Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18744g37236619560.0
Sklu_2360.537236617500.0
Kwal_56.2307937236617170.0
Scas_661.2437236617120.0
CAGL0H10142g37236616790.0
YDR035W (ARO3)37036616160.0
ABL102C37336615690.0
YBR249C (ARO4)37035811491e-157
Scas_597.1337235711441e-157
CAGL0C01573g35636011371e-156
AFL047W36435911311e-155
Sklu_1187.136835311251e-154
Kwal_14.155436435311121e-152
KLLA0F06556g36435310951e-149
Scas_26.11831677961e-107
AFR270W381107920.002
YEL023C682104800.070
KLLA0B09218g1385103740.41
CAGL0M04829g170687691.6
AFR648W47117645.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18744g
         (366 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18744g complement(1723008..1724126) highly similar to sp|P...   758   0.0  
Sklu_2360.5 YDR035W, Contig c2360 14257-15375                         678   0.0  
Kwal_56.23079                                                         665   0.0  
Scas_661.24                                                           664   0.0  
CAGL0H10142g 989652..990770 highly similar to sp|P14843 Saccharo...   651   0.0  
YDR035W (ARO3) [888] chr4 (521811..522923) 2-Dehydro-3-deoxyphos...   627   0.0  
ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH] (206411..207...   608   0.0  
YBR249C (ARO4) [428] chr2 complement(716839..717951) 2-Dehydro-3...   447   e-157
Scas_597.13                                                           445   e-157
CAGL0C01573g 170694..171764 highly similar to sp|P32449 Saccharo...   442   e-156
AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH] complement(...   440   e-155
Sklu_1187.1 YBR249C, Contig c1187 489-1595                            437   e-154
Kwal_14.1554                                                          432   e-152
KLLA0F06556g 633167..634261 highly similar to sp|P32449 Saccharo...   426   e-149
Scas_26.1                                                             311   e-107
AFR270W [3462] [Homologous to NOHBY] complement(919886..921031) ...    40   0.002
YEL023C (YEL023C) [1401] chr5 complement(108504..110552) Protein...    35   0.070
KLLA0B09218g 805915..810072 gi|22080764|emb|CAD43185.1 Kluyverom...    33   0.41 
CAGL0M04829g complement(524685..529805) similar to sp|Q05022 Sac...    31   1.6  
AFR648W [3841] [Homologous to ScYGR255C (COQ6) - NSH] complement...    29   5.8  

>KLLA0F18744g complement(1723008..1724126) highly similar to
           sp|P14843 Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           phenylalanine-inhibited, start by similarity
          Length = 372

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/366 (100%), Positives = 366/366 (100%)

Query: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60
           MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD
Sbjct: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60

Query: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240

Query: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300
           LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL
Sbjct: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300

Query: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360
           YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA
Sbjct: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360

Query: 361 KGVKNR 366
           KGVKNR
Sbjct: 361 KGVKNR 366

>Sklu_2360.5 YDR035W, Contig c2360 14257-15375
          Length = 372

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/366 (86%), Positives = 342/366 (93%)

Query: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60
           MFI NDH+GDR+ LEDWRIKGYDPLTPPDLLQHEYPI EK  K IV+ARE+VC+ILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60

Query: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCSIHDPKAAYEYAD L  +S++LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT L EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV++DAMR+AAHSHYFLSVTKPG+TAIVGTEGN DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240

Query: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300
           LRGGK GTN+D+ NVK+TQ EL+KAK+AD  G QRRIM+DCSHGNS KDFRNQPKVAQS+
Sbjct: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300

Query: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360
           Y+QL+AG+NAICGVMIESNLVEGRQDVPPEGGRE L YGCSITDACIGWE+TE VL LLA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360

Query: 361 KGVKNR 366
           KGV+NR
Sbjct: 361 KGVQNR 366

>Kwal_56.23079
          Length = 372

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/366 (86%), Positives = 336/366 (91%)

