Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18700g77075839500.0
Kwal_56.2308476276118300.0
AGR023C78077517930.0
CAGL0H10186g77878117670.0
YBR058C (UBP14)78177217660.0
Scas_718.49*82978215250.0
Sklu_1729.11361232357e-23
CAGL0G05247g9472601526e-10
CAGL0K02563g586721427e-09
YHL010C585721373e-08
KLLA0C03476g12522031312e-07
YJL197W (UBP12)12541301303e-07
YDR069C (DOA4)9262941284e-07
AFR627C12871571259e-07
AGL079C506661241e-06
Kwal_26.8090520601231e-06
Scas_545.2*9182621213e-06
Sklu_2425.87542091177e-06
Kwal_33.1362811601171161e-05
Kwal_14.20084242701132e-05
CAGL0L01639g11471201152e-05
KLLA0F25740g517521122e-05
KLLA0E10252g7961321133e-05
Kwal_26.91514543801087e-05
Kwal_34.162684491571088e-05
AFR007W8482591081e-04
Scas_634.1412011171081e-04
CAGL0K10494g495701043e-04
KLLA0E20449g6971531033e-04
Scas_618.5493761015e-04
YFR010W (UBP6)499731015e-04
KLLA0C06974g4463881006e-04
YMR223W (UBP8)4714271008e-04
CAGL0I06765g8872911008e-04
KLLA0A10791g484112999e-04
KLLA0D08459g750265970.002
ABL145W749148960.002
Scas_11.1*8850860.003
Scas_609.972948950.003
Kwal_33.14430511263940.003
AFR296C116958930.006
YIL156W (UBP7)1071112920.008
YER098W (UBP9)754164910.009
YNL186W (UBP10)79255910.009
Scas_623.2*795128910.010
CAGL0J11352g77143910.010
YER144C (UBP5)805260900.012
AGL357W116661890.017
Scas_655.487543890.018
Sklu_1544.2454254870.024
Scas_715.271744870.028
AEL029W44641860.030
Scas_464.3121155870.035
AGR370W74041860.036
YBL067C (UBP13)688160850.044
AGR139C789133850.054
CAGL0I05522g72441840.063
Kwal_55.19645970110840.077
AFR551W469141810.13
Sklu_1620.2772212810.13
Scas_698.7103048810.14
Scas_692.39466378800.16
Sklu_1979.431469790.17
CAGL0G02563g631118790.21
CAGL0A04477g77044790.25
Scas_664.17494201780.29
Kwal_55.2126760445770.47
CAGL0M11198g46144760.52
Kwal_27.1084271121760.60
YHR021W-A (ECM12)15158720.62
Scas_555.691725740.97
ACL164C138947741.0
Scas_695.748218731.0
KLLA0A00396g1012145731.4
YOR138C67156721.5
Kwal_26.95981191211731.6
Scas_714.11126929721.7
Kwal_14.1957444130712.1
YER151C (UBP3)91229712.3
CAGL0H05335g48322702.5
KLLA0B01650g85764712.6
KLLA0E00979g774166702.7
Scas_671.377040703.0
CAGL0M13783g1196243703.1
KLLA0E08767g77121693.8
Kwal_55.21393123316693.8
CAGL0F08041g991117693.9
CAGL0H10582g79027694.0
Sklu_1860.2615211684.5
CAGL0H06721g108119685.3
YKR023W53036675.7
AGR389C77543676.8
YOR124C (UBP2)127230677.0
CAGL0K10252g126716677.3
KLLA0D17138g91975668.0
Sklu_2341.750036659.8
KLLA0A09669g497366510.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18700g
         (758 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces...  1526   0.0  
Kwal_56.23084                                                         709   0.0  
AGR023C [4333] [Homologous to ScYBR058C (UBP14) - SH] (756967..7...   695   0.0  
CAGL0H10186g complement(993354..995690) similar to sp|P38237 Sac...   685   0.0  
YBR058C (UBP14) [248] chr2 complement(353632..355977) Ubiquitin-...   684   0.0  
Scas_718.49*                                                          592   0.0  
Sklu_1729.1 YBR058C, Contig c1729 2315-2720 reverse complement         95   7e-23
CAGL0G05247g complement(491024..493867) similar to sp|P32571 Sac...    63   6e-10
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    59   7e-09
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    57   3e-08
KLLA0C03476g 314815..318573 weakly similar to sp|P39538 Saccharo...    55   2e-07
YJL197W (UBP12) [2729] chr10 (63804..67568) Ubiquitin-specific p...    55   3e-07
YDR069C (DOA4) [920] chr4 complement(584935..587715) Ubiquitin-s...    54   4e-07
AFR627C [3819] [Homologous to ScYJL197W (UBP12) - SH] (1572372.....    53   9e-07
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    52   1e-06
Kwal_26.8090                                                           52   1e-06
Scas_545.2*                                                            51   3e-06
Sklu_2425.8 YER098W, Contig c2425 12113-14377 reverse complement       50   7e-06
Kwal_33.13628                                                          49   1e-05
Kwal_14.2008                                                           48   2e-05
CAGL0L01639g 176107..179550 similar to sp|P39538 Saccharomyces c...    49   2e-05
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    48   2e-05
KLLA0E10252g 906675..909065 gi|10444512|gb|AAG17929.1|AF303215_1...    48   3e-05
Kwal_26.9151                                                           46   7e-05
Kwal_34.16268                                                          46   8e-05
AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C (...    46   1e-04
Scas_634.14                                                            46   1e-04
CAGL0K10494g 1022869..1024356 highly similar to sp|P43593 Saccha...    45   3e-04
KLLA0E20449g 1810593..1812686 weakly similar to sp|P39967 Saccha...    44   3e-04
Scas_618.5                                                             44   5e-04
YFR010W (UBP6) [1690] chr6 (165060..166559) Ubiquitin C-terminal...    44   5e-04
KLLA0C06974g complement(604344..605684) similar to sp|P50102 Sac...    43   6e-04
YMR223W (UBP8) [4179] chr13 (716714..718129) Putative ubiquitin-...    43   8e-04
CAGL0I06765g 655806..658469 similar to sp|P32571 Saccharomyces c...    43   8e-04
KLLA0A10791g join(complement(935718..935733),complement(934135.....    43   9e-04
KLLA0D08459g complement(718046..720298) some similarities with s...    42   0.002
ABL145W [447] [Homologous to ScYNL186W (UBP10) - SH] complement(...    42   0.002
Scas_11.1*                                                             38   0.003
Scas_609.9                                                             41   0.003
Kwal_33.14430                                                          41   0.003
AFR296C [3488] [Homologous to ScYIL156W (UBP7) - SH; ScYKR098C (...    40   0.006
YIL156W (UBP7) [2521] chr9 (48091..51306) Putative ubiquitin-spe...    40   0.008
YER098W (UBP9) [1530] chr5 (355462..357726) Ubiquitin C-terminal...    40   0.009
YNL186W (UBP10) [4415] chr14 (289498..291876) Ubiquitin C-termin...    40   0.009
Scas_623.2*                                                            40   0.010
CAGL0J11352g complement(1101349..1103664) similar to sp|P53874 S...    40   0.010
YER144C (UBP5) [1573] chr5 complement(457801..460218) Ubiquitin-...    39   0.012
AGL357W [3955] [Homologous to ScYMR304W (UBP15) - SH] complement...    39   0.017
Scas_655.4                                                             39   0.018
Sklu_1544.2 YMR223W, Contig c1544 592-1956 reverse complement          38   0.024
Scas_715.2                                                             38   0.028
AEL029W [2477] [Homologous to ScYFR010W (UBP6) - SH] complement(...    38   0.030
Scas_464.3                                                             38   0.035
AGR370W [4681] [Homologous to ScYER098W (UBP9) - SH; ScYBL067C (...    38   0.036
YBL067C (UBP13) [130] chr2 complement(93817..95883) Ubiquitin C-...    37   0.044
AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH] (1010466..1...    37   0.054
CAGL0I05522g complement(521749..523923) some similarities with s...    37   0.063
Kwal_55.19645                                                          37   0.077
AFR551W [3743] [Homologous to ScYMR223W (UBP8) - SH] complement(...    36   0.13 
Sklu_1620.2 YER151C, Contig c1620 788-3106                             36   0.13 
Scas_698.7                                                             36   0.14 
Scas_692.39                                                            35   0.16 
Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement         35   0.17 
CAGL0G02563g complement(235498..237393) weakly similar to sp|P36...    35   0.21 
CAGL0A04477g 437397..439709 similar to sp|P38187 Saccharomyces c...    35   0.25 
Scas_664.17                                                            35   0.29 
Kwal_55.21267                                                          34   0.47 
CAGL0M11198g 1101217..1102602 similar to sp|P50102 Saccharomyces...    34   0.52 
Kwal_27.10842                                                          34   0.60 
YHR021W-A (ECM12) [2308] chr8 (149217..149672) Protein possibly ...    32   0.62 
Scas_555.6                                                             33   0.97 
ACL164C [885] [Homologous to ScYOR124C (UBP2) - SH] (67792..7196...    33   1.0  
Scas_695.7                                                             33   1.0  
KLLA0A00396g 29717..32755 similar to sp|P40453 Saccharomyces cer...    33   1.4  
YOR138C (YOR138C) [4939] chr15 complement(584309..586324) Protei...    32   1.5  
Kwal_26.9598                                                           33   1.6  
Scas_714.11                                                            32   1.7  
Kwal_14.1957                                                           32   2.1  
YER151C (UBP3) [1580] chr5 complement(469681..472419) Ubiquitin-...    32   2.3  
CAGL0H05335g complement(512683..514134) weakly similar to sp|Q02...    32   2.5  
KLLA0B01650g complement(131822..134395) weakly similar to sp|Q03...    32   2.6  
KLLA0E00979g 104991..107315 some similarities with sp|Q01477 Sac...    32   2.7  
Scas_671.3                                                             32   3.0  
CAGL0M13783g 1352648..1356238 similar to sp|P50101 Saccharomyces...    32   3.1  
KLLA0E08767g 784991..787306 similar to sp|P25037 Saccharomyces c...    31   3.8  
Kwal_55.21393                                                          31   3.8  
CAGL0F08041g complement(792575..795550) highly similar to sp|P16...    31   3.9  
CAGL0H10582g complement(1029876..1032248) similar to sp|P25037 S...    31   4.0  
Sklu_1860.2 YMR304W, Contig c1860 839-2682                             31   4.5  
CAGL0H06721g complement(667816..671061) similar to sp|P40453 Sac...    31   5.3  
YKR023W (YKR023W) [3278] chr11 (483062..484654) Protein of unkno...    30   5.7  
AGR389C [4700] [Homologous to ScYDL122W (UBP1) - SH] (1443891..1...    30   6.8  
YOR124C (UBP2) [4926] chr15 complement(554824..558642) Ubiquitin...    30   7.0  
CAGL0K10252g complement(997315..1001118) similar to sp|Q01476 Sa...    30   7.3  
KLLA0D17138g complement(1452972..1455731) similar to sp|P89102 S...    30   8.0  
Sklu_2341.7 YMR290C, Contig c2341 11365-12867 reverse complement       30   9.8  
KLLA0A09669g complement(847036..848529) highly similar to sp|Q03...    30   10.0 

>KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces
           cerevisiae YBR058c UBP14 ubiquitin specific protease
           singleton, start by similarity
          Length = 770

 Score = 1526 bits (3950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/758 (97%), Positives = 738/758 (97%)

Query: 1   MSGSDILDINVPRVIDTDDCVYCFETMKNKDEGREHSLFICLRCFQSFSEEHWELHQEVV 60
           MSGSDILDINVPRVIDTDDCVYCFETMKNKDEGREHSLFICLRCFQSFSEEHWELHQEVV
Sbjct: 1   MSGSDILDINVPRVIDTDDCVYCFETMKNKDEGREHSLFICLRCFQSFSEEHWELHQEVV 60

Query: 61  LSETGSTHDLYLRVFKVLKPKQEREEAGTXXXXXXXXXXVKDVNEDDLYDTHWLLGSVEH 120
           LSETGSTHDLYLRVFKVLKPKQEREEAGT          VKDVNEDDLYDTHWLLGSVEH
Sbjct: 61  LSETGSTHDLYLRVFKVLKPKQEREEAGTPPLEKKLKLEVKDVNEDDLYDTHWLLGSVEH 120

Query: 121 GELLSSDTPSIPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFDLSNLEKREG 180
           GELLSSDTPSIPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFDLSNLEKREG
Sbjct: 121 GELLSSDTPSIPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFDLSNLEKREG 180

Query: 181 GISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTA 240
           GISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTA
Sbjct: 181 GISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTA 240

Query: 241 DAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAKSKEKTLVELQVEQSLKWDFQMVDS 300
           DAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAKSKEKTLVELQVEQSLKWDFQMVDS
Sbjct: 241 DAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAKSKEKTLVELQVEQSLKWDFQMVDS 300

Query: 301 QGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTN 360
           QGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTN
Sbjct: 301 QGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTN 360

Query: 361 LHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDR 420
           LHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDR
Sbjct: 361 LHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDR 420

Query: 421 EIFKNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDY 480
           EIFKNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDY
Sbjct: 421 EIFKNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDY 480

Query: 481 FSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQPSKTSEQVVVPGVRD 540
           FSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQPSKTSEQVVVPGVRD
Sbjct: 481 FSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQPSKTSEQVVVPGVRD 540

Query: 541 DALLDMSPFKATGICXXXXXXXXXXSDSFQFNELFLGQLEQMGFSRNATKRALFETGNSD 600
           DALLDMSPFKATGIC          SDSFQFNELFLGQLEQMGFSRNATKRALFETGNSD
Sbjct: 541 DALLDMSPFKATGICEGEEVEEEEESDSFQFNELFLGQLEQMGFSRNATKRALFETGNSD 600

Query: 601 PNAATEWLFQHMEDPNLNEAFDPHASSSAKNRVDSEALNSMTAMGLDSKLCRKALILKNG 660
           PNAATEWLFQHMEDPNLNEAFDPHASSSAKNRVDSEALNSMTAMGLDSKLCRKALILKNG
Sbjct: 601 PNAATEWLFQHMEDPNLNEAFDPHASSSAKNRVDSEALNSMTAMGLDSKLCRKALILKNG 660

Query: 661 DVNASVEWVFSHMDDDGELPEAEEWKDQSRKSFGIPASSIASAKYKLTAVICHKGNSVHS 720
           DVNASVEWVFSHMDDDGELPEAEEWKDQSRKSFGIPASSIASAKYKLTAVICHKGNSVHS
Sbjct: 661 DVNASVEWVFSHMDDDGELPEAEEWKDQSRKSFGIPASSIASAKYKLTAVICHKGNSVHS 720

Query: 721 GHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDIE 758
           GHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDIE
Sbjct: 721 GHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDIE 758

>Kwal_56.23084
          Length = 762

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/761 (47%), Positives = 506/761 (66%), Gaps = 22/761 (2%)

Query: 5   DILDINVPRVIDTDDCVYCFETMKNKDEGREHSLFICLRCFQSFSEEHWELHQEVVLSET 64
           D   + +P VI  DDC YCFET+ N+ +   H+L ICL CFQSF + H  LHQ V   E 
Sbjct: 6   DFTQLQIPSVIYKDDCGYCFETLHNESQTTSHALHICLDCFQSFCKSHVPLHQCVTKKEF 65

Query: 65  GSTHDLYLRVFKVLKPKQEREEAGTXXXXXXXXXXVKDVNEDDLYDTHWLLGSVEHGELL 124
             +HD  L+V K  K +Q +               V + +EDD+YD+ W L     G  +
Sbjct: 66  ARSHDFLLKVSKCKKAEQSQP------IEKKLKLEVMERSEDDIYDSLWWLMK---GNDI 116

Query: 125 SSDTPS--IPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFDLSNLEKREGGI 182
            +D  S     +  +K+++IL  +S+++Q  + +W LE+K C H+ +F+ + + K E  +
Sbjct: 117 IADYKSQDFEADVQNKVAQILNARSNTFQRATESWQLEIKPCSHVTSFE-TPVNKSEC-L 174

Query: 183 SQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTADA 242
           S  C +C L SNLWLCLHCGNV CGR+QVGIEG+SHAL H+E    H LA+KLGSL+  +
Sbjct: 175 SDVCVECKLGSNLWLCLHCGNVGCGRQQVGIEGHSHALTHFEENPEHPLAVKLGSLSNTS 234

Query: 243 ADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAK-SKEKTLVELQVEQSLKWDFQMVDSQ 301
           ADIYCY CD++V+F    +  ++L+ W + +  K ++EK+LVELQVEQ+  WDFQMVDSQ
Sbjct: 235 ADIYCYFCDDEVQFQDLDKWHNVLEHWGINIRDKVAQEKSLVELQVEQNASWDFQMVDSQ 294

