1053 YSTVV----ILKKNDDNLISKMTALGEELDTGKIAHCVLVIDGASLAVFENNPTMMSVFI 1108

Query: 720  -----------ARCAPQTKVRMIEALHRRSK--FCAMTGDGVNDSPSLKIANVGIAMGIN 766
                        R +P  K  ++  +  ++K       GDG ND   ++ A++G+  GI 
Sbjct: 1109 ELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGV--GIT 1166

Query: 767  GSD--VAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLC 824
            G +   A  +SD  ++   +   L  V  GR       KFVL    + V   L+ +  + 
Sbjct: 1167 GKEGLQASRSSDYSIAQFRYLLKLLFV-HGRYNYVRTSKFVLCTFYKEV---LFYLTQMI 1222

Query: 825  FVDKEGFSVFPL-SPVEVLWIIVVTSCFPAMGLGL 858
            +  +  FS   L  P  +     + +  P + +G+
Sbjct: 1223 YQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGM 1257

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 12/75 (16%)

Query: 323 SMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDS-----------LEALGAVNDICSDKT 371
           ++IP SL V   I  +  +K+M   ++ +  ++S           LE LG V+ I SDKT
Sbjct: 479 TLIPLSLYVTTEIIKAMQSKLMEW-DIDMYHIESDTPCESRTATILEELGQVSYIFSDKT 537

Query: 372 GTLTQGKMIAKQVWI 386
           GTLT  KMI ++  I
Sbjct: 538 GTLTDNKMIFRKFSI 552

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/243 (23%), Positives = 95/243 (39%), Gaps = 63/243 (25%)

Query: 580  LETIQKNVDTLSSEGLRVLAFAKKSFNESEF-NANK----------DKLLKERDF---VE 625
            +E   + +D  S+EGLR L +A K  +  ++ N NK          D+ +K  +    +E
Sbjct: 1018 IERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIE 1077

Query: 626  CKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYH 685
              L  LG+  I D  +     A++K  +AGI + MLTGD   TA +I     ++      
Sbjct: 1078 DGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLI------ 1131

Query: 686  YPKEVVNFMVMAATDFDALS-----DQEIDDLRVLPLVI--------------------- 719
              K+    +++  TD + +S      QE+D   +   V+                     
Sbjct: 1132 --KDYSTVVILTTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFV 1189

Query: 720  -----------ARCAPQTKVRMIEALHRRSK--FCAMTGDGVNDSPSLKIANVGIAMGIN 766
                        R +P  K  M+  +            GDG ND   ++ A++G+  GI 
Sbjct: 1190 ELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGV--GIA 1247

Query: 767  GSD 769
            G +
Sbjct: 1248 GKE 1250

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 10/71 (14%)

Query: 323 SMIPSSLVVVLTITMSAGAKVM--------ATRNVIV--RKLDSLEALGAVNDICSDKTG 372
           ++IP SL V + I     +K+M        A  N     R    LE LG V+ I SDKTG
Sbjct: 510 TVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTG 569

Query: 373 TLTQGKMIAKQ 383
           TLT  KMI ++
Sbjct: 570 TLTDNKMIFRK 580

>Scas_576.8
          Length = 1591

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 81/186 (43%), Gaps = 27/186 (14%)

Query: 516  FEHVAEFPFDSSVKRMSAIYK----NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGK 571
            F+ +    F+S+ KRMS I K    N +D   P   +  KGA   +       Y+    K
Sbjct: 850  FQILNTLEFNSTRKRMSCIVKIPGANPDDE--PRALLICKGADSII-------YSRLGTK 900

Query: 572  PSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEF--------------NANKDKL 617
                S+  LE    +++  ++EGLR L  A++  +  E+                 +++L
Sbjct: 901  NGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAASVTNREEQL 960

Query: 618  LKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVG 677
                D +E +LT LG   I D  +     ++    QAGI + +LTGD   TA +I     
Sbjct: 961  EAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVETAINIGFSCN 1020

Query: 678  ILPHNL 683
            +L +++
Sbjct: 1021 LLNNDM 1026

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 89/419 (21%), Positives = 165/419 (39%), Gaps = 90/419 (21%)