Query: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60
           MFI NDH+GDR+ LEDWRIKGYDPLTPPDLLQHE PI  K  K IV+ARE+VCDILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60

Query: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCSIHDPKAAYEY D L   S + + DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE+FT L EK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV+VDAMR+AAHSHYFLSVTKPGVTAIVGTEGN DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240

Query: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300
           LRGGKTGTN+DAENVKKTQ ELVKAK+A+  G  RRIM+DCSHGNS KD+RNQPKVAQS+
Sbjct: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300

Query: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360
           YEQL+ GQNAICGVMIESNLVEGRQDVP EGGRE L YGCSITDACIGWETTE+VL LLA
Sbjct: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360

Query: 361 KGVKNR 366
           KGV+NR
Sbjct: 361 KGVQNR 366

>Scas_661.24
          Length = 372

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/366 (85%), Positives = 337/366 (92%)

Query: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60
           MFI NDH GDR+ LEDWRIKGYDPLTPPDLLQHEYPI E+  KIIV+ARE VCDILNGKD
Sbjct: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60

Query: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCSIHDPKAAYEYAD L KI+  LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT+L EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240
           RELASGLSFPIGFKNGTDGGLQV++DAMR+AAH HYFLSVTKPGVTAIVGTEGN+DTFVI
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240

Query: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300
           LRGGK GTNFDAE+V+ T+ EL K  + DA   QRRIM+DCSHGNS KD+RNQPKVAQS+
Sbjct: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300

Query: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360
           Y+QL+AG+NAICGVMIESNLVEGRQDVPPEGGR  L YGCSITDACIGWE+TEDVL+ LA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360

Query: 361 KGVKNR 366
           +GV+NR
Sbjct: 361 EGVRNR 366

>CAGL0H10142g 989652..990770 highly similar to sp|P14843
           Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase, start by
           similarity
          Length = 372

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/366 (83%), Positives = 333/366 (90%)

Query: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60
           MFI ND+ GDR+ LEDWRIKGYDPLTPPDLLQHEYPI EK    I++AR+ VCDILNGKD
Sbjct: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60

Query: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+V+VIGPCSIHDPKAAYEYAD L  I+++LSDDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT+L EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVA+DAMR+A+H HYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240

Query: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300
           LRGGK GTN+DAENVK T+ +L KAK+ D     RRIM+DCSHGNS KD+RNQPKVAQ +
Sbjct: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300

Query: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360
           Y QLSAG+N +CGVMIESNLVEGRQDVPPEGGRE L YGCSITDACIGW+TTE VL LLA
Sbjct: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360

Query: 361 KGVKNR 366
           +GV+NR
Sbjct: 361 EGVRNR 366

>YDR035W (ARO3) [888] chr4 (521811..522923)
           2-Dehydro-3-deoxyphosphoheptonate aldolase (DAHPS),
           inhibited by phenylalanine [1113 bp, 370 aa]
          Length = 370

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/366 (79%), Positives = 331/366 (90%), Gaps = 2/366 (0%)

Query: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60
           MFI NDH GDR  LEDWRIKGYDPLTPPDLLQHE+PI  K ++ I++AR+ VCDILNGKD
Sbjct: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60

Query: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCS+HDPKAAY+YAD L KIS++LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREMF +L EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240
           RELASGLSFPIGFKNGTDGGLQVA+DAMR+AAH HYFLSVTKPGVTAIVGTEGN+DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240

Query: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300
           LRGGK GTNFD E+V+ T+ +L KA + D    Q+RIM+DCSHGNS KDF+NQPKVA+ +
Sbjct: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTDDS--QKRIMIDCSHGNSNKDFKNQPKVAKCI 298

Query: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360
           Y+QL+ G+N++CGVMIESN+ EGRQD+P EGGRE L YGCS+TDACIGWE+TE VL LLA
Sbjct: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358