Query: 302 GKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNL 361
           G  L HL++   YG GLLNLGNSCY+N+VLQVL NGG+ +W+LD LG FPTDVVY  +NL
Sbjct: 295 GHELHHLRSSKRYGCGLLNLGNSCYMNAVLQVLFNGGVSSWSLDELGDFPTDVVYVSSNL 354

Query: 362 HCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDRE 421
            CQLIK+RNA+      YP G+KP+TFK  +GG+HEEFSSGRQQD+LEFFSYL D LD++
Sbjct: 355 KCQLIKLRNALRTNPEMYPNGVKPSTFKDCVGGTHEEFSSGRQQDALEFFSYLIDLLDKK 414

Query: 422 IFKNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYF 481
           +F  +  +PNDL +F++QD+I+C +C+ VK++ QVS+ +Q+PL + D  Q LI  L  Y 
Sbjct: 415 LFNRSEFHPNDLMKFSLQDRIECTSCHGVKYVTQVSDYLQVPLPESDDPQMLITNLERYL 474

Query: 482 SGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQPSKTSEQVVVPGV--R 539
            GE +E+ C    ++  A K  GF ++P TL+++  RI+L+NW P+KTS++V +PG+   
Sbjct: 475 QGETVEFSCPKCNRVTEAVKSSGFQTYPETLVVSCSRIKLVNWVPTKTSQEVTMPGIDAA 534

Query: 540 DDALLDMSPFKATGI-CXXXXXXXXXXSDSFQFNELFLGQLEQMGFSRNATKRALFETGN 598
           D +LL +   K+ G             S  F+     + QL +MGF+ NA+ RAL+ TGN
Sbjct: 535 DTSLLQLGHLKSNGFNSESEHLLPEDESPGFKAKPHCVSQLMEMGFTENASIRALYHTGN 594

Query: 599 SDPNAATEWLFQHMEDPNLNEAFDPHASSSAKNRVDSEALNSMTAMGLDSKLCRKALILK 658
           SD ++A  WLFQH+ED ++NE F    + S  + V+ +AL SM +MGL+  LC KAL+L 
Sbjct: 595 SDTDSAMNWLFQHVEDDDINELFVAPNAPSKPSEVNPQALESMVSMGLNPDLCHKALVLH 654

Query: 659 NGDVNASVEWVFSHMDD-DGELPEAEEWKDQSRKSFGIPASSIASAKYKLTAVICHKGNS 717
            G+V+ASVEWVF++ D+ D  L E ++  D +  S+GI  S    A ++L+AVICHKG+S
Sbjct: 655 KGNVSASVEWVFNNADNTDDTLLETQDGLDSN--SYGI--SDETKANFRLSAVICHKGSS 710

Query: 718 VHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDIE 758
           VHSGHYVAFIKK VE + +WVLYNDEK+++A+D  N  +I+
Sbjct: 711 VHSGHYVAFIKKDVENETKWVLYNDEKMVVADDPSNITEIK 751

>AGR023C [4333] [Homologous to ScYBR058C (UBP14) - SH]
           (756967..759309) [2343 bp, 780 aa]
          Length = 780

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/775 (46%), Positives = 490/775 (63%), Gaps = 35/775 (4%)

Query: 6   ILDINVPRVIDTDDCVYCFETMKNKDEG------REHSLFICLRCFQSFSEEHWELHQEV 59
           +  + +P  I  DDC YCFETM N + G       EH L ICL CFQSF  EH  LHQ+V
Sbjct: 5   VKQLKIPSTIYKDDCGYCFETMINPNFGDGGPAEPEHQLNICLGCFQSFCHEHVNLHQQV 64

Query: 60  VLSETGSTHDLYLRVFKVLKPKQEREEAGTXXXXXXXXXXVKDVNEDDLYDTHWLLGSVE 119
           V     +THDLYL V+K+ +PK       T          V+D++E++LY+T W L  + 
Sbjct: 65  VRRVQQATHDLYLNVYKIERPK------ATESAEKRLKLEVQDLSEEELYETVWSLVRIN 118

Query: 120 HGELL----SSDTPSIPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFDLSNL 175
           +        S     +      K+ +I++T+SS ++DM+ TW LE+K+CPH + F +   
Sbjct: 119 NACTARLGSSKQKQKMDTTVVSKLEQIIRTRSSDFKDMAATWQLEIKACPHSEQFVVP-- 176

Query: 176 EKREGGISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYE-STDGHALAIK 234
            +    + ++C DC L  NLWLCLHCGN+ CGREQVGIEG+SHALKHY+ S + H LA+K
Sbjct: 177 -QDAMPVRETCGDCDLDRNLWLCLHCGNIGCGREQVGIEGHSHALKHYQQSENNHPLAVK 235

Query: 235 LGSLTADAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAK-SKEKTLVELQVEQSLKW 293
           LGSLT+++ DIYCYSC+++V F    +   +L  + +++  + +KEKTLVELQVEQ++ W
Sbjct: 236 LGSLTSESNDIYCYSCNDEVAFPDPNRFSAVLAKFGIDLEGQVAKEKTLVELQVEQNMNW 295

Query: 294 DFQMVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTD 353
           DFQM DS  +  K +    EYG GL+NLGNSCYLNSV+QVL NGG+++WNLD LG FP D
Sbjct: 296 DFQMRDSGNEFTKKIFASKEYGCGLINLGNSCYLNSVVQVLFNGGVKDWNLDMLGDFPRD 355

Query: 354 VVYPRTNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSY 413
           VV+P TNL CQLIK+RNA+ +   +Y  G+KP + KK IG  +EEFSSGRQQD++EF +Y
Sbjct: 356 VVFPSTNLKCQLIKLRNALKIHPEKYQHGVKPASVKKCIGEDNEEFSSGRQQDAMEFLTY 415

Query: 414 LSDKLDREIF-KNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQN 472
             DKLDR++F K +++NPNDL RF ++D+++C  C  VK+  QV E++Q+PL   +  Q 
Sbjct: 416 FIDKLDRKVFSKASSSNPNDLMRFMVEDRLECTKCEHVKYSSQVCEILQIPLLDSNDPQF 475

Query: 473 LIDRLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQPSKTSEQ 532
           L+DRL+ YF+GE ++  C    +I  A+K     + P TL+INPIRI+L NW P KTS Q
Sbjct: 476 LMDRLHSYFNGESLDIHCPQCSEITVATKNSMLKTAPATLLINPIRIKLQNWTPIKTSNQ 535

Query: 533 VVVPGVRDDALLDMSPFKATGICXXXXXXXXXXSD---------SFQFNELFLGQLEQMG 583
           + VPG+RD+  L +S FKA G             D         SF  +E  +  +  MG
Sbjct: 536 LFVPGLRDEKRLKLSQFKAHGRQPGEKIFEDSPDDNSNVPASAISFNPDEDKVISIISMG 595

Query: 584 FSRNATKRALFETGNSDPNAATEWLFQHMEDPNLNEAFDPHASSSAKNRVDSEALNSMTA 643
           FS+NA  RAL+ TG S+   A  W+F+HMEDP LN  F    +      VD  AL+SM +
Sbjct: 596 FSKNAALRALYNTG-SEVERALNWIFEHMEDPELNAEFSVPGTKKQAAVVDQGALDSMVS 654

Query: 644 MGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAEEWKDQSRKSFGIPASSIASA 703
           MGL  + CRKALIL +GDV  SVEWVF++ D+  +    E       + +G P       
Sbjct: 655 MGLAERHCRKALILNDGDVTRSVEWVFNNADNLDDDDTQESIDPPVSRDYGYPGD---IP 711

Query: 704 KYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDIE 758
            Y L+AVICHKGNSV SGHYVAFIKK V+G+ +WVLYNDEK++      N ++IE
Sbjct: 712 DYALSAVICHKGNSVQSGHYVAFIKKAVDGEPKWVLYNDEKLMAVGGNENLQEIE 766

>CAGL0H10186g complement(993354..995690) similar to sp|P38237
           Saccharomyces cerevisiae YBR058c UBP14 ubiquitin
           specific protease, hypothetical start
          Length = 778

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/781 (45%), Positives = 501/781 (64%), Gaps = 39/781 (4%)

Query: 1   MSGSDILDINVPRVIDTDDCVYCFETMKNKDE------------GREHSLFICLRCFQSF 48
           MS   +  + VP +I  ++C+YCFET  N ++               H+L ICL CFQ+ 
Sbjct: 1   MSDQILQGLEVPAIIAKEECIYCFETPYNPEKPGSKEQQLTDSTKAAHTLNICLVCFQAV 60

Query: 49  SEEHWELHQEVVLSETGSTHDLYLRVFKVLKPKQ--EREEAGTXXXXXXXXXXVKDVNED 106
              H   H EV      + H  YL V KV K +   + EE             V + + D
Sbjct: 61  CPRHTPFHIEVG-KHNDAQHFDYLNVAKVRKYEDMLDGEEDEDTNSSKKIKLQVIEKSRD 119

Query: 107 DLYDTHWLLGSVEHGE-----LLSSDTPSIPKEWSDKISEILQTKSSSYQDMSNTWTLEL 161
           + Y+  W L   E  +     +L S+  +  +  ++K+  +L  KS    D +N W L++
Sbjct: 120 EDYNDVWSLLHFESSQSSPHIVLKSNEANAAQ--TEKVDHVLNAKSQDLADQANVWELDI 177

Query: 162 KSCPHIQTFDLSNLEKREGGISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALK 221
           K C H+ +F  +N++  E  +   C+ C LT NLW+CL+CGN+ CGREQVGIEG+SHAL+
Sbjct: 178 KPCKHVDSFSFANVQ--EKPLETHCSSCELTQNLWICLYCGNLGCGREQVGIEGHSHALE 235

Query: 222 HYESTDGHALAIKLGSLTADAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAKSK-EK 280
           H++S + H LAIKLGSL++ + D+YCY+CD++VKF     L+  L  + +++  KS  EK
Sbjct: 236 HFKSKNDHCLAIKLGSLSSSSFDLYCYACDDEVKFNDLQVLKTTLAKYGIDMDKKSADEK 295

Query: 281 TLVELQVEQSLKWDFQMVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIR 340
           TLVELQVEQ++ WDF+MVD +G+ LK L    E G GL+NLGNSCYLNS LQ L NGG++
Sbjct: 296 TLVELQVEQNMNWDFKMVDEKGQQLKQLNASQELGCGLINLGNSCYLNSTLQCLFNGGVK 355

Query: 341 NWNLDGLGSFPT-DVVYPRTNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEF 399
            W+ D LG+ P+ +VVYP  NL  QL K+R A+  + + Y +GI+P +FKK IGGSHEEF
Sbjct: 356 GWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKEEPTIYKQGIRPKSFKKCIGGSHEEF 415

Query: 400 SSGRQQDSLEFFSYLSDKLDREIFKNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEV 459
           SSGRQQD+LEFF+Y  D+LD+++FKN+  NPNDL +F ++D+++C  C+ VK+  + S V
Sbjct: 416 SSGRQQDALEFFTYFVDELDKKLFKNSDYNPNDLMKFMMEDRLQCQECHGVKYSTETSNV 475

Query: 460 IQLPLRKLDGEQNLIDRLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRI 519
           IQLPL++ +  Q+L +R+N YFSGE IE++C   KK+  A K P   +FP TL+INPIRI
Sbjct: 476 IQLPLQESNDAQDLEERINAYFSGEVIEFKCPNCKKMVNAVKKPAMRTFPDTLVINPIRI 535

Query: 520 ELINWQPSKTSEQVVVPGVRDDA-LLDMSPFKATGICXXXXXXXXXXSDSFQF--NELFL 576
           ++ NW P KTS  + +PG+     +L+++ +K  G+           +D  QF  NE F+
Sbjct: 536 KIENWTPVKTSNLLTIPGLETPTEVLELTQYKGNGLQKDTETQLNDDNDEIQFEVNETFV 595

Query: 577 GQLEQMGFSRNATKRALFETGNSDPNAATEWLFQHMEDPNLNEAFDPHASSSAKNRVDSE 636
            QL +MGF+ NA  RAL+ TGN DP  A  WLF H+ED ++N  F P     AKN V+ E
Sbjct: 596 NQLMEMGFTENACVRALYHTGNKDPELAMNWLFGHIEDADVNAEFIP--PKKAKNDVNPE 653

Query: 637 ALNSMTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAEEWKDQSRKSFGIP 696
            ++ M  MGLD KLCRKALIL N DV  SV+WVF++MDDDGE+ E +E  D S K++G  
Sbjct: 654 HISMMVGMGLDPKLCRKALILNNHDVTRSVDWVFNNMDDDGEIEELKEQSDTS-KTYG-- 710

Query: 697 ASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFED 756
                +  Y+L+A+ICHKGNSVHSGHYVAFI+K+V+GK  WVLYNDEKI+++N   NFE+
Sbjct: 711 --HHDAKPYELSAIICHKGNSVHSGHYVAFIRKMVDGKPTWVLYNDEKIVVSN---NFEE 765

Query: 757 I 757
           +
Sbjct: 766 M 766

>YBR058C (UBP14) [248] chr2 complement(353632..355977)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2346 bp, 781 aa]
          Length = 781

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/772 (47%), Positives = 504/772 (65%), Gaps = 31/772 (4%)

Query: 1   MSGSDILDINVPRVIDTDDCVYCFETMKNK----DEGREHSLFICLRCFQSFSEEHWELH 56
           M+ + + ++NVP V+  D+C+YCFE+  N+    +   +HSL ICL CFQ+    H  LH
Sbjct: 1   MAEAVLENVNVPAVVSKDECIYCFESPYNEPLALNASPKHSLNICLNCFQATCNRHVPLH 60

Query: 57  QEVVLSETGSTHDLYLRVFKVLKPKQEREEAGTXXXXXXXXXXVKDVNEDDLYDTHWLL- 115
             V      + H  YL + KV KPKQE  E             V + +EDD ++T W L 
Sbjct: 61  IRVTEYACDTIHSNYLTIAKVEKPKQENVEENNNNKKIKLQ--VIETSEDDTHNTIWSLQ 118

Query: 116 ---GSVEHGELLSSDTPS-IPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFD 171
              G      +LS  T S I     +KI +IL+ KS  ++D  N+W LE+ +CPH + F 
Sbjct: 119 RFNGENVPRTVLSKSTDSDISSTALEKIEKILKAKSQDFEDKKNSWVLEISTCPHTENFQ 178

Query: 172 LSNLEKREGGISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHAL 231
           + +  +    ++Q C+ C LT NLWLCLHCGN+ CGREQ+GI+G+SHAL HY S + H L
Sbjct: 179 IPSKPENTVNLNQ-CSSCDLTQNLWLCLHCGNIGCGREQIGIDGHSHALDHYRSNNNHPL 237

Query: 232 AIKLGSLTADAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAK-SKEKTLVELQVEQS 290
           AIKLGSL++   D+YCY+CD++ +F  N+ L   L+ + + +  K + EKTLV+LQVEQ+
Sbjct: 238 AIKLGSLSSSTYDLYCYACDDETRFPDNVNLGSALQIYGINIQEKIADEKTLVQLQVEQN 297

Query: 291 LKWDFQMVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGS- 349
             W F+MVDS GK  + L     YG GL+NLGNSCYLNSV+Q L+NGG+ NW+LD LGS 
Sbjct: 298 ENWQFRMVDSSGKEFEKLSASKNYGCGLINLGNSCYLNSVIQSLVNGGVPNWSLDFLGSK 357

Query: 350 FPTDVVYPRTNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLE 409
           FP DVVYP  NL CQ IK+ NAM  +   YP GIKPTTFKK IG +H+EFSS RQQD++E
Sbjct: 358 FPLDVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTTFKKCIGQNHQEFSSNRQQDAME 417

Query: 410 FFSYLSDKLDREIFKNTTT---NPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRK 466
           F ++L D LD++ F ++++   NPNDL RF ++D+++C+ C KVK+  + +E IQ+PL +
Sbjct: 418 FLTFLLDLLDKKFFSSSSSGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEE 477

Query: 467 LDGEQNLIDRLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQP 526
            D  Q++++R+  YF G+ IE++C   K+  TA+K PGF S P+TLI+NPIRI L NW P
Sbjct: 478 NDEPQDMLERIKAYFEGQTIEFKCANCKEKVTANKKPGFKSLPQTLILNPIRIRLQNWIP 537

Query: 527 SKTSEQVVVPGVRD-DALLDMSPFKATGI---CXXXXXXXXXXSDSFQFNELFLGQLEQM 582
            KTS ++ +PG+ D D +LD+S + + G                 SF  N+  + QL +M
Sbjct: 538 VKTSNELSLPGLIDRDDMLDVSSYLSQGFDPQTENLLPDEDENRSSFTPNQCSISQLIEM 597