Query: 516  FEHVAEFPFDSSVKRMSAIYKNTEDPAT--PIYEVFTKGAFERVLQCCDSWYTTPDGKPS 573
            F+ +    F+SS KRMS I K   D A   P   +  KGA   +    D          +
Sbjct: 841  FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDK---------T 891

Query: 574  PLSKEDL-ETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLL 618
             L++E L E    +++  ++EGLR L  A++  +  E+                 +++L 
Sbjct: 892  GLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELE 951

Query: 619  KERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGI 678
            K  D +E  L  LG   I D  +     ++    +AGI + +LTGD   TA +I     +
Sbjct: 952  KVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNL 1011

Query: 679  LPH---------------NLYHYPKEVVNFMV---------MAATDFD------------ 702
            L +               +L   PK++V+ ++         MA ++ +            
Sbjct: 1012 LNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPR 1071

Query: 703  --------------ALSDQEIDDLRVL------PLVIARCAPQTKVRMIEALHRRSKFCA 742
                          ALS +++    +L       ++  R +P  K  +++ +  ++    
Sbjct: 1072 GEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLV--KNTLDV 1129

Query: 743  MT---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSD 799
            MT   GDG ND   ++ AN+G+ +       A  +SD  +    + + L  V  G+    
Sbjct: 1130 MTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLV-HGKWCYK 1188

Query: 800  NIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGL 858
             + + + Q   +N+   L L     + D +G  +F  + +   + +  TS  P + LG+
Sbjct: 1189 RLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYL-TFYNLAFTS-IPVILLGI 1245

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 96/426 (22%), Positives = 165/426 (38%), Gaps = 91/426 (21%)

Query: 516  FEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPL 575
            FE +    F+S+ KRMS I K     ATP  E        R L  C    +    + S  
Sbjct: 830  FEILNILEFNSARKRMSCIIKIP--GATPNDE-------PRALLICKGADSVIYSRLSTK 880

Query: 576  SKEDLETIQK----NVDTLSSEGLRVLAFAKKSFNESEF---NANKD-----------KL 617
            + E+ ET+ +    +++  ++EGLR L  A++    SE+   NA  D           +L
Sbjct: 881  AGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQL 940

Query: 618  LKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVG 677
                D +E  L  LG   I D  +     ++    +AGI + +LTGD   TA +I     
Sbjct: 941  EIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCN 1000

Query: 678  ILPHNL------------YHY---PKEVVNFMV-------------------------MA 697
            +L +++              Y   P EVVN ++                           
Sbjct: 1001 LLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFP 1060

Query: 698  ATDFDALSDQEI-------DDLRVLPLVI---------ARCAPQTKVRMIEALHRRSKFC 741
              DF  + D +        DD++   L++          R +P  K  +++ +  ++   
Sbjct: 1061 KGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV--KNTLD 1118

Query: 742  AMT---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMS 798
             MT   GDG ND   ++ A+VGI +       A   SD  +    + + L  V  GR   
Sbjct: 1119 VMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLV-HGRWSY 1177

Query: 799  DNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGL 858
              + + + +   +NV   L L     + + +G  +F  + + + + +  TS  P + LG+
Sbjct: 1178 KRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYL-MFYNLAFTS-IPVILLGI 1235

Query: 859  EKASVD 864
                V+
Sbjct: 1236 LDQDVN 1241

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 95/417 (22%), Positives = 160/417 (38%), Gaps = 63/417 (15%)

Query: 317  AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIV----------RKLDSLEALGAVNDI 366
            A+ +  S++P SL + + I  +A A  +    ++           R  +  + LG +  I
Sbjct: 612  ALILYQSLVPISLYISIEIIKTAQAAFIYGDVLLYNPKLDYPCTPRTWNISDDLGQIEYI 671

Query: 367  CSDKTGTLTQGKMIAKQVWIP--QFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDE 424
             SDKTGTLTQ  M  K+  I    +G    +           +I         + + D +
Sbjct: 672  FSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDIEEEGARERAEIEEDKK 731

Query: 425  EDVGIIPD-------------FKSKYLAGELGPLNVS----LFDQWLYTATLANIATVFQ 467
            + V ++               F SK L  +LG  N        + ++ +  L +   V +
Sbjct: 732  QMVELLLKLGKNSQLDPHTVTFVSKELVQDLGGANSQEQKEAVEHFMLSLALCHSVVVEE 791