Query: 361 KGVKNR 366
           +GV+NR
Sbjct: 359 EGVRNR 364

>ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH]
           (206411..207532) [1122 bp, 373 aa]
          Length = 373

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/366 (77%), Positives = 323/366 (88%)

Query: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60
           MFI N++IGD+S LEDWRIKGYDPLTPP++LQHE P+    + IIV ARE V  +L+G+D
Sbjct: 1   MFIKNEYIGDKSRLEDWRIKGYDPLTPPNVLQHELPVSANGRAIIVRAREGVVQVLSGRD 60

Query: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRL+VV+GPCSIHDP+AA EYA  L +++  L  +LL+IMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLLVVVGPCSIHDPEAALEYAQRLSEVASRLRGELLVIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREM+T+L E +PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMYTQLVEHIPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240
           RELASGLSFPIGFKNGTDG LQVA+DAMR+AAHSHYFLSVTKPGVTAIVGTEGNEDTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGCLQVAIDAMRAAAHSHYFLSVTKPGVTAIVGTEGNEDTFII 240

Query: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300
           LRGGK GTN+DA +V++ + +LV AK+ D+ GVQRRIM+DCSHGNS KD+RNQPKVAQ +
Sbjct: 241 LRGGKDGTNYDAASVQQAKQDLVNAKLVDSAGVQRRIMIDCSHGNSNKDYRNQPKVAQDI 300

Query: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360
           YEQLS G+NAICGVMIESNLVEGRQD+P   GR  L YGCSITDACIGW+ T +VL LLA
Sbjct: 301 YEQLSKGENAICGVMIESNLVEGRQDIPEGNGRVGLKYGCSITDACIGWDQTVEVLELLA 360

Query: 361 KGVKNR 366
           KGV N+
Sbjct: 361 KGVINK 366

>YBR249C (ARO4) [428] chr2 complement(716839..717951)
           2-Dehydro-3-deoxyphosphoheptonate aldolase
           (3-deoxy-D-arabino-heptulosonate-7-phosphate synthase or
           DAHP synthase), inhibited by tyrosine [1113 bp, 370 aa]
          Length = 370

 Score =  447 bits (1149), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 225/358 (62%), Positives = 271/358 (75%), Gaps = 10/358 (2%)

Query: 10  DRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKDDRLVVVIGP 69
           ++ + ED RI GYDPL  P LLQ + P    + +     R +  DI+ GKDDR++V++GP
Sbjct: 16  NQGAEEDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGP 75

Query: 70  CSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQIN 129
           CSIHD +AA EYA  LKK+SDEL  DL IIMRAYLEKPRTTVGWKGLINDPD++N+F IN
Sbjct: 76  CSIHDLEAAQEYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNIN 135

Query: 130 KGLRISREMFTRLTE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLS 188
           KGL+ +R++F  LT   LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLS
Sbjct: 136 KGLQSARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAIGARTTESQLHRELASGLS 195

Query: 189 FPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVILRGGKTGT 248
           FP+GFKNGTDG L VAVDA ++AAHSH+F+ VTK GV AI  T+GNE  FVILRGGK GT
Sbjct: 196 FPVGFKNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGT 255

Query: 249 NFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSLYEQLSAGQ 308
           N+DA++V + +A+L     A + G    +M+D SHGNS KDFRNQPKV   + EQ++ G+
Sbjct: 256 NYDAKSVAEAKAQL----PAGSNG----LMIDYSHGNSNKDFRNQPKVNDVVCEQIANGE 307

Query: 309 NAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLAKGVKNR 366
           NAI GVMIESN+ EG Q +P E G+  L YG SITDACIGWETTEDVLR LA  V+ R
Sbjct: 308 NAITGVMIESNINEGNQGIPAE-GKAGLKYGVSITDACIGWETTEDVLRKLAAAVRQR 364

>Scas_597.13
          Length = 372

 Score =  445 bits (1144), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 275/357 (77%), Gaps = 10/357 (2%)