Query: 583 GFSRNATKRALFETGNSDPNAATEWLFQHMEDPNLNEAFDPHASSSAKNR--VDSEALNS 640
           GF++NA+ RALF TGN D  +A  WLFQHM+DP+LN+ F P  +   K++  VD  +L S
Sbjct: 598 GFTQNASVRALFNTGNQDAESAMNWLFQHMDDPDLNDPFVPPPNVPKKDKREVDEVSLTS 657

Query: 641 MTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAE--EWKDQSRKSFGIPAS 698
           M +MGL+  LCRKALIL NGDVN SVEWVF++MDDDG  PE E    + Q +K  G    
Sbjct: 658 MLSMGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFPEPEVPNEEQQQKKDLG---- 713

Query: 699 SIASAK-YKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLAN 749
             ++AK Y LTAVICHKGNSVHSGHYV FI+K+V  K +WVLYNDEK++ A+
Sbjct: 714 -YSTAKPYALTAVICHKGNSVHSGHYVVFIRKLVADKWKWVLYNDEKLVAAD 764

>Scas_718.49*
          Length = 829

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/782 (41%), Positives = 474/782 (60%), Gaps = 49/782 (6%)

Query: 8   DINVPRVIDTDDCVYCFETMKNKDEGR---EHSLFICLRCFQSFSEEHWELHQEVVLSET 64
           ++ VP  I  D C+YCFE++ N         HSL IC+ CFQ+    H  LH +V    +
Sbjct: 42  NLAVPTSIAKDQCIYCFESLYNNITATFNTTHSLDICISCFQATCPNHSLLHYKVTQHSS 101

Query: 65  GSTHDLYLRVFKVLKPKQEREEA---GTXXXXXXXXXXVKDVNEDDLYDTHWLLGSVE-H 120
            S H  YL + K  +P      A               +   +ED+LY+T W    +   
Sbjct: 102 DSPHGHYLNLSKWERPASSPSSASMNNDESNNKKIKLQIDTKSEDELYETKWSFQKISTD 161

Query: 121 GELL------SSDTPSIPKEWSDKISEILQTKSSSYQDMSNTWTLELKSCPHIQTFDLSN 174
           G LL      +++T ++     +KI++I++ KS +  + + +W LEL SC H ++     
Sbjct: 162 GSLLEPLFDNNTNTETLSSNTLNKINDIIRAKSKTLVEETQSWELELNSCSHTRS----- 216

Query: 175 LEKREGGISQS------CNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDG 228
           L+  E  IS +      C+DC L SNLWLCLHCGNV CGR QVGI+G SHAL H+++   
Sbjct: 217 LQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTHKD 276

Query: 229 HALAIKLGSLTADAADIYCYSCDEDVKF--THNLQLQDILKFWEVEVPAK-SKEKTLVEL 285
           H LAIKLGSL+ +++D+YCY C+++V+F    +   + +L  ++++V +K   EK+L+EL
Sbjct: 277 HPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLIEL 336

Query: 286 QVEQSLKWDFQMVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNW--- 342
           QVEQ++ W+F+MVDS G  L  L    E G G +NLGNSCYLNSVLQ L N G+ NW   
Sbjct: 337 QVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWATL 396

Query: 343 --NLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFS 400
             NL G   FP D VYP TNL CQLIKI NA  L    YPEGIKP +FK  +G S++EF 
Sbjct: 397 LANLIG-NEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEFK 455

Query: 401 SGRQQDSLEFFSYLSDKLDREIFKNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVI 460
           S  QQD+ EF ++L ++L++ +FK    NPN++ +F ++DKI+C +C  VK+  + +E I
Sbjct: 456 SNNQQDATEFLTFLLEQLEKTLFK-KDNNPNNIMKFIMEDKIQCQSCGNVKYSYEPTEYI 514

Query: 461 QLPLRKLDGEQNLIDRLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRI- 519
           QLPL   +  QNL++ L ++F+GE I++ C T KK   A+K   F + P TL+I+P RI 
Sbjct: 515 QLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVISPHRIS 574

Query: 520 -ELINWQPSKTSEQVVVPGVRDDA--LLDMSPFKATGICXXXXXX----XXXXSDSFQFN 572
            E   W P KTS ++ +P + D +  LLD+S F + G                +++F+ N
Sbjct: 575 FEKETWTPIKTSAELTLPNLDDSSNELLDLSSFISKGFDPTKETLFPEDVNEDNNTFKPN 634

Query: 573 ELFLGQLEQMGFSRNATKRALFETG-NSDPNAATEWLFQHMEDPNLNEAFDPHASSSAKN 631
           E  +  L +MGF+ N   +AL+ TG N+DP  A +WL QHM+D +  + F P   + A  
Sbjct: 635 EQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQDEFVPPPQTKAAG 694

Query: 632 ---RVDSEALNSMTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAEEWKDQ 688
              +VD E+L++M  MGL+ KL  KAL+L  GD+NAS+EWVF++ DD+GELP     K  
Sbjct: 695 PAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSETTPK-- 752

Query: 689 SRKSFGIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLA 748
            R   GI   ++ +  Y+LTAV+CHKGNS HSGHYVAFI+K+++ + +WVLYNDEKI+++
Sbjct: 753 -RDEEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVS 811

Query: 749 ND 750
           ++
Sbjct: 812 DN 813

>Sklu_1729.1 YBR058C, Contig c1729 2315-2720 reverse complement
          Length = 136

 Score = 95.1 bits (235), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (57%), Gaps = 8/123 (6%)

Query: 8   DINVPRVIDTDDCVYCFETMKNKDEGREHSLFICLRCFQSFSEEHWELHQEVVLSETGST 67
           ++ VP  I  DDC YCFETM N D+   H L ICL CFQSF  +H  LHQ +V  E   +
Sbjct: 9   NLAVPSSIYKDDCGYCFETMYNSDDSTNHHLNICLSCFQSFCVDHVHLHQSIVGKELSES 68

Query: 68  HDLYLRVFKVLKPKQEREEAGTXXXXXXXXXXVKDVNEDDLYDTHWLLGSVEHGE---LL 124
           HDLYL++ K  KP+ E +              VK+ +ED++Y+T W +  +++G    L+
Sbjct: 69  HDLYLKLKKTRKPEVEEQRM-----EKKLKLEVKEQSEDEIYETKWWVVQIQNGSSKLLI 123

Query: 125 SSD 127
           SSD
Sbjct: 124 SSD 126

>CAGL0G05247g complement(491024..493867) similar to sp|P32571
           Saccharomyces cerevisiae YDR069c DOA4 ubiquitin-specific
           protease, hypothetical start
          Length = 947

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 106/260 (40%), Gaps = 58/260 (22%)

Query: 314 YGLGLLNLGNSCYLNSVLQVLL-----------NGGIRNWNLDG-LGSFPTDVVYPRTNL 361
           + +GL N+GNSCY+N +LQ ++           N   ++ N++  LGS      Y     
Sbjct: 581 FTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARY----- 635

Query: 362 HCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKL--- 418
             +L  I +  +  Q +    ++PT F+  I   +  F +  QQD  EF  +L D L   
Sbjct: 636 FARLAHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFRNTNQQDCQEFCQFLLDGLHED 695

Query: 419 -------------------DREIF-----------KNTTTNPN---DLFRFNIQDKIKCD 445
                               RE+            +  TTN +   DLF+     ++KC 
Sbjct: 696 LNQCGNNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTNFSVIIDLFQGQYASRLKCS 755

Query: 446 NCNKVKFMDQVSEVIQLPLRK-LDGEQNLIDRLNDYFSGEKIEY----RCLTNKKINTAS 500
            C+      Q   V+ +PL        NL+D  N++   EK+E+     C T KK   ++
Sbjct: 756 VCSNTSTTYQPFSVLSVPLPTGTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTCKKKQPST 815

Query: 501 KVPGFSSFPRTLIINPIRIE 520
           K    +  PR LII+  R +
Sbjct: 816 KQLTITRLPRNLIIHLKRFD 835

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (56%), Gaps = 8/72 (11%)

Query: 164 CP--HIQTFDLSNLEKREGGISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALK 221
           CP   + +F LS    R+ G  + C++CG + NLW+CL CG+V CGR         HA+K
Sbjct: 283 CPVCRLSSFRLSRDTLRKHGNKEKCSECGSSENLWICLICGHVGCGR-----YNSRHAIK 337

Query: 222 HYESTDGHALAI 233
           H+E T  H  A+
Sbjct: 338 HFEET-SHCFAM 348

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 178 REGGISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYEST-DGHALAIKLG 236
           ++ G S  C  CG T NLW+CL CGNV CGR         HA+KHYE T    A+ I+  
Sbjct: 293 KQAGDSAHCATCGSTDNLWICLICGNVGCGR-----YNSKHAIKHYEETLHCFAMDIRTQ 347

Query: 237 SLTADAADIYCY 248
            +   A D Y +
Sbjct: 348 RVWDYAGDNYVH 359

>KLLA0C03476g 314815..318573 weakly similar to sp|P39538
           Saccharomyces cerevisiae YJL197w UBP12 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 1252

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 77/203 (37%), Gaps = 55/203 (27%)

Query: 310 NGPEYGLGLLNLGNSCYLNSVLQVLLN-----------GGIRNWNLDGLGSFPTDVVYPR 358
           N P   +GL NLGN+CY+NS LQ LL+           G  R  N++       DV +  
Sbjct: 333 NAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAF 392

Query: 359 TNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKL 418
            +L   L     A +  QS +     P  FK  IG  +  F+   QQDS EF ++L D L
Sbjct: 393 GHLLYSLF----APSYGQSTF---YAPRNFKNTIGHYNSLFAGYGQQDSQEFLAFLLDGL 445

Query: 419 DREI-------FKNTTTNPND----------LFRFNIQDKIK------------------ 443
             ++       + N    PND          L   N+ D IK                  
Sbjct: 446 HEDLNRVIEKPYVNKPEFPNDGQIDDTDQIVLLAANMWDYIKKRNDSVIMDLFVGLYKST 505

Query: 444 --CDNCNKVKFMDQVSEVIQLPL 464
             C NCN V         + LPL
Sbjct: 506 LVCPNCNHVSITFDPYNDLTLPL 528

>YJL197W (UBP12) [2729] chr10 (63804..67568) Ubiquitin-specific
           protease, ubiquitin C-terminal hydrolase [3765 bp, 1254
           aa]
          Length = 1254

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 68/130 (52%), Gaps = 21/130 (16%)

Query: 317 GLLNLGNSCYLNSVLQVLLN-GGIRNWNL-DG----------LGSFPTDVVYPRTNLHCQ 364
           GL+NLGN+CY+NS LQ L++   +R++ L DG          LG +   V    ++L  +
Sbjct: 365 GLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLG-YHGYVARAFSDLVQK 423

Query: 365 LIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDK----LDR 420
           L + R ++  + + +P    P+ FK  IG  +  FS   QQDS EF ++L D     L+R
Sbjct: 424 LFQNRMSIMQRNAAFP----PSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNR 479

Query: 421 EIFKNTTTNP 430
            I K  T  P
Sbjct: 480 IIKKEYTEKP 489

>YDR069C (DOA4) [920] chr4 complement(584935..587715)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), involved in recycling ubiquitin from protein
           substrates targeted to the proteasome and the vacuole
           [2781 bp, 926 aa]
          Length = 926

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 113/294 (38%), Gaps = 70/294 (23%)

Query: 313 EYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQL----IKI 368
           ++ +GL NLGNSCY+N ++Q +L         +    F  D      N++ +L    I  
Sbjct: 559 DFAVGLENLGNSCYMNCIIQCILGTH------ELTQIFLDDSYAKHININSKLGSKGILA 612

Query: 369 RNAMTLQQSRYPE--------GIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDR 420
           +    L    Y E         I P  FK   G  +  F +  QQD  EF  +L D L  
Sbjct: 613 KYFARLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLHE 672

Query: 421 EIFKNTTTNP------------------------------------NDLFRFNIQDKIKC 444
           ++ +  +  P                                     DLF+     ++KC
Sbjct: 673 DLNQCGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKC 732

Query: 445 DNCNKVKFMDQVSEVIQLPLRKLDGEQNLI--DRLNDYFSGEKIE----YRCLTNKKINT 498
             C+      Q   V+ +P+ K +   N+   D   ++   E +E    + C   +K   
Sbjct: 733 KVCSHTSTTYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDEQWLCPHCEKRQP 792

Query: 499 ASKVPGFSSFPRTLIINPIRIE-LINWQPSKTSEQVVVPGVRDDALLDMSPFKA 551
           ++K    +  PR LI++  R + L+N    K ++ V+ P      LLD++PF A
Sbjct: 793 STKQLTITRLPRNLIVHLKRFDNLLN----KNNDFVIYP-----FLLDLTPFWA 837

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 3/45 (6%)

Query: 700 IASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEK 744
           I   KY+L  V CH G +++ GHY A++KK +  K+ W+ ++D K
Sbjct: 859 IPPFKYELYGVACHFG-TLYGGHYTAYVKKGL--KKGWLYFDDTK 900

>AFR627C [3819] [Homologous to ScYJL197W (UBP12) - SH]
           (1572372..1576235) [3864 bp, 1287 aa]
          Length = 1287

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 66/157 (42%), Gaps = 27/157 (17%)

Query: 316 LGLLNLGNSCYLNSVLQVLL-----------NGGIRNWNLDGLGSFPTDVVYPRTNLHCQ 364
           +GL NLGN+CY+NS LQ LL           NG  +  N++        + +   ++   
Sbjct: 346 IGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQA 405

Query: 365 LIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDRE--- 421
           L   R++     S       P  FK  IG  +  FS  +QQDS EF ++L D L  +   
Sbjct: 406 LFGKRHSAATSYS-------PRNFKNTIGHLNSMFSGYQQQDSQEFLAFLLDGLHEDLNR 458

Query: 422 ------IFKNTTTNPNDLFRFNIQDKIKCDNCNKVKF 452
                 + K   T+ +D   F +  K+  D   K K 
Sbjct: 459 IIEKPYVEKPELTSTDDTAEFKVIKKLADDTWGKHKL 495

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 7/66 (10%)

Query: 173 SNLEKREGGISQS-CNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHAL 231
           SN  + E G +QS C+ CG + NLW+CL CG++ CGR         HA++HYES+  H  
Sbjct: 254 SNARECEDGANQSHCDVCGSSENLWVCLICGHMGCGR-----YNSKHAIQHYESS-SHCF 307

Query: 232 AIKLGS 237
           A+ + +
Sbjct: 308 AMDIAT 313

>Kwal_26.8090
          Length = 520

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 9/60 (15%)

Query: 178 REGGISQSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGS 237
           R+G     C+ CG+  NLW+CL CGN+ CGR       + HA++H++ T  H  A+ + +
Sbjct: 280 RQGA---RCSTCGVNENLWICLICGNIGCGR-----YNFKHAVQHFKET-AHFFAMDVAT 330

>Scas_545.2*
          Length = 918

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 106/262 (40%), Gaps = 60/262 (22%)

Query: 313 EYGLGLLNLGNSCYLNSVLQVLL-----------NGGIRNWNLDG-LGSFPTDVVYPRTN 360
           ++ +GL N+GNSCYLN ++Q LL           N   R+ NL+  LGS      Y    
Sbjct: 556 DFIVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARL 615

Query: 361 LHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDR 420
           +H   +   +A    ++ Y   ++P  FK  +G  +  F +  QQD  EF  +L D L  
Sbjct: 616 IH---LMHNHANPKLKNNY---VRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHE 669

Query: 421 EIFKNTTTNP------------------------------------NDLFRFNIQDKIKC 444
           ++ +  +  P                                     DLF+     +++C
Sbjct: 670 DLNQCGSNPPLKELSSAAEKNREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLQC 729

Query: 445 DNCNKVKFMDQVSEVIQLPLRKLDG--EQNLIDRLNDYFSGEKI----EYRCLTNKKINT 498
           + C       Q   V+ +P+ ++    + N++D   D+   E +    ++ C T KK   
Sbjct: 730 EVCKHTSTTYQPFSVLSVPIPRVPKGVKVNILDCFKDFTKLELLDTDEQWLCPTCKKKQR 789

Query: 499 ASKVPGFSSFPRTLIINPIRIE 520
           ++K    +  PR LII+  R +
Sbjct: 790 STKKLTITRLPRNLIIHLKRFD 811

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 10/69 (14%)

Query: 674 DDDGELPEAEEWKDQSRKSFGIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEG 733
           D DG+LP     +D+  K   IP       KYKL  V  H G S++ GHY A++ K    
Sbjct: 836 DFDGKLPPG--VRDELPKRGQIPP-----FKYKLYGVASHFG-SLYGGHYTAYVDK--GP 885

Query: 734 KEQWVLYND 742
           K  W  ++D
Sbjct: 886 KHGWYYFDD 894

>Sklu_2425.8 YER098W, Contig c2425 12113-14377 reverse complement
          Length = 754