Query: 468  DS---ETQDWKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDDE--KDARANSSFEHVAEF 522
            +    E  D KA   P E A+   A  M        G  K+    +       F  +   
Sbjct: 792  NKNNPEKLDIKAQS-PDEAALVETARDMGFS---FVGRTKNGVIIEIQGVQKEFRILNVL 847

Query: 523  PFDSSVKRMSAIYK--NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDL 580
             F+S+ KRMS I K    ++ + P   +  KGA   +    D     P         + L
Sbjct: 848  EFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSRNDP---------KLL 898

Query: 581  ETIQKNVDTLSSEGLRVLAFAKKSFNESEF-NANKDKLLK-----------ER--DFVEC 626
            E    +++  ++EGLR L  A++  +  E+ N N+ + L            ER  D +E 
Sbjct: 899  ERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEALERVADAIER 958

Query: 627  KLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNL 683
            +L  LG   I D  +     ++     AGI + +LTGD   TA +I     +L  ++
Sbjct: 959  QLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSCNLLGSDM 1015

>Scas_636.16
          Length = 1554

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 76/182 (41%), Gaps = 27/182 (14%)

Query: 516 FEHVAEFPFDSSVKRMSAIYKNTEDPAT----PIYEVFTKGAFERVLQCCDSWYTTPDGK 571
           F+ +    F+SS KRMS I K    PAT    P   +  KGA   +       Y+    K
Sbjct: 813 FQILNILEFNSSRKRMSCIVKLP--PATEKDEPRALLICKGADSVI-------YSRLSRK 863

Query: 572 PSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFN--------------ANKDKL 617
           P    +  LE    +++  ++EGLR L   ++  + SE+                 +++L
Sbjct: 864 PGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEEL 923

Query: 618 LKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVG 677
               D +E  L  LG   I D  +     ++    +AGI + +LTGD   TA +I     
Sbjct: 924 DHVADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCN 983

Query: 678 IL 679
           +L
Sbjct: 984 LL 985

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 77/184 (41%), Gaps = 25/184 (13%)

Query: 516  FEHVAEFPFDSSVKRMSAIYK--NTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPS 573
            F+ +    F+SS KRMS I K   +     P   +  KGA   +    D   T  D    
Sbjct: 879  FQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDR--TQNDATL- 935

Query: 574  PLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLK 619
                  LE    +++  ++EGLR L  A++    SE+                 +++L K
Sbjct: 936  ------LEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDK 989

Query: 620  ERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGIL 679
              D +E +L  LG   I D  +     ++    +AGI + +LTGD   TA +I     +L
Sbjct: 990  VTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVL 1049

Query: 680  PHNL 683
             +++
Sbjct: 1050 NNDM 1053

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 317 AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIVR-KLDS---------LEALGAVNDI 366
           A+ +  S++P SL + + I  +A A  + T  ++   KLD           + LG +  I
Sbjct: 650 AVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYI 709

Query: 367 CSDKTGTLTQGKMIAKQVWI 386
            SDKTGTLTQ  M  K+  I
Sbjct: 710 FSDKTGTLTQNVMEFKKCTI 729

>Kwal_33.15526
          Length = 311

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 1/66 (1%)

Query: 698 ATDFDALSDQEIDDLRVLPLVI-ARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKI 756
           AT+ DA + QEI     L  V+   C  +T +++ +      +   M GDG ND P++ +
Sbjct: 207 ATEVDANTGQEILSGYTLGDVVDGECKAETLLQLAQEYGVPVEATVMVGDGGNDLPAMAV 266

Query: 757 ANVGIA 762
           A  GIA
Sbjct: 267 AGFGIA 272

>Scas_505.4
          Length = 1025

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 100/249 (40%), Gaps = 29/249 (11%)

Query: 717 LVIARCAPQTKVRMIEALHRR-SKFCAMTGDGVNDSPSLKIANVGIAM-GINGSDVAKDA 774
           +V  R +P  K  +++ + R+ S      GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 589 VVCCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648

Query: 775 SDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVF 834
            DI +    F   L  V  G      I   +L    +N   ALY M    FV    FS  
Sbjct: 649 -DIAVGQFRFLKKLLLV-HGSWSYQRISVAILYSFYKNT--ALY-MTQFWFVFANAFSGQ 703