Query: 11  RSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKDDRLVVVIGPC 70
           + + ED RI GYDPL  P LLQ + P  EK  +   + R +  +I++G+DDR++V++GPC
Sbjct: 17  QDAAEDVRILGYDPLVSPALLQVQIPATEKCIETAKKGRRESIEIISGRDDRVLVIVGPC 76

Query: 71  SIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINK 130
           SIHD  AA EYA  LKK++DELS DL++IMRAYLEKPRTTVGWKGLINDPD++N+F INK
Sbjct: 77  SIHDLDAAQEYALKLKKLADELSQDLVVIMRAYLEKPRTTVGWKGLINDPDVNNTFNINK 136

Query: 131 GLRISREMFTRLTE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSF 189
           GL+ +R++F  LT   LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSF
Sbjct: 137 GLQSARQLFVNLTNIGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSF 196

Query: 190 PIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVILRGGKTGTN 249
           PIGFKNGTDG L VAVDA ++A+HSH+F+ VTK GV AI  T+GNE  FVILRGGK GTN
Sbjct: 197 PIGFKNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTN 256

Query: 250 FDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSLYEQLSAGQN 309
           +DA++V + +A+L     A + G    +M+D SHGNS KDFRNQPKV  ++ EQ++ G+N
Sbjct: 257 YDAKSVAEAKAQL----PAGSNG----LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEN 308

Query: 310 AICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLAKGVKNR 366
           AI GVMIESN+ EG Q +PPE G+  L YG SITDACI +ETTEDVL+ LA  V+ R
Sbjct: 309 AIIGVMIESNINEGSQKIPPE-GKAGLKYGVSITDACISFETTEDVLKKLAAAVRQR 364

>CAGL0C01573g 170694..171764 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4, start by
           similarity
          Length = 356

 Score =  442 bits (1137), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 220/360 (61%), Positives = 272/360 (75%), Gaps = 10/360 (2%)

Query: 8   IGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKDDRLVVVI 67
           + D ++ ED RI GYDPL  P LLQ + P  E + +     R++  +I+ G+DDR++V++
Sbjct: 1   MSDANANEDVRILGYDPLVSPALLQVQVPATEVSIQTARRGRKESIEIITGRDDRVLVIV 60

Query: 68  GPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQ 127
           GPCS+HD  AA EYA  LKK+SDEL  DL I+MRAYLEKPRTTVGWKGLINDPD++N+F 
Sbjct: 61  GPCSVHDLDAAQEYAQRLKKLSDELQKDLCIVMRAYLEKPRTTVGWKGLINDPDVNNTFN 120

Query: 128 INKGLRISREMFTRLTEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASG 186
           INKGL+ +R++F  LT   +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASG
Sbjct: 121 INKGLQSARQLFVNLTNTGVPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASG 180

Query: 187 LSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVILRGGKT 246
           LSFPIGFKNGTDG L VAVDA ++A+HSH+F+ VTK GV AI  T+GNE  FVILRGGK 
Sbjct: 181 LSFPIGFKNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKK 240

Query: 247 GTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSLYEQLSA 306
           GTN+DA++V + + +L +     A G    +M+D SHGNS KDFRNQPKV  ++ EQ++ 
Sbjct: 241 GTNYDAKSVAEAKKQLPEG----ANG----LMIDYSHGNSNKDFRNQPKVNDAVCEQIAN 292

Query: 307 GQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLAKGVKNR 366
           G+ AI GVMIESN+ EG Q +PPE G+  L YG SITDACI WETTEDVLR LA  V+ R
Sbjct: 293 GEKAIVGVMIESNINEGNQCIPPE-GKAGLKYGVSITDACISWETTEDVLRKLAAAVRQR 351

>AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH]
           complement(351599..352693) [1095 bp, 364 aa]
          Length = 364