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 99/209 (47%), Gaps = 24/209 (11%)

Query: 333 VLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQQSRYPEGI-KPTTFKKV 391
            L+ G + N +       P+ +   + NL+  L  I  ++T  ++R+  G+  PT+F ++
Sbjct: 375 ALIKGPVLNIDHSLTDYLPSSI---KPNLYTSLRDIFESIT--ENRFLIGVVSPTSFVEI 429

Query: 392 IGGSHEEFSSGRQQDSLEFFSY----LSDKLDREIFKNTTTNPND-----LFRFNIQDKI 442
           +   +  FS+   QD+ EF ++    LSD L R+I  ++   PND     LF+  + ++ 
Sbjct: 430 LKRENVLFSTMMHQDAHEFLNFLLNELSDSLQRQISDDSIITPNDNFIDRLFKGTMTNQT 489

Query: 443 KCDNCNKVKFMDQVSEVIQLPLRKLDG--EQNLIDRLNDYFSGEKI----EYRCLTNKKI 496
           KC  C+ +   D+    +  P+ +++G  E ++ + L+D+   E +    ++ C     +
Sbjct: 490 KCLTCDNITSRDE--PFLDFPI-EVNGNCETDIQEMLSDFHQKEMLNGSNKFYCDKCCGL 546

Query: 497 NTASKVPGFSSFPRTLIINPIRIELINWQ 525
             A ++ G    P  L ++  R +    Q
Sbjct: 547 QEAERIVGLKQLPHILALHLKRFKYSETQ 575

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 289 QSLKWDFQMVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLN 336
           +S+   F ++ +    L    +G     G  N GN+CY NSVLQ L N
Sbjct: 119 ESVDHCFPVLSTHTTDLLPYGDGSNKVFGYENFGNTCYCNSVLQCLYN 166

>Kwal_33.13628
          Length = 1160

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 58/117 (49%), Gaps = 8/117 (6%)

Query: 312 PEYGLGLLNLGNSCYLNSVLQVLLN-GGIRNWNLDGLGSFPTDV-----VYPRTNLHCQL 365
           P   +GL NLGNSCY+NS LQ L++   +R++ L   G F  D+     +  +  +    
Sbjct: 294 PSGIVGLSNLGNSCYMNSALQCLVHIPELRDYFL--YGGFEQDINTSNPLGYQGQIAQAF 351

Query: 366 IKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREI 422
             +  ++   ++   +   P  FK +IG  +  F+   QQDS E  ++L D L  ++
Sbjct: 352 AALVKSLFDDKASALQAFSPRAFKSIIGHHNGMFAGFLQQDSQELLAFLLDGLHEDL 408

>Kwal_14.2008
          Length = 424

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 101/270 (37%), Gaps = 61/270 (22%)

Query: 308 LQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIR-------------NWNLDG-LGSFPTD 353
           ++ G    +GL+NLGNSCY+N ++Q LL  G R             + NL+  LGS    
Sbjct: 48  VKRGLNINVGLVNLGNSCYMNCIIQCLL--GTRELVQIFLDDSYKNHVNLNSRLGSKGVL 105

Query: 354 VVYPRTNLHCQLIKIRNAMTLQQSRYPE--GIKPTTFKKVIGGSHEEFSSGRQQDSLEFF 411
             Y    +H    +  +A   + +   E   ++P  FK   G  +  F +  QQD  EF 
Sbjct: 106 AKYFSQLIHNMQQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKTTSQQDCQEFC 165

Query: 412 SYLSDKLDREIFKNTTTNPN-------------------------------------DLF 434
            +L D L  ++      NP                                      DLF
Sbjct: 166 QFLLDGLHEDL-NQCGGNPALKELSEEAEAIREKLCMRIASSIEWERYLTTDFSVIVDLF 224

Query: 435 RFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEKIE----YRC 490
           +     ++ C  C +     Q   V+ +P+ +     NL+D   ++   E +E    + C
Sbjct: 225 QGQYASQLMCKVCGRTSTTYQPFSVLSVPVPR-GARCNLLDCFEEFTKIETLEKDEQWSC 283

Query: 491 LTNKKINTASKVPGFSSFPRTLIINPIRIE 520
              K    ++K    +  PR LII+  R +
Sbjct: 284 PRCKVKQPSTKKITITRLPRNLIIHLKRFD 313

>CAGL0L01639g 176107..179550 similar to sp|P39538 Saccharomyces
           cerevisiae YJL197w UBP12 ubiquitin C-terminal hydrolase,
           hypothetical start
          Length = 1147

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 58/120 (48%), Gaps = 20/120 (16%)

Query: 316 LGLLNLGNSCYLNSVLQVLLN----------GGI-RNWNLDGLGSFPTDVVYPRTNLHCQ 364
           +GL NLGN+CY+NS LQ L++          GG  +  NLD    +   V     NL   
Sbjct: 289 VGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGYNGTVATAFGNL--- 345

Query: 365 LIKIRNAMTLQ--QSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREI 422
              I+N  +    Q +Y +   P  FK  +G ++  F+   QQDS EF ++L D L  ++
Sbjct: 346 ---IQNLYSYHWNQQQY-QSYSPNRFKMTLGQANSMFAGYMQQDSQEFLAFLLDSLHEDL 401

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 6/52 (11%)

Query: 186 CNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGS 237
           C +CG T+NLW+CL CG++ CGR         HA+ HYE ++ H  A+ L +
Sbjct: 270 CLECGETNNLWICLICGHLGCGR-----YNSQHAICHYEQSN-HCFAMDLTT 315

>KLLA0E10252g 906675..909065 gi|10444512|gb|AAG17929.1|AF303215_1
           Kluyveromyces lactis deubiquitinating enzyme,
           hypothetical start
          Length = 796

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 57/132 (43%), Gaps = 16/132 (12%)

Query: 313 EYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAM 372
           ++ +GL+NLGNSCYLN ++Q LL  G    +   L +     V   + L  + +      
Sbjct: 429 DFAIGLVNLGNSCYLNCIIQCLL--GCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFS 486

Query: 373 TLQQSRYPEG--------------IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKL 418
            L Q  Y +G              + PT FK   G  +  F   +QQD  EF  +L D L
Sbjct: 487 QLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFKGKQQQDCQEFCQFLLDGL 546

Query: 419 DREIFKNTTTNP 430
             ++ +  T  P
Sbjct: 547 HEDLNQCGTNPP 558

>Kwal_26.9151
          Length = 454

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 75/380 (19%), Positives = 148/380 (38%), Gaps = 69/380 (18%)

Query: 188 DCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTADAADIYC 247
           +CG T   ++CL CG   C  +Q       H   H +   GH   +      +    ++C
Sbjct: 52  NCGST---FMCLQCGVCGCWNKQ-------HFALHSKKA-GHIFGV-----NSSNGLLFC 95

Query: 248 YSCDEDVKFTHNLQLQDILKFWEVEVPAKSKEKTLVELQVEQSLKWDFQMVDSQGKSLKH 307
           + C E V     L    + K W+                            D   KS   
Sbjct: 96  FKCVEYVTGNEMLTNSMLNKNWD----------------------------DISVKSSVP 127

Query: 308 LQNGPEYGLGLLNLGNSCYLNSVLQVLL-NGGIRNWNLDGLGSFPTDVVYPRTNLHCQLI 366
           L  G +   GL+N+G++C+++S++Q L+ N  +    ++ +     D+    +   C L 
Sbjct: 128 LAKGRDGLCGLVNMGSTCFMSSIIQTLVHNPYVLKTCMNQVHFSRCDIQDSASCFSCALD 187

Query: 367 KIRNAMTLQQSRYPEGIKPTTFKKVIGGS---HEEFSSGRQQDSLEFFSYLSDKLDREIF 423
           +I +      +      +   F  ++  S   +   +   QQD+ EF+ +  ++L  +  
Sbjct: 188 RIVSNFYGPAADASFTSQQKGFVDLLLCSWKINRNLAGYSQQDAHEFWQFFLNQLHADHV 247

Query: 424 KNT---TTNPNDL-------FRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNL 473
           + T   ++ P +        F+ +++  I C +C+    +     ++ L L ++  +  L
Sbjct: 248 RVTGKKSSKPEECNCISHSAFQGSLRSSILCTDCHDGSNIT-FDPMMDLSL-EIKNKNKL 305

Query: 474 IDRLNDYFSGEKI---EYRCLTNKKINTASKVPGFSSFPRTLIINPIRIE-LINWQPSKT 529
           +D L  +  GE +    +RC     +    K    +  P  L++   R E L+N    K 
Sbjct: 306 VDCLKSFHEGETLTDFNHRCPNCGSVQNPIKQMTIAKLPPVLVLQLKRFEHLMNGNSVKL 365

Query: 530 SEQVVVPGVRDDALLDMSPF 549
           +E++  P       L+M+PF
Sbjct: 366 NEKIAYP-----TYLNMAPF 380

>Kwal_34.16268
          Length = 449

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 19/157 (12%)

Query: 301 QGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTN 360
           +G  ++HL   P   +GL NLGN+CY+NS LQ L    I+    D + ++      P   
Sbjct: 48  EGAQMQHLSQTP---VGLKNLGNTCYMNSTLQALYQ--IKPLR-DEVLNYKVPREKPSEE 101

Query: 361 LHCQLI-KIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFS-----SG--RQQDSLEFFS 412
            H QL+ ++R      + +  E + P     ++   + +F+     SG  +QQD+ E F+
Sbjct: 102 QHHQLVSELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAEELFT 161

Query: 413 YLSDKLDREIFKNTTTNPNDLFRFNIQDKIKCDNCNK 449
            + + L R +F +        F+ N +  IK D  N+
Sbjct: 162 QIFNSL-RVVFGDNLVQK---FQINFETTIK-DTANE 193

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 683 EEWKDQSRKSF--GIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLY 740
           E+W  + RK F   +      S  Y L  VI H+G +  SGHY +FI+  V+ + +W  +
Sbjct: 356 EKWSQEYRKRFPSNLAQGENPSCVYNLIGVITHQGANSESGHYQSFIRDEVD-ENKWYRF 414

Query: 741 NDEKILLANDE 751
           ND+K+ +   E
Sbjct: 415 NDDKVSIIEKE 425

>AFR007W [3199] [Homologous to ScYDR069C (DOA4) - SH; ScYER144C
           (UBP5) - SH] complement(448632..451178) [2547 bp, 848
           aa]
          Length = 848

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 96/259 (37%), Gaps = 54/259 (20%)

Query: 314 YGLGLLNLGNSCYLNSVLQVL----------LNGGIRN-WNLDG-LGSFPTDVVYPRTNL 361
           + +GL+N GNSCY++ ++Q L          LN   +N  NL+  LGS      Y    +
Sbjct: 486 FSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLI 545

Query: 362 HCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDRE 421
           H Q+ +    +  +       + PT FK   G  +  F    QQD  EF  +L D L  +
Sbjct: 546 H-QMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFKDNTQQDCQEFCQFLLDGLHED 604

Query: 422 IFKNTTTNP------------------------------------NDLFRFNIQDKIKCD 445
           + +     P                                     DLF+     +++C 
Sbjct: 605 LNQCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQLQCK 664

Query: 446 NCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEKIE----YRCLTNKKINTASK 501
            C +     Q   V+ +P+        L D   ++   E +E    + C + KK   ++K
Sbjct: 665 VCQRTSTTYQPFSVLSVPVPS-TRTCTLTDCFTEFTKIETLEQEEQWSCPSCKKRQPSTK 723

Query: 502 VPGFSSFPRTLIINPIRIE 520
               +  PR LII+  R +
Sbjct: 724 KITITRLPRNLIIHLKRFD 742

>Scas_634.14
          Length = 1201

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 50/117 (42%), Gaps = 18/117 (15%)

Query: 317 GLLNLGNSCYLNSVLQ-----------VLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQL 365
           GL+NLGN+CY+NS LQ            L +G  +  N D    +   V         +L
Sbjct: 322 GLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVA----EAFSEL 377

Query: 366 IKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREI 422
           I+      L Q        P  FK  IG  +  FS   QQDS EF ++L D L  ++
Sbjct: 378 IRCLFGDKLVQF---SAYAPNHFKATIGHFNSMFSGYLQQDSQEFLAFLLDSLHEDL 431

>CAGL0K10494g 1022869..1024356 highly similar to sp|P43593
           Saccharomyces cerevisiae YFR010w UBP6 ubiquitin-specific
           protease, start by similarity
          Length = 495

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 678 ELPEAEEWKDQSRKSF--GIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKE 735
           E  E E W ++ +K F   + A    S+ Y L  VI H+G +  SGHY AFI+   + + 
Sbjct: 397 EESEREYWLNEFKKRFPSNLAAGENPSSVYDLIGVITHQGANSESGHYQAFIRDESD-EN 455

Query: 736 QWVLYNDEKI 745
           +W  +ND+K+
Sbjct: 456 KWYKFNDDKV 465

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 96/255 (37%), Gaps = 63/255 (24%)

Query: 316 LGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSF-----PTDVVYPRTN--LHCQLI-K 367
           LGL N+GN+CYLN+ LQ L          D L        P+ V     N  +H +++ +
Sbjct: 109 LGLQNMGNTCYLNATLQALFRA-------DELKDLILQYDPSKVTNSDANDEIHYKIVLE 161

Query: 368 IRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSG-------RQQDSLEFFSYLSDKLDR 420
           ++      + R  + + P      +   + +F+         +QQD+ E F+ L   L  
Sbjct: 162 LKRTFETLKKRSFKSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTV 221

Query: 421 EIFKNTTTNPNDL-FRFNIQD----------------KIKCDNCNKVKFMDQVSEVIQLP 463
            +F +   N   + FR  I+D                K++C       FM          
Sbjct: 222 -VFGDKFANQFQINFRATIKDTANEDDVTVREDESDMKLQCHISGTTNFM---------- 270

Query: 464 LRKLDGEQNLIDRLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRI--EL 521
                 +  LI+ LN     EKIE R       +T +     +  P+ L +  +R   + 
Sbjct: 271 ------KNGLIESLN-----EKIEKRSDITGLNSTYAVQKQITKLPKYLTVQYVRFFWKR 319

Query: 522 INWQPSKTSEQVVVP 536
            + + SK   +VV P
Sbjct: 320 SSGKKSKILRKVVFP 334

>KLLA0E20449g 1810593..1812686 weakly similar to sp|P39967
           Saccharomyces cerevisiae YER098w UBP9 ubiquitin
           carboxyl-terminal hydrolase, start by similarity
          Length = 697

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 71/153 (46%), Gaps = 17/153 (11%)

Query: 383 IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSY----LSDKLDREI------FKNTTTNPND 432
           + P+ F  ++   +  FSS   QD+ EF +Y    LSD L R++       ++  T   D
Sbjct: 379 VSPSNFVNILKQENILFSSSMHQDAHEFLNYLLNELSDTLKRDMELDTDKLESKPTFIED 438

Query: 433 LFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLR-KLDGEQNLIDRLNDYFSGEKI----E 487
           LF+ ++ +  KC  C+ +   D+    +  P+  + D E  + D LN+Y   E +    +
Sbjct: 439 LFKGSLCNSTKCFTCDTITARDE--PFLDFPIEIQEDEEIKIQDILNNYKHRELLTGANK 496

Query: 488 YRCLTNKKINTASKVPGFSSFPRTLIINPIRIE 520
           + C     +  A +  G  S P+TL I+  R +
Sbjct: 497 FYCDKCCGLQEAERTVGLKSLPKTLAIHLKRFK 529

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 20/74 (27%)

Query: 316 LGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVV-YPRTNLHCQLIKIRNAMTL 374
            G  N GN+CY NSVLQ L N          L  F T+++ YP  +    L++ R   ++
Sbjct: 115 FGYENFGNTCYCNSVLQCLYN----------LTEFRTEILKYPSRD---GLLRRRRKSSV 161

Query: 375 QQSRYPEGIKPTTF 388
                  G+KP  F
Sbjct: 162 V------GVKPRVF 169

>Scas_618.5
          Length = 493

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 678 ELPEAEEWKDQSRKSF--GIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKE 735
           E  E E W  + +K F   +      S+ Y L  +I H+G +  SGHY AFI+   + + 
Sbjct: 395 EQSEKEHWLSEFKKHFPPDLQPGENPSSVYNLVGIITHQGANSESGHYQAFIRDETD-EN 453

Query: 736 QWVLYNDEKILLANDE 751
           +W  +ND+K+ +   E
Sbjct: 454 KWYKFNDDKVSVVEKE 469

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query: 316 LGLLNLGNSCYLNSVLQVLLN-GGIRN--WNLDGLGSFPTDVVYPRTNLHCQLIKIRNAM 372
           +GL N+GN+CY+N+ LQ L     IR+   N D   + P D ++     H  +++++   
Sbjct: 107 IGLQNMGNTCYMNATLQALFRVDSIRDLILNYDPAKASPQDEMH-----HKIVLEMKRCF 161