Query: 835 PLSPVEVL-WIIVVTSCFPAMGLGL--EKASVDVMEKPPKDAK--------AVVFTWEVI 883
            +     + +  V  + FP   +G+  +  S  ++E+ P+  K        +V   W  I
Sbjct: 704 SIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWI 763

Query: 884 IDMLVYGVIMAACCMACFVTVLYGTGDGNLGSDCND------ALGETCHLVFRGRAAAFA 937
           ++   +  ++    M  +    YG    N+  +  D      A+  +  L+  G+ AA  
Sbjct: 764 VNGFYHSAVVYIGTMLFY---RYGMA-LNMHGEVADHWSWGIAVYTSSILIVLGK-AALV 818

Query: 938 TMTWCALIL 946
           T  W    L
Sbjct: 819 TNQWTKFTL 827

>Sklu_786.1 YGR208W, Contig c786 410-1348
          Length = 312

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query: 649 KKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQE 708
           K   + G  + +L+G F   A  + +        + H      NF+   AT+ D  + +E
Sbjct: 170 KGLGRTGCKLAVLSGGFTPFANYMKE--------ILHLDYARANFL---ATEIDPTTGEE 218

Query: 709 IDDLRVL-PLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIA 762
           +     +  +V  +C  +T +++ +      +   M GDG ND P++ +A  GIA
Sbjct: 219 VLSGHTIGDIVDGQCKAKTLLQLAKEYDVPVESTVMVGDGGNDLPAMGVAGFGIA 273

>YGR208W (SER2) [2158] chr7 (911886..912815) Phosphoserine
           phosphatase, involved in synthesis of serine from
           3-phosphoglycerate [930 bp, 309 aa]
          Length = 309

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 716 PLVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIA 762
           P+V  +C  +T +++    +   +   M GDG ND P++  A  GIA
Sbjct: 225 PIVDGQCKSETLLQLCNDYNVPVEASCMVGDGGNDLPAMATAGFGIA 271

>Scas_463.3
          Length = 315

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 717 LVIARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIA 762
           +V  +C  +T + + E      +   M GDG ND P++ +A  GIA
Sbjct: 228 IVDGQCKAETLLELCEKYQCPVEASCMVGDGGNDLPAMSVAGFGIA 273

>AGR226W [4537] [Homologous to ScYPL112C - SH]
            complement(1174528..1175499) [972 bp, 323 aa]
          Length = 323

 Score = 32.0 bits (71), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 999  PVINDKVFLHYNISYEWGFAIGFSFAFWAGVELYKYGKRH 1038
            P + D ++L+Y I  E   ++ +SF  WA   LY +  RH
Sbjct: 145  PTLTDVLYLYYGIMDE--LSLTYSFGLWAHKGLYAFVARH 182

>YDR495C (VPS3) [1310] chr4 complement(1438103..1441138) Vacuolar
           sorting protein, also involved in vacuolar segregation
           [3036 bp, 1011 aa]
          Length = 1011

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 25/36 (69%)

Query: 683 LYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLV 718
           L+++  E  N+M+++ T FDA S+ +ID + +LP V
Sbjct: 166 LHYFELERGNYMLVSQTKFDAESNSKIDKILLLPKV 201

>Scas_665.13
          Length = 568

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 16/96 (16%)

Query: 744 TGDGVNDSPSLKIANVGIAMGI-NGSDVAKDASDIVLSDDNFA---------SILNAVEE 793
           T D V+D P+LK+A+    +G+  G+ +    SDI+  D N           SI  A E+
Sbjct: 143 TNDEVDDLPTLKLAHTIDHLGVGKGTILTLRESDILSDDANEGEGNDVLEDTSIQQAKED 202

Query: 794 GRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKE 829
            R    NI+  + Q+  E   + + L VG  F++K+
Sbjct: 203 KR----NIE--LRQMNKERRRRKMNLAVGSKFIEKD 232

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,878,584
Number of extensions: 1474124
Number of successful extensions: 4378
Number of sequences better than 10.0: 91
Number of HSP's gapped: 4312
Number of HSP's successfully gapped: 205
Length of query: 1066
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 954
Effective length of database: 12,718,893
Effective search space: 12133823922
Effective search space used: 12133823922
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)