Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18722g27026611831e-166
ABL103W3172174904e-60
Kwal_56.230803141884852e-59
YBR057C (MUM2)3661623933e-45
CAGL0H10164g4841073698e-41
Scas_718.502361022502e-25
Scas_661.252251022333e-23
YNL199C (GCR2)53468662.1
YCR033W (SNT1)122635653.2
KLLA0F21648g122156644.2
ADR271W29346609.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18722g
         (266 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236 Saccha...   460   e-166
ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH] complement(2...   193   4e-60
Kwal_56.23080                                                         191   2e-59
YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein req...   155   3e-45
CAGL0H10164g complement(991125..992579) weakly similar to sp|P38...   146   8e-41
Scas_718.50                                                           100   2e-25
Scas_661.25                                                            94   3e-23
YNL199C (GCR2) [4403] chr14 complement(264925..266529) Transcrip...    30   2.1  
YCR033W (SNT1) [567] chr3 (186484..190164) Component of Set3p co...    30   3.2  
KLLA0F21648g complement(2008351..2012016) highly similar to sp|P...    29   4.2  
ADR271W [2012] [Homologous to ScYDL087C (LUC7) - SH] complement(...    28   9.7  

>KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein
           singleton, hypothetical start
          Length = 270

 Score =  460 bits (1183), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 229/266 (86%), Positives = 229/266 (86%)

Query: 1   MNSSMAHGGSFSLHGNIDGMGSHYNQGLQGHLXXXXXXXXXXXXYWEQPLIEQHNSPEIE 60
           MNSSMAHGGSFSLHGNIDGMGSHYNQGLQGHL            YWEQPLIEQHNSPEIE
Sbjct: 1   MNSSMAHGGSFSLHGNIDGMGSHYNQGLQGHLSGSSTHRSSMSSYWEQPLIEQHNSPEIE 60

Query: 61  SSRGISSNTHPGSSSNNTVIMDRSSYAKSSGFNTTFDSETEPSSDNFKLELQLKETQXXX 120
           SSRGISSNTHPGSSSNNTVIMDRSSYAKSSGFNTTFDSETEPSSDNFKLELQLKETQ   
Sbjct: 61  SSRGISSNTHPGSSSNNTVIMDRSSYAKSSGFNTTFDSETEPSSDNFKLELQLKETQIES 120

Query: 121 XXXXXXXXXXVFNQGLTFXXXXXXXXXXXXALTFDSEIQIPASLEIIFCKLSDSLKRKDQ 180
                     VFNQGLTF            ALTFDSEIQIPASLEIIFCKLSDSLKRKDQ
Sbjct: 121 LEIEIKKLKEVFNQGLTFKQQEEQKMKKSKALTFDSEIQIPASLEIIFCKLSDSLKRKDQ 180

Query: 181 ELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYG 240
           ELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYG
Sbjct: 181 ELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYG 240

Query: 241 RVKETSIELELLRKENQELKERLRIL 266
           RVKETSIELELLRKENQELKERLRIL
Sbjct: 241 RVKETSIELELLRKENQELKERLRIL 266

>ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH]
           complement(205068..206021) [954 bp, 317 aa]
          Length = 317

 Score =  193 bits (490), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 141/217 (64%), Gaps = 14/217 (6%)

Query: 64  GISSNTHPGSSSNNTVIMDRSSYAKSSGFNTTFDS----ETEPSS------DNFKLELQL 113
           G+++      +     IMD  +   SSGF+TTF +    ++ PS       ++ +LELQL
Sbjct: 90  GVAAGGSTAGTLTTASIMDGHTAKSSSGFSTTFATTSSQQSNPSHGSLESMESLRLELQL 149

Query: 114 KETQXXXXXXXXXXXXXVFNQGLTFXXXXXXXXXXX---XALTFDS-EIQIPASLEIIFC 169
           KETQ             +FNQGLTF               AL  D   ++IPA+LEIIF 
Sbjct: 150 KETQIESLEDEITKLKSIFNQGLTFKQQEQQLQKRKLHQHALDLDHMPVEIPANLEIIFN 209