 Score =  440 bits (1131), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 215/359 (59%), Positives = 267/359 (74%), Gaps = 11/359 (3%)

Query: 9   GDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKDDRLVVVIG 68
            D    ED RI GYDPL  P LLQ + P  +   +   + R +  DI+ GKDDR++VV+G
Sbjct: 9   ADADQAEDVRILGYDPLVSPALLQSQIPATQACLETAQKGRREAIDIITGKDDRVLVVVG 68

Query: 69  PCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQI 128
           PCSIHD  AA EYA  LKK+++EL  DL+++MRAYLEKPRTTVGWKGLINDPD++N+F I
Sbjct: 69  PCSIHDLDAAQEYAQRLKKLAEELEGDLVVVMRAYLEKPRTTVGWKGLINDPDVNNTFNI 128

Query: 129 NKGLRISREMFTRLTE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGL 187
           NKGL+ +R++F  LT   +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGL
Sbjct: 129 NKGLQAARQLFVNLTSIGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGL 188

Query: 188 SFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVILRGGKTG 247
           SFPIGFKNGTDG L VA+DA+++++HSH+F+ VTK GV AI  T+GNE  FVILRGGK G
Sbjct: 189 SFPIGFKNGTDGSLDVALDAVKASSHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKRG 248

Query: 248 TNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSLYEQLSAG 307
           TN+DA +V + +A+L    V         +M+D SHGNS KDFRNQPKV + + EQ++ G
Sbjct: 249 TNYDATSVAEAKAKLPPTGV---------LMIDYSHGNSNKDFRNQPKVNEVVSEQIANG 299

Query: 308 QNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLAKGVKNR 366
           ++ I GVMIESN+ EG Q +PPE G+  L YG SITD CI WETTE+VLR LA  V+ R
Sbjct: 300 EDKIVGVMIESNINEGSQKIPPE-GKAGLKYGVSITDGCISWETTEEVLRKLAGAVRKR 357

>Sklu_1187.1 YBR249C, Contig c1187 489-1595
          Length = 368

 Score =  437 bits (1125), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 214/353 (60%), Positives = 266/353 (75%), Gaps = 11/353 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKDDRLVVVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P  + + +     R++  DI+ GKDDR++V++GPCSIHD
Sbjct: 19  EDVRILGYDPLVSPALLQSQVPATQVSLQTAQRGRKESIDIITGKDDRVLVIVGPCSIHD 78

Query: 75  PKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            + A EY   LKK+SDEL  DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 79  LELAQEYGTRLKKLSDELQGDLCIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQY 138

Query: 135 SREMFTRLTE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  LT   +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 139 ARQLFVNLTSLGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGLSFPIGF 198

Query: 194 KNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVILRGGKTGTNFDAE 253
           KNGTDG L VA+DA+++A+HSH+F+ VTK GV AI  T+GNE  F+ILRGGK GTN+DA+
Sbjct: 199 KNGTDGTLGVALDAVKAASHSHHFMGVTKHGVAAITTTKGNEHCFIILRGGKKGTNYDAQ 258

Query: 254 NVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSLYEQLSAGQNAICG 313
           +V + +A+L              +MVD SHGNS KDFRNQPKV  ++ EQ++ G++ I G
Sbjct: 259 SVAEAKAQLPPTGA---------LMVDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 309

Query: 314 VMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLAKGVKNR 366
           VMIES++ EG+Q +PPE G+  L YG SITD CIGWE+TE VLR LA  V+ R
Sbjct: 310 VMIESHINEGQQSIPPE-GKAGLKYGVSITDGCIGWESTEQVLRKLAAAVRQR 361

>Kwal_14.1554
          Length = 364

 Score =  432 bits (1112), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 212/353 (60%), Positives = 262/353 (74%), Gaps = 11/353 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKDDRLVVVIGPCSIHD 74
           ED RI G DPL  P LLQ + P   +  + + + R     I+ G+DDRL+V++GPCSIHD
Sbjct: 14  EDVRILGLDPLVSPALLQSQIPATPECLRTVQKGRVGASKIIMGEDDRLLVIVGPCSIHD 73