Query: 373 TLQQSRYPEGIKPTTFKKVIGGSHEEFSSG-------RQQDSLEFFSYLSDKLD 419
              +++  + + P     V+   + +F+         +QQD+ E F+ L    D
Sbjct: 162 ENLENKSYKSVMPLMLLNVLRKCYPQFAERDAQGGFYKQQDAEELFTQLFHTFD 215

>YFR010W (UBP6) [1690] chr6 (165060..166559) Ubiquitin C-terminal
           hydrolase associated with the 26S proteaseome, involved
           in ubiquitin turnover [1500 bp, 499 aa]
          Length = 499

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 681 EAEEWKDQSRKSF--GIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWV 738
           E ++W ++ +K F   +      S  Y L  VI H+G +  SGHY AFI+  ++ + +W 
Sbjct: 404 EKDQWLEEYKKHFPPNLEKGENPSCVYNLIGVITHQGANSESGHYQAFIRDELD-ENKWY 462

Query: 739 LYNDEKILLANDE 751
            +ND+K+ +   E
Sbjct: 463 KFNDDKVSVVEKE 475

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 105/269 (39%), Gaps = 69/269 (25%)

Query: 306 KHLQNGPEYGLGLLNLGNSCYLNSVLQVL-----LNGGIRNWNLDGLGSFPTDVVYPRTN 360
           + +Q   +  +G  N+GN+CYLN+ LQ L     L   I N+N       P+  V   +N
Sbjct: 99  QQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNYN-------PSQGV---SN 148

Query: 361 LHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIG--------GSHEEF----SSG---RQQ 405
              Q  +I   + ++  R  E ++  +FK V+           + +F    S G   +QQ
Sbjct: 149 SGAQDEEIHKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQ 208

Query: 406 DSLEFFSYL--------SDKLDREI---FKNT---TTNPNDL-FRFNIQD-KIKCDNCNK 449
           D+ E F+ L         DK   +    FK T   T N ND+  + N  D K++C     
Sbjct: 209 DAEELFTQLFHSMSIVFGDKFSEDFRIQFKTTIKDTANDNDITVKENESDSKLQCHISGT 268

Query: 450 VKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEKIEYRCLTNKKINTASKVPGFSSFP 509
             FM                   L++ LN     EKIE R       +  S     S  P
Sbjct: 269 TNFM----------------RNGLLEGLN-----EKIEKRSDLTGANSIYSVEKKISRLP 307

Query: 510 RTLIINPIRI--ELINWQPSKTSEQVVVP 536
           + L +  +R   +    + SK   +VV P
Sbjct: 308 KFLTVQYVRFFWKRSTNKKSKILRKVVFP 336

>KLLA0C06974g complement(604344..605684) similar to sp|P50102
           Saccharomyces cerevisiae YMR223w UBP8, start by
           similarity
          Length = 446

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 78/388 (20%), Positives = 148/388 (38%), Gaps = 96/388 (24%)

Query: 183 SQSCNDCGLTS--NLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTA 240
           +  C DCG  S  + ++CL CG   C          +H L H +   GH   +      +
Sbjct: 42  TMRCMDCGEISCGSTFICLQCGFCGCWNN-------NHFLDHSQKL-GHIFGVN-----S 88

Query: 241 DAADIYCYSCDEDVKFTHNLQLQDILKFWEVEVPAKSKEKTLVELQVEQSLKWDFQMVDS 300
               ++C+ C             D +     E+PA   +  + + ++  SL  D      
Sbjct: 89  SNGLVFCFRCG------------DFMADLVAEIPASQWDTVMEKTELPASLHRD------ 130

Query: 301 QGKSLKHLQNGPEYGL-GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRT 359
                         GL GL+N+G++C+++S++Q +++             F  D++   +
Sbjct: 131 --------------GLQGLVNMGSTCFMSSIIQTIIHNPY----------FVEDLL---S 163

Query: 360 NLHCQLIKIRNAMTLQQSRYPE------GIKPTT---------FKKVIGGS---HEEFSS 401
           + HC    I++          E      G  P T         F  ++  S   +     
Sbjct: 164 HKHCNNCDIKSGTKCVSCALDEIACDFYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVG 223

Query: 402 GRQQDSLEFFSYLSDKL--DREIFKNTTTNPN------DLFRFNIQDKIKCDNCNKVKFM 453
             QQD+ E++ +L ++L  D      ++  P+       +F+  +++ ++C  C   K  
Sbjct: 224 SSQQDAHEYWQFLLNQLHTDHARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGFSK-- 281

Query: 454 DQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEK----IEYRCLTNKKINTASKVPGFSSFP 509
             +  ++ L L ++     L D L D+F  E+      Y C + K+     K       P
Sbjct: 282 TTIDPIMDLSL-EIKNNPKLEDCL-DHFQREETLTDFHYECQSCKQNQGVVKQLTLHKAP 339

Query: 510 RTLIINPIRIE-LINWQPSKTSEQVVVP 536
             L+I   R E  +N Q +K +++V  P
Sbjct: 340 NVLVIQLKRFEHQLNGQSAKLNDRVQFP 367

>YMR223W (UBP8) [4179] chr13 (716714..718129) Putative
           ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [1416 bp, 471 aa]
          Length = 471

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 88/427 (20%), Positives = 167/427 (39%), Gaps = 101/427 (23%)

Query: 164 CPHIQTFDLSNLEKREGGISQSCN-------------------DCGLTSNL-----WLCL 199
           CPHIQ   +   EK + G+ ++CN                    CG    +     ++CL
Sbjct: 4   CPHIQ--QVFQNEKSKDGVLKTCNAARYILNHSVPKEKFLNTMKCGTCHEINSGATFMCL 61

Query: 200 HCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTADAADIYCYSCDEDVKFTHN 259
            CG   C         +SH L H +   GH   I      ++   ++C+ C++ +     
Sbjct: 62  QCGFCGCWN-------HSHFLSHSKQI-GHIFGI-----NSNNGLLFCFKCEDYIGNIDL 108

Query: 260 LQLQDILKFWEVEVPAKSKEKTLVELQVEQSLKWDFQMVDSQGKSLKHLQNGPEYGLGLL 319
           +    + K+W+ +V  K+                   MV S  +     ++G     GL+
Sbjct: 109 INDAILAKYWD-DVCTKT-------------------MVPSMER-----RDGLS---GLI 140

Query: 320 NLGNSCYLNSVLQVLLNGG--IRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRN----AMT 373
           N+G++C+++S+LQ L++    IR+ ++  + S    V  P     C L KI +    A+ 
Sbjct: 141 NMGSTCFMSSILQCLIHNPYFIRH-SMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALN 199

Query: 374 LQQ--SRYPEGIKPTTFKKVIGGS---HEEFSSGRQQDSLEFFSYLSDKLDREIF----- 423
            +Q  S      + T F  ++  +   ++  +   QQD+ EF+ ++ +++ +        
Sbjct: 200 TKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPN 259

Query: 424 ---------KNTTTNPNDLFRFNIQDKIKCDNC-NKVKFMDQVSEVIQLPLRKLDGEQNL 473
                    K      + +F  +++  I C  C N  K    +   + L L   D ++ L
Sbjct: 260 AKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSK--TTIDPFLDLSLDIKD-KKKL 316

Query: 474 IDRLNDYFSGEKIE---YRCLTNKKINTASKVPGFSSFPRTLIINPIRIE-LINWQPSKT 529
            + L+ +   E+++   Y C        A K  G    P  L++   R E L+N    K 
Sbjct: 317 YECLDSFHKKEQLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKL 376

Query: 530 SEQVVVP 536
            + +  P
Sbjct: 377 DDFIEFP 383

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 4/41 (9%)

Query: 705 YKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           Y+L  ++ HKG +V+ GHY+AF K  + G  QW  +ND  +
Sbjct: 411 YELIGIVSHKG-TVNEGHYIAFCK--ISGG-QWFKFNDSMV 447

>CAGL0I06765g 655806..658469 similar to sp|P32571 Saccharomyces
           cerevisiae YDR069c DOA4 ubiquitin-specific protease,
           hypothetical start
          Length = 887

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 111/291 (38%), Gaps = 66/291 (22%)

Query: 314 YGLGLLNLGNSCYLNSVLQ-VLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAM 372
           + +GL N+GNSCY+N ++Q +     +    L+G  +     +  ++ L  + +   N  
Sbjct: 523 FTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYA---KHINKQSKLGSKGVLSHNFA 579

Query: 373 TLQQSRYPE-----------GIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDRE 421
            L +  Y E            +K   FK      +  F    QQD LEF  +L D L  +
Sbjct: 580 KLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDASQQDCLEFCQFLLDGLHED 639

Query: 422 IFKNTTTNP------------------------------------NDLFRFNIQDKIKCD 445
           + +     P                                     DLF+     +++C 
Sbjct: 640 LNQCGANPPLKELSPEAEKMRENLSLRVASSIEWERYLTTDFSIIVDLFQGQYASQLRCK 699

Query: 446 NCNKVKFMDQVSEVIQLPLRKLDGEQ-NLIDRLNDYFSGEKIE----YRCLTNKKINTAS 500
            CN+     Q   V+ +P+    G+   L+D   ++   E +E    + C + KK   ++
Sbjct: 700 VCNRTSTTYQAFSVLSVPVP--SGKSCGLLDCFIEFTKTENLEVDEQWFCPSCKKKQPST 757

Query: 501 KVPGFSSFPRTLIINPIRIELINWQPSKTSEQVVVPGVRDDALLDMSPFKA 551
           K    +  PR LII+  R +      +  ++  +   VR   +LD++PF A
Sbjct: 758 KKLTITRLPRNLIIHLKRFD------NMMNKNNIF--VRYPQILDLTPFWA 800

>KLLA0A10791g
           join(complement(935718..935733),
           complement(934135..935573)) similar to sp|P43593
           Saccharomyces cerevisiae YFR010w UBP6 ubiquitin-specific
           protease singleton, start by similarity
          Length = 484

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 316 LGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQL-IKIRNAMTL 374
           +GL N+GN+CY N+ LQ L       + +  L         P  +LH QL I++RN    
Sbjct: 106 MGLRNMGNTCYFNASLQAL-------YRIKPLREKVLAYNEPNPDLHGQLVIQLRNCFNA 158

Query: 375 QQSRYPEGIKPTTFKKVIGGSHEEF-----SSG--RQQDSLEFFSYLSDKLD 419
              R  +   P     V+   + +F     S+G  +QQD+ E F+ L   +D
Sbjct: 159 FAQRKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLLHTID 210

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 702 SAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDE 751
           S+ Y L  V+ H+G +  SGHY AF++   + + +W  YND+K+ +   E
Sbjct: 412 SSVYNLIGVVTHQGANSDSGHYQAFVRDDAD-ENKWYKYNDDKVYVVTRE 460

>KLLA0D08459g complement(718046..720298) some similarities with
           sp|P53874 Saccharomyces cerevisiae YNL186w UBP10
           derepression of telomeric silencing, hypothetical start
          Length = 750

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 104/265 (39%), Gaps = 45/265 (16%)

Query: 317 GLLNLGNSCYLNSVLQVLLN-GGIRNWNLDGL-GSFPTDVVYPRTNLHCQLIKIRNAMTL 374
           GLLN G +CY N+ +Q +++   I+++    L G+F   V   ++N    L+     M +
Sbjct: 363 GLLNHGVTCYTNAAVQAMVHIPAIQHYLFQLLRGNFKDTV---KSNCVSMLL-AETTMRM 418

Query: 375 QQSRYPEG--IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREIF----KNTTT 428
             S   +   I P      +   +   S+  Q+DS E+F  L  +L  +      K T +
Sbjct: 419 WSSDSTKNTYINPDKLINALEDINCMMSAWNQEDSHEYFMSLMSRLQEDSVPKGHKMTES 478

Query: 429 NPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLD---------GEQNLIDR--- 476
              D+F   +Q  +KC NC ++   +Q    + L L+            G+ N ID    
Sbjct: 479 IIYDVFGGLLQQSVKCSNCGEISTTEQPIYDLSLHLKGRKTTDQDQNSVGQDNSIDNSVD 538

Query: 477 --------------LNDYFSGEKIE-------YRCLTNKKINTASKVPGFSSFPRTLIIN 515
                         + D+F+ E I+       Y C   KK+  A K       P TL+++
Sbjct: 539 QQQSSKRRFSIEKSIRDFFNPELIKRVDNKEGYTCEKCKKVTNALKSNKIIRAPETLVVH 598

Query: 516 PIRIELINWQPSKTSEQVVVPGVRD 540
             +        SK  + V  P   D
Sbjct: 599 LKKFRFNGTSSSKMKQAVSYPMFLD 623

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 704 KYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           +Y+L +V+ H+G S+ SGHY+A  K   +    W  Y+DE I
Sbjct: 638 RYQLISVVVHEGRSLSSGHYIAHCK---QPDGSWATYDDEYI 676

>ABL145W [447] [Homologous to ScYNL186W (UBP10) - SH]
           complement(124841..127090) [2250 bp, 749 aa]
          Length = 749

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 12/148 (8%)

Query: 317 GLLNLGNSCYLNSVLQVLLN-GGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375
           GLLN G +CY N+ +Q +L+   ++++  D       DV+ P +         +   +L+
Sbjct: 352 GLLNHGVTCYQNAAVQAMLHIPALQHYLFDIAQGKYKDVISPSSVSQVLAETSKRMWSLE 411

Query: 376 QSRYPEG-IKPTTFKKVIGGSHE---EFSSGRQQDSLEFFSYLSDKLDREIF----KNTT 427
             +     I P   KK+IG   +     S   Q+DS E+F  L  +L  +      K T 
Sbjct: 412 NGKSKASYINP---KKLIGRLEDINCMMSVWNQEDSHEYFMSLISRLQEDSVPRGHKMTE 468

Query: 428 TNPNDLFRFNIQDKIKCDNCNKVKFMDQ 455
           +   D+F   +Q ++KC +C  V   +Q
Sbjct: 469 SLIYDIFGGLLQQRVKCKSCGSVSITEQ 496

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 693 FGIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           + + A+     KY+L +V+ H+G S+ SGHY+A  K   +    W  Y+DE I
Sbjct: 626 YCVEAAKCLPVKYQLISVVVHEGRSLSSGHYIAHCK---QPDGTWATYDDEYI 675

>Scas_11.1*
          Length = 88

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 702 SAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDE 751
           S  Y L  VI H+G +  SGHY AFI+  ++ + +W  +ND+K+ +   E
Sbjct: 16  SCVYDLIGVITHQGANSESGHYQAFIRDEMD-ENKWYKFNDDKVSVIEKE 64

>Scas_609.9
          Length = 729

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query: 698 SSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           SSIA  KY+LT V+ H G S   GHYV+  K    G   W+L++DE +
Sbjct: 582 SSIA-KKYELTGVVIHMGGSPQHGHYVSLCKNDKFG---WLLFDDETV 625

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 72/152 (47%), Gaps = 23/152 (15%)

Query: 383 IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREIFKNTTTNPN----------- 431
           + P  F KV+   +  F+S  QQD+ EF ++L ++L  E  +N  ++P+           
Sbjct: 401 VSPVEFVKVLKKENILFNSMMQQDAHEFLNFLLNELS-EYLQNHISHPSNKPTDIPFKNY 459

Query: 432 --DLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQN--LIDRLNDYFSGEKI- 486
             DLF+  + ++IKC  C+ +   D+    +  P+  + G++N  + D L  Y + E + 
Sbjct: 460 VIDLFQGVLTNRIKCLTCDNITSRDE--PFLDFPI-GVKGDENIDIQDVLRCYHTREMLN 516

Query: 487 ---EYRCLTNKKINTASKVPGFSSFPRTLIIN 515
              ++ C     +  A ++ G    P TL ++
Sbjct: 517 GSNKFYCSQCCGLQEAERIVGLKQLPHTLALH 548

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 14/21 (66%)

Query: 316 LGLLNLGNSCYLNSVLQVLLN 336
            G  N GN+CY NSVLQ L N
Sbjct: 137 FGYENFGNTCYCNSVLQCLYN 157

>Kwal_33.14430
          Length = 511

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 105/263 (39%), Gaps = 47/263 (17%)

Query: 317 GLLNLGNSCYLNSVLQVLLN-GGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375
           GLLN G +CY N+ +Q L++   I+++  D L       + P++     L +    M   
Sbjct: 125 GLLNHGVTCYTNAAVQALVHIPAIQHYLFDVLRGEYKSTIAPQSVTQV-LAETTKRMWSN 183

Query: 376 QSRYPEGIKPTTFKKVIGGSHE---EFSSGRQQDSLEFFSYLSDKLDREIF----KNTTT 428
           +S   + I P   KK+IG   +     S  +Q+DS E+F  L  +L  +      K T +
Sbjct: 184 ESSKNQFINP---KKLIGRLDDINCMMSEWQQEDSHEYFMSLISRLQEDSVPRGHKLTES 240