Query: 170 KLSDSLKRKDQELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLETLMKE 229
           KL+ SLKRKD+EL++T++RLE I+TA+ALNPSNS T+FGRYDEEALAHKM+ RLE L KE
Sbjct: 210 KLATSLKRKDEELEDTRKRLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEMLTKE 269

Query: 230 NEEMAKMLSYGRVKETSIELELLRKENQELKERLRIL 266
           N+EMAK+LSYGR KET IELELL+K N++L+ ++  L
Sbjct: 270 NQEMAKLLSYGRSKETHIELELLKKVNRDLQRKVEQL 306

>Kwal_56.23080
          Length = 314

 Score =  191 bits (485), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 129/188 (68%), Gaps = 3/188 (1%)

Query: 80  IMDRSSYAKSSGFNTTF-DSETEPSSDNFKLELQLKETQXXXXXXXXXXXXXVFNQGLTF 138
           IMD S   K S FNTT+  SE + ++++ +LELQLKETQ             +FN GL  
Sbjct: 122 IMDNSVNTKISDFNTTYGSSEQQENAESMQLELQLKETQIESLEVEIQSLKLIFNDGLRL 181

Query: 139 XXXXXXXXXXXXALTFDSEIQIPASLEIIFCKLSDSLKRKDQELQETKRRLEGIVTAVAL 198
                       A+  ++ +++PASLE IF KLS +L  KD+EL ETK+RLE IVTAVAL
Sbjct: 182 RQEHDLRALSGPAI--NASVEVPASLEAIFQKLSSTLATKDKELDETKKRLESIVTAVAL 239

Query: 199 NPSNSTTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYGRVKETSIELELLRKENQE 258
           NPSN+ TK GRYDEEALAHKMV RLETL KEN++MAKML YGR KE  IE+ELL+KENQE
Sbjct: 240 NPSNTVTKLGRYDEEALAHKMVVRLETLTKENQDMAKMLGYGRSKENHIEIELLKKENQE 299

Query: 259 LKERLRIL 266
           LK++L  L
Sbjct: 300 LKKKLSQL 307

>YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein
           required for premeiotic DNA synthesis and sporulation
           [1101 bp, 366 aa]
          Length = 366

 Score =  155 bits (393), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 82/162 (50%), Positives = 108/162 (66%), Gaps = 6/162 (3%)

Query: 107 FKLELQLKETQXXXXXXXXXXXXXVFNQGLTFXXXXXXXXXXXXAL--TFDSEIQIPASL 164
            ++ELQ+KE+Q             +FN+GL +             +  TF+    +PASL
Sbjct: 193 LEVELQIKESQIESLENEIQRLKKIFNEGLNYKQNEHKYEKENCHIPQTFE----LPASL 248

Query: 165 EIIFCKLSDSLKRKDQELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLE 224
           E+IF KLS SL  K++EL ETK  LE I+TA+ALNP+NS TK+GRYD E++AHKMV RLE
Sbjct: 249 EVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAHKMVVRLE 308

Query: 225 TLMKENEEMAKMLSYGRVKETSIELELLRKENQELKERLRIL 266
            L  EN+EMAKML+YGR KET IEL+L +KEN EL+E++  L
Sbjct: 309 NLTNENKEMAKMLAYGRSKETQIELQLAKKENLELREKIASL 350

>CAGL0H10164g complement(991125..992579) weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein,
           hypothetical start
          Length = 484

 Score =  146 bits (369), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 68/107 (63%), Positives = 88/107 (82%)

Query: 157 EIQIPASLEIIFCKLSDSLKRKDQELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALA 216
           EI +P SL+IIF KLS +L+++++EL ETK  LE ++ A+ALNPSNS+TKFGRYD E LA
Sbjct: 366 EIDVPNSLDIIFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYDPENLA 425

Query: 217 HKMVTRLETLMKENEEMAKMLSYGRVKETSIELELLRKENQELKERL 263
           HK V RLETL KEN+EMA+MLS+GR KE  I LELL+KEN++LK ++
Sbjct: 426 HKTVVRLETLTKENQEMARMLSFGRAKEKHIALELLKKENKDLKTQI 472

>Scas_718.50
          Length = 236

 Score =  100 bits (250), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 56/102 (54%), Positives = 68/102 (66%), Gaps = 2/102 (1%)