Query: 75  PKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
              A EYA  LKK++DEL  +L IIMRAYLEKPRTTVGWKGLINDPD++NSF INKGL+ 
Sbjct: 74  LDLAQEYARRLKKVADELEGELCIIMRAYLEKPRTTVGWKGLINDPDVNNSFNINKGLQC 133

Query: 135 SREMFTRLTEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  LT   LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 134 ARQLFVNLTSAGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 193

Query: 194 KNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVILRGGKTGTNFDAE 253
           KNGTDG + VA+DAM +A+HSH+F+ VTK G  AI  T+GNE  FVILRGG  GTN+DA+
Sbjct: 194 KNGTDGTMGVAIDAMLAASHSHHFMGVTKHGFAAITTTKGNEHCFVILRGGTKGTNYDAK 253

Query: 254 NVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSLYEQLSAGQNAICG 313
           +V + +A+L              +MVDCSHGNS KD+RNQPKV  ++ EQ++ G++ I G
Sbjct: 254 SVAEAKAQLPPGGT---------LMVDCSHGNSNKDYRNQPKVNDAVCEQVANGEDKIIG 304

Query: 314 VMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLAKGVKNR 366
           VMIES++ EG+Q +PPE G+  L YG SITD CIGWETTE+VLR L+  VK R
Sbjct: 305 VMIESHINEGKQSIPPE-GKAGLKYGVSITDGCIGWETTEEVLRKLSNAVKQR 356

>KLLA0F06556g 633167..634261 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           tyrosine-inhibited, start by similarity
          Length = 364

 Score =  426 bits (1095), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 212/353 (60%), Positives = 263/353 (74%), Gaps = 11/353 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKDDRLVVVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P  ++  +   + R++  DI+ GKDDR++VV+GPCSIHD
Sbjct: 13  EDVRILGYDPLVSPALLQAQVPASQECLETAQKGRKESIDIITGKDDRVLVVVGPCSIHD 72

Query: 75  PKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            K A +YA  LK +SDEL  DL IIMRAYLEKPRTTVGWKGLINDPD+DN++ INKGL++
Sbjct: 73  LKEAQDYAKGLKALSDELKGDLCIIMRAYLEKPRTTVGWKGLINDPDVDNTYNINKGLQV 132

Query: 135 SREMFTRLTE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           SR++F  LT   LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 133 SRQLFVNLTSLGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 192

Query: 194 KNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVILRGGKTGTNFDAE 253
           KNGTDG L VA+DA+++A+HSH+F+ VTK GV AI  T+GNE  FVILRGGK GTN+D+ 
Sbjct: 193 KNGTDGTLGVALDAVQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKQGTNYDSV 252

Query: 254 NVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSLYEQLSAGQNAICG 313
           +V + +  L    V         +M+D SHGNS KDFRNQPKV  ++ EQ++ G++ I G
Sbjct: 253 SVAEAKKALPPTGV---------LMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 303

Query: 314 VMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLAKGVKNR 366
           VMIES++ EG+Q +P E G+  L YG SITD CI  ETT +VLR LA  V+ R
Sbjct: 304 VMIESHINEGKQSIPAE-GKAGLKYGVSITDGCISLETTAEVLRKLAAAVRAR 355

>Scas_26.1
          Length = 183

 Score =  311 bits (796), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 145/167 (86%), Positives = 155/167 (92%)

Query: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60
           MFI NDH+GDR+ LEDWRIKGYDPLTPPDLLQHEYPI EK  K IV+ARE+VC+ILNGKD
Sbjct: 3   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 62

Query: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRLV+VIGPCSIHDPKAAYEYAD L  +S++LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 63  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 122