Query: 429 NPNDLFRFNIQDKIKCDNCNKVKFMDQ-----------------------VSEVIQLPLR 465
              D+F   ++ ++ C +C +V   +Q                        SE  + P R
Sbjct: 241 ILYDIFGGLLRQEVTCKSCGEVSKTEQPIYDLSLHLKGKKNSSQGESAKNSSEYEEEPQR 300

Query: 466 KLDGEQNLIDRLNDYFSGEKIE--------YRCLTNKKINTASKVPGFSSFPRTLIINPI 517
           +   E++    + D+F+ E I+        Y C    K   ASK       P TL+++  
Sbjct: 301 RFSIEKS----IRDFFNPELIKADKATKEGYVCEKCHKTTNASKHNFLLRAPETLLVHLK 356

Query: 518 RIELINWQPSKTSEQVVVPGVRD 540
           +        SK  + V  P   D
Sbjct: 357 KFRFNGTSSSKLKQAVSYPMFLD 379

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 697 ASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           +++    KY+L +V+ H+G S+ SGHY+A  K   +    W  Y+DE I
Sbjct: 387 SATALPVKYQLISVVVHEGRSLSSGHYIAHCK---QPDGSWSTYDDEYI 432

>AFR296C [3488] [Homologous to ScYIL156W (UBP7) - SH; ScYKR098C
            (UBP11) - SH] (972525..976034) [3510 bp, 1169 aa]
          Length = 1169

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 6/58 (10%)

Query: 703  AKYKLTAVICHKGNSVHSGHYVAFIKK-----VVEGKEQWVLYNDEKILLANDEPNFE 755
            AKY+L + I H G  + SGHY + + K     + EGK++W  ++DE + L  +  N++
Sbjct: 1093 AKYRLYSTINHFGTLI-SGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYD 1149

>YIL156W (UBP7) [2521] chr9 (48091..51306) Putative
           ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase) [3216 bp, 1071 aa]
          Length = 1071

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 317 GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYP-RTNLHCQLIKIRNAMTLQ 375
           GL NLGN+CY+NS++Q L     + +    + S     + P R+N      K+ N++++ 
Sbjct: 610 GLRNLGNTCYINSMIQCLF--AAKTFRTLFISSKYKSYLQPIRSNGSHYSPKLSNSLSML 667

Query: 376 QSR-YPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREI 422
            ++ Y  G   + PT F KVI     +      QQD+ EF   L D+L  E+
Sbjct: 668 FNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDEL 719

>YER098W (UBP9) [1530] chr5 (355462..357726) Ubiquitin C-terminal
           hydrolase, has similarity to Ubp13p [2265 bp, 754 aa]
          Length = 754

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 70/164 (42%), Gaps = 21/164 (12%)

Query: 383 IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREIFKNT---------TTNPN-- 431
           + PT F K++   +  F++  QQD+ EF ++L +     I +N          T N N  
Sbjct: 412 VSPTEFVKILKKENVLFNTMMQQDAHEFLNFLLNDFSEYIQRNNPRMRFGPQKTDNSNDN 471

Query: 432 ---DLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLR-KLDGEQNLIDRLNDYFSGEKI- 486
              DLF+  + ++IKC  C+ +   D+    +  P+  + D E ++   L  Y   E + 
Sbjct: 472 FITDLFKGTLTNRIKCLTCDNITSRDE--PFLDFPIEVQGDEETDIQKMLKSYHQREMLN 529

Query: 487 ---EYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQPS 527
              ++ C     +  A ++ G    P  L ++  R +    Q S
Sbjct: 530 GVNKFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSEEQKS 573

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 704 KYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           KY+L+ V+ H G+    GHYV   +    G   W+LY+DE +
Sbjct: 600 KYELSGVVIHMGSGPQHGHYVCICRNEKFG---WLLYDDETV 638

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 310 NGPEYGLGLLNLGNSCYLNSVLQVLLN 336
           +G     G  N GN+CY NSVLQ L N
Sbjct: 128 DGSNKVFGYENFGNTCYCNSVLQCLYN 154

>YNL186W (UBP10) [4415] chr14 (289498..291876) Ubiquitin C-terminal
           hydrolase, involved in telomeric silencing [2379 bp, 792
           aa]
          Length = 792

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 8/55 (14%)

Query: 704 KYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLAND-----EPN 753
           KY+L +V+ H+G S+ SGHY+A  K   +    W  Y+DE I + ++     EPN
Sbjct: 673 KYQLLSVVVHEGRSLSSGHYIAHCK---QPDGSWATYDDEYINIISERDVLKEPN 724

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 74/172 (43%), Gaps = 17/172 (9%)

Query: 317 GLLNLGNSCYLNSVLQVLLN-GGIRNWNLDGL-GSFPTDVVYPRTNLHCQLIKIRNAMTL 374
           GLLN G +CY N+ +Q +L+   I+++  D L G +  D    + ++   L +    M L
Sbjct: 363 GLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILMGKY--DSTISKNSVSYTLAETSKKMWL 420

Query: 375 QQSRYPEG------IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREIF----K 424
             S+ P        I P      +   +   S  +Q+DS E+F  L  +L  +      K
Sbjct: 421 PVSKNPRKNVSASYINPKHLISRLDDINCMMSEWQQEDSHEYFMSLMSRLQEDSVPKGHK 480

Query: 425 NTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPL---RKLDGEQNL 473
              +   D+F   ++  + C +C  +   +Q    + L L   +KLD   +L
Sbjct: 481 LIESIIYDIFGGLLKQIVTCKSCGSISKTEQPFYDLSLHLKGKKKLDPNSDL 532

>Scas_623.2*
          Length = 795

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 57/128 (44%), Gaps = 25/128 (19%)

Query: 312 PEYGLGLLNLGNSCYLNSVLQVLL-----------NGGIRNWNLDG-LGSFPTDVVYPR- 358
           P   +GL N+ NSCY+N ++Q LL           N  +++ N++  LGS    V+    
Sbjct: 425 PTIIIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGS--KGVIMKHF 482

Query: 359 ----TNLHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYL 414
                ++H Q +K   ++      YP  +K   FK         +S  +QQD  EF  +L
Sbjct: 483 AKLIQDMHSQQVKTGRSLF----SYP--VKTIDFKNACASVSSIYSGSQQQDCQEFCEFL 536

Query: 415 SDKLDREI 422
            D L  ++
Sbjct: 537 LDGLHEDL 544

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 674 DDDGELPEAEEWKDQSRKSFGIPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKK 729
           D +GELP           S       +   KY+L AV CH G ++ SGHY A++ K
Sbjct: 709 DFNGELPLG------MTNSLLTKGGQVGPFKYQLNAVACHMG-TLGSGHYTAYVNK 757

>CAGL0J11352g complement(1101349..1103664) similar to sp|P53874
           Saccharomyces cerevisiae YNL186w UBP10, start by
           similarity
          Length = 771

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 703 AKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
            KY+L +V+ H+G S+ SGHY+A  K+  +G   W  Y+DE I
Sbjct: 660 VKYELLSVVVHEGRSLSSGHYIAHCKQ-PDG--SWATYDDEYI 699

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 56/287 (19%), Positives = 107/287 (37%), Gaps = 60/287 (20%)

Query: 311 GPEYGL----GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLI 366
           GP Y      GLLN G +CY N+ +Q LL+       +  +  +  D++  + +      
Sbjct: 376 GPTYSKLKPKGLLNHGVTCYTNAAVQALLH-------IPAMQHYLNDILAGKYSSTISSN 428

Query: 367 KIRNAMTLQQSR--YPEG-------IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDK 417
            + + +     R  + +G       I P      +   +   S  +Q+DS E+F  +  +
Sbjct: 429 SVSHVLAETSRRMWHNDGKKSGNSYINPKKLIARLDDINCMMSEWQQEDSHEYFMSIMSR 488

Query: 418 LDREIF----KNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNL 473
           L  +      K T +   D+F  +++  + C +C +V   +Q    + L L+    ++N 
Sbjct: 489 LQEDSVPKGHKMTESIIYDIFGGSLKQTVTCKSCGEVSTTEQPFYDLSLHLKGKKTDENT 548

Query: 474 IDR------------------------LNDYFSGEKIE-------YRCLTNKKINTASKV 502
           +++                        + D+F+ E I+       Y C    K   A K 
Sbjct: 549 VNQEKSSSQSETKDSDSQTSRYSIEKSIRDFFNPELIKVDKEKKGYVCEKCHKTTNALKR 608

Query: 503 PGFSSFPRTLIINPIRIELINWQPSKTSEQVVVPGVRDDALLDMSPF 549
                 P TL+++  +        SK  + V  P       LDM+ +
Sbjct: 609 NSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYP-----MFLDMTEY 650

>YER144C (UBP5) [1573] chr5 complement(457801..460218)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), homologous to Doa4p and human Tre-2 [2418
           bp, 805 aa]
          Length = 805

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 52/260 (20%), Positives = 95/260 (36%), Gaps = 62/260 (23%)

Query: 316 LGLLNLGNSCYLNSVLQVLL-----------NGGIRNWNLDG----LGSFPTDVVYPRTN 360
           +GL N+GN CY+N +LQ L+           N  +   N D      G    +      N
Sbjct: 446 VGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVNN 505

Query: 361 LHCQLIKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDR 420
           +H      R+      +     ++   FKK+ G  +  +S   QQD  EF  +L D L  
Sbjct: 506 MH------RHGAFTPPNVRTIPVQTIQFKKICGHINPMYSDSMQQDCQEFCQFLLDGLHE 559

Query: 421 EIFKNTT------------------------------------TNPNDLFRFNIQDKIKC 444
           ++ +N +                                    +   DLF+     +++C
Sbjct: 560 DLNQNGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLTDFSAIIDLFQGQYASRLQC 619

Query: 445 DNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEKI----EYRCLTNKKINTAS 500
             C       Q   V+ +P+ ++    N++D   ++   E++    ++ C    K   ++
Sbjct: 620 QVCEHTSTTYQTFSVLSVPVPRVK-TCNILDCFREFTKCERLGVDEQWSCPKCLKKQPST 678

Query: 501 KVPGFSSFPRTLIINPIRIE 520
           K    +  P+ LIIN  R +
Sbjct: 679 KQLKITRLPKKLIINLKRFD 698

>AGL357W [3955] [Homologous to ScYMR304W (UBP15) - SH]
           complement(33383..36883) [3501 bp, 1166 aa]
          Length = 1166

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 695 IPASSIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNF 754
           +   S A+AKY L  V+ H G+ + +GHY A IK  +E  + W  ++D+K+     +  F
Sbjct: 417 VQEDSPANAKYNLHGVLVHTGD-ISTGHYYAMIKPGLE--DAWYRFDDDKVWRVTKKQVF 473

Query: 755 E 755
           E
Sbjct: 474 E 474

>Scas_655.4
          Length = 875

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 703 AKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
            KY+L +V+ H+G S+ SGHY+A  +   +    W  Y+DE I
Sbjct: 689 VKYELLSVVVHEGRSLSSGHYIAHCR---QPDGSWATYDDEYI 728

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 70/157 (44%), Gaps = 13/157 (8%)

Query: 311 GPEYG----LGLLNLGNSCYLNSVLQVLLN-GGIRNWNLDGLGSFPTDVVYPRTNLHCQL 365
           GPE+      GLLN G +CY N+ +Q +L+   I+++  D L     + + P++ +   L
Sbjct: 397 GPEFANRKPKGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRGKYKETISPKS-VSVML 455

Query: 366 IKIRNAMTLQQSRYPEGIKPTTFKKVIGGSHE---EFSSGRQQDSLEFFSYLSDKLDREI 422
            +    M   Q +  + +     KK+I          S  +Q+DS E+F  L  +L  + 
Sbjct: 456 AETSLRMWALQDKKKKNLGYINPKKLIASLETINCMMSEWQQEDSHEYFMSLMSRLQEDS 515

Query: 423 F----KNTTTNPNDLFRFNIQDKIKCDNCNKVKFMDQ 455
                K T +   D+F   ++  + C +C  V   +Q
Sbjct: 516 VPPGHKMTESMIYDIFGGLLKQIVTCKSCGGVSTTEQ 552

>Sklu_1544.2 YMR223W, Contig c1544 592-1956 reverse complement
          Length = 454

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 53/254 (20%), Positives = 105/254 (41%), Gaps = 25/254 (9%)

Query: 317 GLLNLGNSCYLNSVLQVLL-NGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375
           GL+N+G++C+++S++Q L+ N  I   ++D L S   D+    + + C + +I +     
Sbjct: 137 GLVNMGSTCFMSSIIQTLIHNPYILKHSMDQLHSTTCDLQNSSSCMSCAVDQIISDFYGA 196

Query: 376 QSRYPEGIKPTTFKKVIGGS---HEEFSSGRQQDSLEFFSYLSDKLDREIFKNTTTNP-- 430
                       F  ++  S   ++  +   QQD+ EF+ +L ++L  +  + T      
Sbjct: 197 SKSETSETNQQGFVNLLSCSWRKNKNLAGYSQQDAHEFWQFLLNQLHNDHLRATNQKASL 256

Query: 431 -NDL-------FRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFS 482
            ND        F+  ++  I C  C   +    +  ++ L L  +  +  L + L+++  
Sbjct: 257 KNDCNCISHRSFQGFLKSSIVCPECQNDR-KTTIDLMMDLSL-DIKNKSTLHECLDNFHK 314

Query: 483 GEKI---EYRCLTNKKINTASKVPGFSSFPRTLIINPIRIE-LINWQPSKTSEQVVVPGV 538
            E++    Y C        A +    +  P  L++   R E  IN    K +  +  P  
Sbjct: 315 KEQLTDFNYHCEKCNTKQNAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFP-- 372

Query: 539 RDDALLDMSPFKAT 552
                LDMS +  T
Sbjct: 373 ---TYLDMSKYCQT 383

>Scas_715.2
          Length = 717

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 3/44 (6%)

Query: 702 SAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           + KY+L+ ++ H G+    GHYVA  K    G   W+ Y+DE +
Sbjct: 562 TIKYELSGIVIHVGDGPQMGHYVALCKTEKYG---WLFYDDETV 602

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 11/59 (18%)

Query: 310 NGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVV-YPRTNLHCQLIK 367
           +G     G  N GN+CY NSVLQ L N          L  F  +++ YP  NL  Q ++
Sbjct: 120 DGSNKVFGYENFGNTCYCNSVLQCLYN----------LPEFRLNILQYPERNLMDQRVR 168

>AEL029W [2477] [Homologous to ScYFR010W (UBP6) - SH]
           complement(580062..581402) [1341 bp, 446 aa]
          Length = 446

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 705 YKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           Y L  VI H+G +  SGHY AF++   +  ++W  +ND+K+
Sbjct: 377 YDLIGVITHQGANSESGHYQAFMRDEFD-DDKWYKFNDDKV 416

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 11/108 (10%)

Query: 316 LGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNL-HCQLIK-IRNAMT 373
           +G++N+GN+CY+N+ LQ L   GI       L            +L H QLI+ I+    
Sbjct: 60  MGIVNMGNTCYMNATLQGLY--GIVPLREQILAFDDKKATAEGMDLYHVQLIREIQATFR 117

Query: 374 LQQSRYPEGIKPTTFKKVIGGSHEEFSSG-------RQQDSLEFFSYL 414
             + +  E I P    +++     +FS         +QQD+ E F+ L
Sbjct: 118 KLRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQL 165

>Scas_464.3
          Length = 1211

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 702 SAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFED 756
           S KY L  V+ H G+ + +GHY A IK   + ++QW  ++DEK+     +  FE+
Sbjct: 441 SCKYTLHGVLVHTGD-ISTGHYYAMIKP--DLQDQWYRFDDEKVWKVTKKQVFEE 492

>AGR370W [4681] [Homologous to ScYER098W (UBP9) - SH; ScYBL067C
           (UBP13) - SH] complement(1416093..1418315) [2223 bp, 740
           aa]
          Length = 740

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 705 YKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           Y+L  ++ H G     GHYVA  K  + G   W+LY+DE +
Sbjct: 592 YELNGIVIHMGGGPQHGHYVAICKHELFG---WLLYDDETV 629

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 54/112 (48%), Gaps = 9/112 (8%)

Query: 383 IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSY----LSDKLDREIFKNTTTNPND----LF 434
           + P+ F  V+   +  F+S   QD+ EF ++    LSD L  ++ +    +P +    LF
Sbjct: 409 VSPSHFVSVLRKENVLFNSMMHQDAHEFLNFLMNALSDSLQLQLQRLPDKSPENFIHTLF 468