Query: 167 IFCKLSDSLKRKDQELQETKRRLEGIVTAVALN--PSNSTTKFGRYDEEALAHKMVTRLE 224
           IF  L  SL  +++E +  KR  E +   VA+N   SNS TK GRYD E +AHKM+ R E
Sbjct: 131 IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRFE 190

Query: 225 TLMKENEEMAKMLSYGRVKETSIELELLRKENQELKERLRIL 266
            L KEN  MAKMLSYGR  ET IEL+L+  ENQELKER++ L
Sbjct: 191 MLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQL 232

>Scas_661.25
          Length = 225

 Score = 94.4 bits (233), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 76/102 (74%)

Query: 165 EIIFCKLSDSLKRKDQELQETKRRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLE 224
           E++F +L+  L+ K++E+++ + + E ++TA+AL+P+N    +G+ D E ++ KMVT+LE
Sbjct: 116 ELLFTRLNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQLE 175

Query: 225 TLMKENEEMAKMLSYGRVKETSIELELLRKENQELKERLRIL 266
           TL KEN+EM+K+L++   K  +IEL L+RKEN EL++RL  L
Sbjct: 176 TLTKENQEMSKLLNFEVSKSKNIELNLVRKENDELRKRLNQL 217

>YNL199C (GCR2) [4403] chr14 complement(264925..266529)
           Transcriptional activator involved in regulation of
           glycolytic gene expression [1605 bp, 534 aa]
          Length = 534

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 11/68 (16%)

Query: 196 VALNPSNSTTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYGRVKETSIELELLRKE 255
           V LNPSNS    G  D EA+   +    + ++ E  +        R+ +   ELEL R+E
Sbjct: 462 VDLNPSNS---MGPIDTEAVIRPLKEAYDAIISEKGQ--------RIVQLERELELQRQE 510

Query: 256 NQELKERL 263
            Q L++ L
Sbjct: 511 TQWLRKML 518

>YCR033W (SNT1) [567] chr3 (186484..190164) Component of Set3p
           complex (Set3p-Yil112p-Snt1p-Hst1p-Hos2p-Cph1p-Sif2p)
           that has histone deacetylase activity and a role in
           repression of meiotic-specific sporulation gene
           expression [3681 bp, 1226 aa]
          Length = 1226

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 7/35 (20%)

Query: 167 IFCKLSDSL-------KRKDQELQETKRRLEGIVT 194
           I  KLS++L       KRK+ EL E KRR EGI T
Sbjct: 550 ILTKLSENLRKEEIENKRKEHELMEQKRREEGIET 584

>KLLA0F21648g complement(2008351..2012016) highly similar to
           sp|P52918 Saccharomyces cerevisiae YDR335w MSN5
           multicopy supressor of SNF1 mutation singleton, start by
           similarity
          Length = 1221

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 6/56 (10%)

Query: 159 QIPASLEIIFCKLSDSLKRKDQE--LQETKRRLEGIVTA--VAL-NPSNSTTK-FG 208
           Q+ A+LE+I+   SD+ KR D +  L E K R E       +AL NP NS  K FG
Sbjct: 8   QVVAALEVIYDPKSDNAKRLDAQKFLDEVKEREESPFWGYEIALNNPQNSILKHFG 63

>ADR271W [2012] [Homologous to ScYDL087C (LUC7) - SH]
           complement(1165929..1166810) [882 bp, 293 aa]
          Length = 293

 Score = 27.7 bits (60), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 7/46 (15%)

Query: 219 MVTRLETLMKENEEMAKMLSYGRVKETSIELELLRKENQELKERLR 264
           M+  +ETL++ NE +  M+        S++L+ L+KE  EL +++R
Sbjct: 137 MIQEIETLVRSNEVVKAMVQ-------SLKLQTLQKERHELAKKVR 175

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.127    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,521,943
Number of extensions: 286107
Number of successful extensions: 1573
Number of sequences better than 10.0: 72
Number of HSP's gapped: 1561
Number of HSP's successfully gapped: 79
Length of query: 266
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 166
Effective length of database: 13,134,309
Effective search space: 2180295294
Effective search space used: 2180295294
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.7 bits)