Query: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSL 167
           DIDNSFQINKGLRISREMFT L EKLPIAGEMLDTISPQFLSDCFS+
Sbjct: 123 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSV 169

>AFR270W [3462] [Homologous to NOHBY] complement(919886..921031)
           [1146 bp, 381 aa]
          Length = 381

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 135 SREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGFK 194
           +R++   + E   +  ++LD     F+SD  SL  + AR+ +  L  ++ASGL   +  +
Sbjct: 126 TRDVLRAICEHTGVCLDILDNTLMNFVSDIPSLVVLDARSPDISL--KVASGLPSNVAVR 183

Query: 195 NGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVIL 241
                 +  A+  +   A    + +V+  G+   + T GN DTF+ L
Sbjct: 184 CRNANEIFSAIKILEHIAQPTLYPTVSHDGLPICIHTTGNPDTFLAL 230

>YEL023C (YEL023C) [1401] chr5 complement(108504..110552) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.9143p [2049 bp, 682 aa]
          Length = 682

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 4/104 (3%)

Query: 183 LASGLSFPIGFKNGTDGGLQVAVDAMRSA-AHSHYFLSVTKPGVTAIVGTEGNEDTFVIL 241
           LA  + F + FK G          ++ S  A +H +LS   P   +++G   NED     
Sbjct: 414 LAEAIKFGVKFKPGAIHDFATKHTSIGSLFADTHDYLSFNSPKKCSLLGVSDNEDG---A 470

Query: 242 RGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGN 285
           R  K+G N   E+  K   E   +   + E V+    + C H N
Sbjct: 471 REDKSGRNERMEDCLKNIKETRLSLKDEKEKVKDAFTLKCGHAN 514

>KLLA0B09218g 805915..810072 gi|22080764|emb|CAD43185.1
           Kluyveromyces lactis alpha-aminoadipate reductase, start
           by similarity
          Length = 1385

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 12  SSLEDWRIKGYDP---LTPPDLL------------------QHEYPIGEKAKKIIVEARE 50
           S+L+DW IK  +P   + P D L                  Q E P G     II+ A  
Sbjct: 2   SALKDWAIKLDNPTISVLPHDFLRPQQQPLVKQESLSFQLPQLEVPHGRDPYTIILAAWA 61

Query: 51  KVCDILNGKDDRLVVVIGPCSIH-DPKAAYEYADLLKKISDEL 92
            +   L G DD +++V G  +I    +A + + +L   +S+EL
Sbjct: 62  SIIYRLTGDDDMVLLVRGAKAIRFTIQATWSFTELYDVVSNEL 104

>CAGL0M04829g complement(524685..529805) similar to sp|Q05022
           Saccharomyces cerevisiae YMR229c RRP5, hypothetical
           start
          Length = 1706

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 261 ELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSLYEQLSAGQNAICGVMIESNL 320
           + V+ KV + +  +RRI+V C   N       + +  +S+ E L  GQ+ I  V++E   
Sbjct: 634 QTVQVKVLEVDEERRRIIVTCKVSNE------EAQQQKSIIESLKIGQSIIETVVVEKTK 687

Query: 321 VEGRQDVPPEGGREKLIYGCSITDACI 347
                ++P  G R  +IY   I+D  I
Sbjct: 688 DSVIVEIPDVGIR-GVIYVGHISDERI 713

>AFR648W [3841] [Homologous to ScYGR255C (COQ6) - NSH]
           complement(1617641..1619056) [1416 bp, 471 aa]
          Length = 471

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 13/17 (76%)

Query: 343 TDACIGWETTEDVLRLL 359
           TDAC+ W TTE + RLL
Sbjct: 251 TDACLTWSTTEPLARLL 267

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,039,277
Number of extensions: 516220
Number of successful extensions: 1329
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1325
Number of HSP's successfully gapped: 28
Length of query: 366
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 263
Effective length of database: 13,030,455
Effective search space: 3427009665
Effective search space used: 3427009665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)