Query: 435 RFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEKI 486
           +  + + IKC  C+ +   ++      +P+ + D E N+ D L D+   E +
Sbjct: 469 QGTMNNSIKCLTCDNITSNEEPFFDFAIPVSE-DEELNVQDILRDFHQREML 519

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 15/21 (71%)

Query: 316 LGLLNLGNSCYLNSVLQVLLN 336
            GL N GN+CY NSVLQ L N
Sbjct: 99  FGLENYGNTCYCNSVLQCLYN 119

>YBL067C (UBP13) [130] chr2 complement(93817..95883) Ubiquitin
           C-terminal hydrolase [2067 bp, 688 aa]
          Length = 688

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 75/160 (46%), Gaps = 24/160 (15%)

Query: 383 IKPTTFKKVIGGSHEEFSSGRQQDSLEFFSY----LSDKLDREIFK------NTTTNP-- 430
           + P++F  V+   +  F++   QD+ EFF++    LS+ ++RE  K      N+ + P  
Sbjct: 410 VSPSSFVDVLKRENVLFNTTMHQDAHEFFNFLLNELSEYIERENKKIAASDINSDSEPSK 469

Query: 431 -----NDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLR-KLDGEQNLIDRLNDYFSGE 484
                +DLF+  + ++IKC  C+ +   D+    +  P+  + D E ++ + L  Y   E
Sbjct: 470 SKNFISDLFQGTLTNQIKCLTCDNITSRDE--PFLDFPIEVQGDEETDIQEILKSYHQRE 527

Query: 485 KI----EYRCLTNKKINTASKVPGFSSFPRTLIINPIRIE 520
            +    ++ C     +  A ++ G    P TL ++  R +
Sbjct: 528 MLNGSNKFYCDECCGLQEAERLVGLKQLPDTLTLHLKRFK 567

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 704 KYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFE 755
           KY+L  ++ H G     GHYV+  K    G   W+L++DE +    +E   E
Sbjct: 601 KYELAGIVVHMGGGPQHGHYVSLCKHEKFG---WLLFDDETVEAVKEETVLE 649

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 14/21 (66%)

Query: 316 LGLLNLGNSCYLNSVLQVLLN 336
            G  N GN+CY NSVLQ L N
Sbjct: 140 FGYENFGNTCYCNSVLQCLYN 160

>AGR139C [4450] [Homologous to ScYER151C (UBP3) - SH]
           (1010466..1012835) [2370 bp, 789 aa]
          Length = 789

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 30/133 (22%)

Query: 317 GLLNLGNSCYLNSVLQVLL--------------NGGIRNWNL--DGLGSFPTDVVYPRTN 360
           G++N GN C+++SVLQVLL                G+++W L    LGS   +       
Sbjct: 350 GIMNKGNICFMSSVLQVLLFCEPFIEMLNVVHARTGVKSWTLLPPLLGSC-LEFYKEFEK 408

Query: 361 LHCQLIKIRN---------AMTLQQSRYPEGIKPTTFKKVIGG--SHEEFSSGRQQDSLE 409
           LH    K +N         +    +S  P+ I P  F K I      ++   G Q+D+ E
Sbjct: 409 LHAD--KDKNDKQSNGNGKSAKANRSSQPDAIDPEHFYKCISKLPMFKDLQWGHQEDAEE 466

Query: 410 FFSYLSDKLDREI 422
           F ++  D+L  E 
Sbjct: 467 FLTHFLDQLHEEF 479

>CAGL0I05522g complement(521749..523923) some similarities with
           sp|P39967 Saccharomyces cerevisiae YER098w UBP9 or
           sp|P38187 Saccharomyces cerevisiae YBL067c UBP13,
           hypothetical start
          Length = 724

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 705 YKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           Y+LT V+ H G S   GHYV+  K    G   W++Y+DE I
Sbjct: 583 YELTGVVLHVGASPTHGHYVSICKHEKYG---WLMYDDETI 620

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 76/184 (41%), Gaps = 23/184 (12%)

Query: 374 LQQSRYPEGI-KPTTFKKVIGGSHEEFSSGRQQDSLEFFSYL-------SDKLDREIFKN 425
           + ++RY  G+  P  F K++   +  F+S  QQD+ EF ++L       + K      K+
Sbjct: 385 ITENRYLSGVVSPAEFVKLLKRQNPLFNSTMQQDAHEFLNFLLNNISDFAGKYKSNYLKS 444

Query: 426 TTTNP--------NDLFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQ-NLIDR 476
           +             D F   + ++IKC  C+ V   ++    +  P+   + E  N+ D 
Sbjct: 445 SNEEECEISHDFVKDQFEGVLLNRIKCLTCDCVSANEE--PFLDFPIEIQNDEAINIQDT 502

Query: 477 LNDYFSGEKI----EYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQPSKTSEQ 532
              ++  E +    ++ C     +  A K  GF   P+TL ++  R +      SK   +
Sbjct: 503 FRSFYQREILCGPNKFYCNECCGLQEAEKTVGFEKLPKTLALHLKRFKCDGIVNSKLFNK 562

Query: 533 VVVP 536
           +  P
Sbjct: 563 IEYP 566

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 297 MVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVLLN 336
           +VD+    L    +G     G  N G++CY NSVLQ + N
Sbjct: 102 IVDTNVTKLMPFGDGSNKVFGYENFGHTCYCNSVLQCIYN 141

>Kwal_55.19645
          Length = 970

 Score = 37.0 bits (84), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 48/110 (43%), Gaps = 8/110 (7%)

Query: 317 GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQQ 376
           GL N+GN+CY+NS+LQ L     R +    L     D    R +   QL K  N   L +
Sbjct: 557 GLRNMGNTCYINSMLQCLF--ATRKFRDLFLSPKYEDYFSKRYSNPHQLSKYFN--ILFK 612

Query: 377 SRYPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREI 422
             Y  G   + PT F K       +      QQD+ EF  +L  +L  E+
Sbjct: 613 KMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFLLSQLHDEL 662

>AFR551W [3743] [Homologous to ScYMR223W (UBP8) - SH]
           complement(1427056..1428465) [1410 bp, 469 aa]
          Length = 469

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 57/141 (40%), Gaps = 41/141 (29%)

Query: 196 WLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTADAADIYCYSCDEDVK 255
           ++CL CG V C  E       SH L H +   GH   +      A    ++C+ C + + 
Sbjct: 58  FMCLQCGFVGCWNE-------SHFLHHSKKV-GHIFGVN-----ATNGLLFCFRCRDYIS 104

Query: 256 FTHNLQLQDILKFWEVEVPAKSKEKTLVELQVEQSLKWDFQMVDSQGKSLKHLQNGPEYG 315
               + +  + K W  EV  +S                       +G+ L          
Sbjct: 105 DNEFVHMDIMPKHWN-EVLRRSSIPA-----------------PHRGEGL---------- 136

Query: 316 LGLLNLGNSCYLNSVLQVLLN 336
           LGL+N+G++C+++SV+Q  L+
Sbjct: 137 LGLVNMGSTCFMSSVIQTFLH 157

>Sklu_1620.2 YER151C, Contig c1620 788-3106
          Length = 772

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 79/212 (37%), Gaps = 59/212 (27%)

Query: 266 LKFWEVEVPAKSKEKTLVELQVEQSLKWDFQMVDSQGKSLKHL----------------- 308
           +K W   + + +  K  V L     LK D + V S  KSL+ L                 
Sbjct: 258 VKSWSA-IASSAVSKPKVSLSPTPQLKKDKKYVPSTIKSLEPLGVVALRMCLDQDYIKYT 316

Query: 309 -QNGPEYG--------LGLLNLGNSCYLNSVLQVLLN--------GGIRNWNLDGLGSFP 351
            +N P  G         G++N GN C+++SVLQVLL           I    +  +GS  
Sbjct: 317 IENVPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFISILNVISYRTVAKIGS-- 374

Query: 352 TDVVYPRTNLHCQLIKIRNAMTLQQSRYP------------------EGIKPTTFKKVIG 393
              V P  +   +L +  +  T +  + P                  E IKP  F K + 
Sbjct: 375 --SVSPSLDACLELYRRFDKQTCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKTLS 432

Query: 394 --GSHEEFSSGRQQDSLEFFSYLSDKLDREIF 423
                 +   G Q+D+ EF ++L D+L  E  
Sbjct: 433 KLPKFRDLRWGHQEDAEEFLTHLLDQLHEEFI 464

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 701 ASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDE 751
           A  KYKL  V+ H G S   GHY A +    +  ++W   +D  I   N E
Sbjct: 701 AGTKYKLVGVVYHHGVSPSGGHYTADVYH--QEMDKWFRIDDVNIAELNKE 749

>Scas_698.7
          Length = 1030

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 6/48 (12%)

Query: 703 AKYKLTAVICHKGNSVHSGHYVAFIKK-----VVEGKEQWVLYNDEKI 745
           AKYKL  ++ H GN + SGHY + + K     +   +++W  ++DE +
Sbjct: 953 AKYKLYGIVNHTGNLI-SGHYTSLVNKEPGHNLNHNQQRWYYFDDEVV 999

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 51/113 (45%), Gaps = 13/113 (11%)

Query: 317 GLLNLGNSCYLNSVLQVLL-NGGIRNWNLDG-LGSFPTDVVYPRTNLHCQLIKIRNAMTL 374
           GL NLGN+CY+NS+LQ L      R+  L     SF     +P + +      I N+  L
Sbjct: 609 GLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLNGSKFPNSPM------ISNSFNL 662

Query: 375 Q-QSRYPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREI 422
             +  Y  G   + PT+F K       +      QQD+ EF   + D+L  E+
Sbjct: 663 LFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDRLHDEL 715

>Scas_692.39
          Length = 466

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 72/378 (19%), Positives = 140/378 (37%), Gaps = 89/378 (23%)

Query: 196 WLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTADAADIYCYSCDEDVK 255
           ++CL C  V C          SH + H +   GH   I      +    ++C+ C + + 
Sbjct: 59  FMCLQCDFVGCWNG-------SHFITHMKRF-GHVFGI-----NSSNGLLFCFKCMDYIG 105

Query: 256 FTHNLQLQDILKFWE-----VEVPAKSKEKTLVELQVEQSLKWDFQMVDSQGKSLKHLQN 310
               +    + K+W+       +P++ +   L                            
Sbjct: 106 HLETINYSMLNKYWDDISTKTTIPSQERRDGL---------------------------- 137

Query: 311 GPEYGLGLLNLGNSCYLNSVLQVLL-NGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIR 369
                 GL+N+G++C+++S+LQ L+ N  I N+++         +      + C L  + 
Sbjct: 138 -----FGLVNMGSTCFMSSILQALIHNPYIVNYSMSQTHFVNCSIKNSSLCMSCALDAMI 192

Query: 370 NAMTLQQSRYP-----------EGIKPTTFKKVIGGS---HEEFSSGRQQDSLEFFSYLS 415
                Q    P               P+ F  ++  S   +E F+   QQD+ EF  Y  
Sbjct: 193 IEFYGQSKLQPISSSSSSSSSSSSSSPSAFISLLTCSLKINENFAGYSQQDAHEFLQYFL 252

Query: 416 DKLDREIFKNTTTN---------PNDLFRFNIQDKIKCDNC-NKVKFMDQVSEVIQLPLR 465
           ++L ++  ++++ N          + +F+  ++  I C  C N  K +  +   + L L 
Sbjct: 253 NQLHQDYKRDSSHNEQENNCPCVAHSIFQGELKSSIVCPECQNDSKTI--IDPFMDLSL- 309

Query: 466 KLDGEQNLIDRLNDYFSGEKIE---YRCLTNKKINTA---SKVPGFSSFPRTLIINPIRI 519
            +  + +L   L+ +   EK+    Y C    + NT+    K    +  P  L++   R 
Sbjct: 310 DIKDKTDLYQCLDSFHKKEKLHDFNYHC---SRCNTSLDPIKQFTINKLPPMLVLQLKRF 366

Query: 520 E-LINWQPSKTSEQVVVP 536
           E  +N    K +E V  P
Sbjct: 367 EHFVNGTNVKLNEFVQYP 384

>Sklu_1979.4 YDR268W, Contig c1979 7588-8532 reverse complement
          Length = 314

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 623 PHASSSAKNRVDSEALNSMTAMGLDSKLCRKALILKNGDVN--ASVEWVFSHMDDDGELP 680
           P  +SS   +  +EA+ S+ ++G+D K   KA+I     V+  A + W+ S +   G L 
Sbjct: 83  PKPNSSEFRQYRTEAIASILSIGIDPK---KAIIFHQSQVHQHAELHWILSTIAPVGYLN 139

Query: 681 EAEEWKDQS 689
              +WK +S
Sbjct: 140 RMTQWKSKS 148

>CAGL0G02563g complement(235498..237393) weakly similar to sp|P36026
           Saccharomyces cerevisiae YKR098c UBP11 ubiquitin
           C-terminal hydrolase, hypothetical start
          Length = 631

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

Query: 316 LGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375
            G+ N+GN+CY+NS+LQ L  G  +  +L     F  ++    TN   + + I N ++L 
Sbjct: 213 FGIRNMGNTCYMNSMLQCLF-GSTQFRDLFLTDKF--EMFKAETN--SESLSIANDLSLL 267

Query: 376 -QSRYPEG---IKPTTFKKVIGGSHEEFSSGR-QQDSLEFFSYLSDKLDREIFKNTTT 428
            +  Y  G   I P +F +       +F     QQD+ EF  ++ ++L  E+   + T
Sbjct: 268 FKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFVLERLRVELANTSAT 325

>CAGL0A04477g 437397..439709 similar to sp|P38187 Saccharomyces
           cerevisiae YBL067c UBP13 or sp|P39967 Saccharomyces
           cerevisiae YER098w UBP9 ubiquitin carboxyl-terminal
           hydrolase, hypothetical start
          Length = 770

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 702 SAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           S  Y+L+ ++ H G     GHY++  K    G   W+L++DE +
Sbjct: 610 SKNYELSGIVVHMGGGPQHGHYISLCKNEKFG---WLLFDDETV 650

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 17/65 (26%)

Query: 289 QSLKWDFQMVDSQGKSL--KHLQN---------------GPEYGLGLLNLGNSCYLNSVL 331
           Q L   F   +S  +SL  +HL N               G     G  N GN+CY NSVL
Sbjct: 106 QKLNGGFNTTNSSNESLPSEHLHNPILNTERTELTPYGDGSNKIFGYENFGNTCYCNSVL 165

Query: 332 QVLLN 336
           Q L N
Sbjct: 166 QCLYN 170

>Scas_664.17
          Length = 494

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 89/201 (44%), Gaps = 37/201 (18%)

Query: 313 EYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTN-----LHCQLIK 367
           ++  GL+N GN C++NS +Q L+        LD L ++ +  +          LH  L  
Sbjct: 73  KFTTGLVNPGNDCFINSSIQALV-------PLDKLTTYLSATLEDEKTASTLPLHNGLAT 125

Query: 368 IRNAMTLQQSRY-PEGIKPTTF----KKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREI 422
           +   + LQQ R  P+ +    F    + + GG      S +Q D+ EF   + ++L+ E 
Sbjct: 126 M--LLELQQLRSDPKSVSSKRFIQQLETIFGGK----ISRQQNDAHEFTQLILERLNEE- 178

Query: 423 FKNTTTNPNDL---FRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLND 479
             N T +  DL   F+  + + + C  C +   +++    I     +L   Q    +L+D
Sbjct: 179 --NLTLDHADLTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIY----ELTLPQQGSVKLSD 232

Query: 480 YFSGEKIE----YRCLTNKKI 496
             +GE++E    Y C+  K +
Sbjct: 233 LVNGEQMETIENYSCMYCKTV 253

>Kwal_55.21267
          Length = 604

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 637 ALNSMTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPE 681
           A+ S+  MG+   +  +AL   NGDV  SV ++FS     GELP+
Sbjct: 5   AIKSLLDMGITRDVAIEALSKTNGDVENSVNYIFS-----GELPQ 44

>CAGL0M11198g 1101217..1102602 similar to sp|P50102 Saccharomyces
           cerevisiae YMR223w UBP8, start by similarity
          Length = 461

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 702 SAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
           S  Y+L  +I H G SV+ GHYVAF K  +E  E W  +ND  +
Sbjct: 398 SILYELIGIISHTG-SVNEGHYVAFCK--IENGE-WFKFNDSMV 437

>Kwal_27.10842
          Length = 711

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 15/21 (71%)

Query: 316 LGLLNLGNSCYLNSVLQVLLN 336
            G  N GN+CY NSVLQVL N
Sbjct: 143 FGYENFGNTCYCNSVLQVLYN 163

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 73/177 (41%), Gaps = 30/177 (16%)

Query: 373 TLQQSRYPEGI-KPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREIFKNT----- 426
           ++ +++Y  G+  P  F + +   +  FS+   QD+ EF ++L +++   +  ++     
Sbjct: 370 SITENKYLTGVVSPIQFVETLKKENVLFSTMMHQDAHEFLNFLLNEVSDYLGAHSEQIAQ 429

