Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18766g68321541e-15
Scas_596.28028822e-04
Kwal_23.31448525700.011
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18766g
         (67 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18766g complement(1725142..1725348) some similarities with...    64   1e-15
Scas_596.2                                                             36   2e-04
Kwal_23.3144                                                           32   0.011

>KLLA0F18766g complement(1725142..1725348) some similarities with
          sgd|S0007234 Saccharomyces cerevisiae YDR034wb
          questionable ORF - identified by SAGE, hypothetical
          start
          Length = 68

 Score = 63.9 bits (154), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/32 (100%), Positives = 32/32 (100%)

Query: 36 APPRQDSGCCGTCCKALMCCCLFELCCSILSG 67
          APPRQDSGCCGTCCKALMCCCLFELCCSILSG
Sbjct: 36 APPRQDSGCCGTCCKALMCCCLFELCCSILSG 67

>Scas_596.2
          Length = 80

 Score = 36.2 bits (82), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 36 APPRQDSGCCGTCCKALMCCCLFELCCS 63
          AP +++S C  TC K ++CCC+ E+CCS
Sbjct: 52 APQKEESSCWSTCFKTMLCCCILEMCCS 79

>Kwal_23.3144
          Length = 85

 Score = 31.6 bits (70), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%)

Query: 38 PRQDSGCCGTCCKALMCCCLFELCC 62
            + SGCCG C KAL CCCLFE+ C
Sbjct: 59 KEEGSGCCGWCMKALCCCCLFEMLC 83

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.336    0.145    0.587 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 939,622
Number of extensions: 13381
Number of successful extensions: 77
Number of sequences better than 10.0: 8
Number of HSP's gapped: 74
Number of HSP's successfully gapped: 8
Length of query: 67
Length of database: 16,596,109
Length adjustment: 40
Effective length of query: 27
Effective length of database: 15,211,389
Effective search space: 410707503
Effective search space used: 410707503
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 54 (25.4 bits)