Query: 427 ---TTNPND------LFRFNIQDKIKCDNCNKV-----KFMDQVSEVIQLPLRKLDGEQN 472
                NP D      LF+  + ++ KC  C+        F+D   EV Q      D E +
Sbjct: 430 GLDVKNPGDINFVNRLFQGTLTNRTKCLTCDNTTYRNEPFLDFAIEVQQ------DSETD 483

Query: 473 LIDRLNDYFSGEKI----EYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELINWQ 525
           +   L D+   E +    ++ C     +  A +V G    P  L ++  R +    Q
Sbjct: 484 IQTTLADFHQKELLNGANKFYCDVCCGLQEAERVVGLKQLPFYLALHMKRFKYSERQ 540

>YHR021W-A (ECM12) [2308] chr8 (149217..149672) Protein possibly
           involved in cell wall structure or biosynthesis [456 bp,
           151 aa]
          Length = 151

 Score = 32.3 bits (72), Expect = 0.62,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 385 PTTFKKVIGGSHE--EFSSGRQQDSLEFFSYLSDKLDREIFKNTTTNPNDLFRFNIQD 440
           P +  +V   S +  EFSSG       + S+L   LD  IF NT  N +  F  N++D
Sbjct: 91  PVSITQVFSLSRKRGEFSSGYILIINPYKSFLRSLLDFSIFNNTAKNKSSTFTLNLED 148

>Scas_555.6
          Length = 917

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%)

Query: 701 ASAKYKLTAVICHKGNSVHSGHYVA 725
           A+ +YKLT VI H G+S   GHY A
Sbjct: 845 ANREYKLTGVIYHHGSSPDGGHYTA 869

>ACL164C [885] [Homologous to ScYOR124C (UBP2) - SH] (67792..71961)
            [4170 bp, 1389 aa]
          Length = 1389

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 699  SIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKI 745
            + +S  Y L AV  H+G + + GHY  +IK    G   W  YNDE +
Sbjct: 1304 AFSSYGYSLGAVFIHRGEASY-GHYWVYIKDCQNGG-IWRKYNDESV 1348

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 11/16 (68%), Positives = 15/16 (93%)

Query: 317 GLLNLGNSCYLNSVLQ 332
           G+ N+GN+CYLNS+LQ
Sbjct: 678 GINNIGNTCYLNSLLQ 693

>Scas_695.7
          Length = 482

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (88%)

Query: 317 GLLNLGNSCYLNSVLQVL 334
           GL+N GNSC++NSVLQ L
Sbjct: 28  GLINNGNSCFMNSVLQAL 45

>KLLA0A00396g 29717..32755 similar to sp|P40453 Saccharomyces
           cerevisiae YIL156w UBP7 ubiquitin carboxy terminal
           hydrolase, start by similarity
          Length = 1012

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 61/145 (42%), Gaps = 12/145 (8%)

Query: 317 GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQQ 376
           GL N+GN+CY+NS+LQ L   G   +    LG      + P+       I  +    L +
Sbjct: 589 GLRNMGNTCYINSMLQCLF--GCSQFRDLFLGGKYHRYLNPK---RSNTIISKWFSLLFR 643

Query: 377 SRYPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREIFKNTTTNPND 432
             Y  G   + P  F K       +F     QQD+ EF  +L D L  E+ + T    ND
Sbjct: 644 KMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDELSEPTKV-AND 702

Query: 433 LFRFNIQD--KIKCDNCNKVKFMDQ 455
                + D  K+  DN    K+ D+
Sbjct: 703 YPNLLLHDDEKLLVDNKEYDKWFDE 727

>YOR138C (YOR138C) [4939] chr15 complement(584309..586324) Protein
           containing a UBA (ubiquitin associated) or TS-N domain
           [2016 bp, 671 aa]
          Length = 671

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 5/56 (8%)

Query: 633 VDSEALNSMTAMGLDSKLCRKALILKNGDVNASVEWVFSHMDDDGELPEAEEWKDQ 688
           +D++A+ S+  MG+  ++   AL    G++ A+V ++FS+     ELPE  E  ++
Sbjct: 2   MDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSN-----ELPEQAEMGEE 52

>Kwal_26.9598
          Length = 1191

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 88/211 (41%), Gaps = 20/211 (9%)

Query: 316 LGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375
           +G  N G +CYLNS+LQ      +       +   P+D   P  ++   L   R+   L+
Sbjct: 202 IGFKNQGATCYLNSLLQSYFFTKLFR---KMVYKIPSDNESPNDSVSLAL--QRSFYLLE 256

Query: 376 QSRYPEGIKPTTFKKVIG-GSHEEFSSGRQQDSLEFFSYLSDKLDREIFKNTTT--NPND 432
           +S+ P  +      +  G  + E F+   Q D  E    L D+L+  + K T      ND
Sbjct: 257 KSKEP--LDTLELTRSFGWDTGEAFT---QHDVQELNRILMDRLETRM-KGTEVEGTLND 310

Query: 433 LFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEKIE---YR 489
           LF   ++  I+C N +   F  +    IQL ++ L   +++ +   +Y   E ++     
Sbjct: 311 LFVGKMKSYIRCVNVDYESFRVEDFWDIQLNVKNL---KDVKESFENYVEVEMMDGENQY 367

Query: 490 CLTNKKINTASKVPGFSSFPRTLIINPIRIE 520
              +  +  A K   F SFP  L +   R E
Sbjct: 368 AAQDYGLQDAKKGVVFESFPPVLHLQLKRFE 398

>Scas_714.11
          Length = 1269

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 317 GLLNLGNSCYLNSVLQVLLN-GGIRNWNL 344
           G+ N+GN+CYLNS+LQ   +   +RN+ L
Sbjct: 714 GINNIGNTCYLNSLLQYYFSIAPLRNYVL 742

>Kwal_14.1957
          Length = 444

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 22/130 (16%)

Query: 317 GLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNL----HC-QLIKIRNA 371
           G++N GN C+++S+LQVLL       +L  L S  T      T       C +L +  + 
Sbjct: 10  GIVNSGNICFMSSILQVLLFCE-PFVSLMNLISIKTSAKMGNTGFLLLDACLELYRKFDK 68

Query: 372 MTLQQ--------------SRYPEGIKPTTFKKVIGG--SHEEFSSGRQQDSLEFFSYLS 415
           +T ++              S   + IKP  F K +      ++   G Q+D+ EF ++L 
Sbjct: 69  VTFEREKAARINAGNSGISSALADAIKPDDFYKTLSKLPKFKDLRWGHQEDAEEFLTHLL 128

Query: 416 DKLDREIFKN 425
           D+L  E  ++
Sbjct: 129 DQLHEEFVQS 138

>YER151C (UBP3) [1580] chr5 complement(469681..472419)
           Ubiquitin-specific protease, ubiquitin C-terminal
           hydrolase [2739 bp, 912 aa]
          Length = 912

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 697 ASSIASAKYKLTAVICHKGNSVHSGHYVA 725
            S I   +YKLT VI H G S   GHY A
Sbjct: 836 TSGIDDRRYKLTGVIYHHGVSSDGGHYTA 864

>CAGL0H05335g complement(512683..514134) weakly similar to sp|Q02863
           Saccharomyces cerevisiae YPL072w UBP16, hypothetical
           start
          Length = 483

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (72%)

Query: 313 EYGLGLLNLGNSCYLNSVLQVL 334
           +Y  GL+N GN CY NSV+Q L
Sbjct: 69  KYTTGLVNKGNYCYANSVIQAL 90

>KLLA0B01650g complement(131822..134395) weakly similar to sp|Q03714
           Saccharomyces cerevisiae YML029w hypothetical protein
           singleton, hypothetical start
          Length = 857

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 30/64 (46%)

Query: 184 QSCNDCGLTSNLWLCLHCGNVACGREQVGIEGYSHALKHYESTDGHALAIKLGSLTADAA 243
           +S N    T NL +C    +       + I G SHA+   EST+   L+  LG   A AA
Sbjct: 155 ESLNQYEQTRNLNICAIKEHTLEDVVALDIAGRSHAIHLSESTEDLTLSDLLGIDFAPAA 214

Query: 244 DIYC 247
           D YC
Sbjct: 215 DAYC 218

>KLLA0E00979g 104991..107315 some similarities with sp|Q01477
           Saccharomyces cerevisiae YER151c UBP3 ubiquitin-specific
           proteinase singleton, hypothetical start
          Length = 774

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 78/166 (46%), Gaps = 27/166 (16%)

Query: 317 GLLNLGNSCYLNSVLQVLLN--------------GGIRNWNLDGLGSFPTDVV--YPRTN 360
           G+ N G+ C+++SVLQ+L++                 R  ++  L +   DV   + R  
Sbjct: 338 GIYNKGSICFISSVLQLLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNACMDVFKRFDRET 397

Query: 361 LHCQLIKIR-NAMTLQQSRYPE----GIKPTTFKKVIG--GSHEEFSSGRQQDSLEFFSY 413
           +  +L + R N+ T  +S         I P  F K I      ++ + GRQ+D+ EF ++
Sbjct: 398 IVNELNETRENSKTKSKSSNLNENIISIDPEPFYKSISTLPKFKDLTWGRQEDAEEFLTH 457

Query: 414 LSDKLDREIFKNTTT-NPNDLFRFNIQDKIKCDNCNKVKFMDQVSE 458
           + D+L  E   +  T N ND+   NI   ++ D+  KV F+  +S+
Sbjct: 458 MLDQLHEEFIGSINTLNSNDI--LNIFQSLQEDD-QKVFFLKYISK 500

>Scas_671.3
          Length = 770

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 306 KHLQNGPEYGLGLLNLGNSCYLNSVLQVLLNGGIRNWNLD 345
           K L+ G   G GL+N GN+C++NSVLQ L +    N  LD
Sbjct: 82  KILKKGGFVG-GLVNDGNTCFMNSVLQSLASSKELNAFLD 120

>CAGL0M13783g 1352648..1356238 similar to sp|P50101 Saccharomyces
           cerevisiae YMR304w UBP15, hypothetical start
          Length = 1196

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 104/243 (42%), Gaps = 29/243 (11%)

Query: 316 LGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375
           +G  N G +CYLNS+LQ         +    +   PT+   P  ++   L   R+   LQ
Sbjct: 203 VGFRNQGATCYLNSLLQSYF---FTKYFRRLVYQIPTENESPNNSVPLAL--QRSFYQLQ 257

Query: 376 QSRYPEGIKPTTFKKVIG-GSHEEFSSGRQQDSLEFFSYLSDKLDREIFKNTTTNP--ND 432
            S++P  +      +  G  S E F+   Q D  E    L D+L+  + K T+     N+
Sbjct: 258 VSKFP--LDTLELTRSFGWDSAEAFT---QHDVQELNRILMDRLENRM-KGTSVEGMLNE 311

Query: 433 LFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEKI----EY 488
           +F   ++  IKC + +      +    +QL ++ + G   L +  ++Y   E +    +Y
Sbjct: 312 IFVGKMKSYIKCIDVDYESSRVEDFWDLQLNVKNMKG---LKESFDNYIEIELLNGENQY 368

Query: 489 RCLTNKKINTASKVPGFSSFPRTLIINPIRIEL-INW-QPSKTSEQVVVPGVRDDALLDM 546
           +   +  +  A K   F SFP  L +   R E   N+ Q  K +++   P       +D+
Sbjct: 369 QA-QDYGLQDAEKGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPET-----IDL 422

Query: 547 SPF 549
           SP+
Sbjct: 423 SPY 425

>KLLA0E08767g 784991..787306 similar to sp|P25037 Saccharomyces
           cerevisiae YDL122w UBP1 ubiquitin-specific protease
           singleton, start by similarity
          Length = 771

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 314 YGLGLLNLGNSCYLNSVLQVL 334
           Y  GL+N GN+C++NSVLQ L
Sbjct: 82  YVGGLVNDGNTCFMNSVLQCL 102

>Kwal_55.21393
          Length = 1233

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (93%)

Query: 317 GLLNLGNSCYLNSVLQ 332
           GL N+GN+CYLNS+LQ
Sbjct: 704 GLNNIGNTCYLNSLLQ 719

>CAGL0F08041g complement(792575..795550) highly similar to sp|P16861
           Saccharomyces cerevisiae YGR240c PFK1
           6-phosphofructokinase, start by similarity
          Length = 991

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 17/117 (14%)

Query: 36  HSL-FICLRCFQSFSEEHWELHQEVVLSETGSTHD----LYLRVFKV-----LKPKQERE 85
           HSL F  ++ F  F       H E V+  +G++ D    ++L  FK+     L  +  ++
Sbjct: 31  HSLGFSTIKDFNKFK------HGENVVLASGTSDDSLREVWLESFKLSETDSLGFRVPQQ 84

Query: 86  EAGTXXXXXXXXXXVKDVNEDDLYDTHWLLGSVEHGELLSSDTPSIPKEWSDKISEI 142
           EA            V+ V  + L D  +      H    S+D P+I KE+ DK++++
Sbjct: 85  EASNKAQSQGAFVKVRLVMHEPLKDV-YSTAQTSHITYFSADLPAIAKEFGDKVTKV 140

>CAGL0H10582g complement(1029876..1032248) similar to sp|P25037
           Saccharomyces cerevisiae YDL122w UBP1 ubiquitin-specific
           protease, hypothetical start
          Length = 790

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query: 308 LQNGPEYGLGLLNLGNSCYLNSVLQVL 334
           LQ G   G GLLN GN C++NSV+Q L
Sbjct: 89  LQRGGYVG-GLLNDGNFCFMNSVIQSL 114

>Sklu_1860.2 YMR304W, Contig c1860 839-2682
          Length = 615

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 85/211 (40%), Gaps = 20/211 (9%)

Query: 316 LGLLNLGNSCYLNSVLQVLLNGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375
           +G  N G +CYLNS+LQ         +    +   PTD   P  ++   L   R    LQ
Sbjct: 206 VGFKNQGATCYLNSLLQSYF---FTKYFRKLVYQIPTDKESPNNSVPLAL--QRAFFQLQ 260

Query: 376 QSRYPEGIKPTTFKKVIG-GSHEEFSSGRQQDSLEFFSYLSDKLDREIFKNTTTNP--ND 432
           +S  P  +      +  G  + + F+   Q D  E    L D+L+ ++ K T  +   N+
Sbjct: 261 KSNEP--LDTLELTRSFGWDTGDAFT---QHDVQELNRILMDRLENKM-KGTDVDGKLNE 314

Query: 433 LFRFNIQDKIKCDNCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYFSGEKIE---YR 489
           +F   ++  IKC N +      +    IQL ++ L G Q   +   +Y   E ++     
Sbjct: 315 VFVGKMRSYIKCVNVDYESSRVEDFWDIQLNVKNLRGLQ---ESFKNYIEVEMMDGENQY 371

Query: 490 CLTNKKINTASKVPGFSSFPRTLIINPIRIE 520
                 +  A K   F SFP  L +   R E
Sbjct: 372 AAQGYGLQDAKKGVVFESFPPVLHLQLKRFE 402

>CAGL0H06721g complement(667816..671061) similar to sp|P40453
           Saccharomyces cerevisiae YIL156w UBP7, hypothetical
           start
          Length = 1081

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (78%)

Query: 317 GLLNLGNSCYLNSVLQVLL 335
           GL NLGN+CY+N +LQ L 
Sbjct: 649 GLRNLGNTCYINCMLQSLF 667

>YKR023W (YKR023W) [3278] chr11 (483062..484654) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.3857p [1593 bp, 530 aa]
          Length = 530

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 4/36 (11%)

Query: 175 LEKREGGISQSCNDCGLTSNLW----LCLHCGNVAC 206
           LE R+ G S++CN  G    ++     CLHCG V C
Sbjct: 165 LELRDSGSSKNCNCQGTRHPVFDIAPNCLHCGKVVC 200

>AGR389C [4700] [Homologous to ScYDL122W (UBP1) - SH]
           (1443891..1446218) [2328 bp, 775 aa]
          Length = 775

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 4/43 (9%)

Query: 292 KWDFQMVDSQGKSLKHLQNGPEYGLGLLNLGNSCYLNSVLQVL 334
           +W  Q  + + ++ +H   G   G GL+N GN+C++NSV+Q L
Sbjct: 68  RWAPQSAELEKQAHQH---GGNVG-GLVNDGNTCFINSVIQSL 106

>YOR124C (UBP2) [4926] chr15 complement(554824..558642)
           Ubiquitin-specific protease (ubiquitin C-terminal
           hydrolase), cleaves at the C-terminus of ubiquitin [3819
           bp, 1272 aa]
          Length = 1272

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 317 GLLNLGNSCYLNSVLQVLLN-GGIRNWNLD 345
           G+ N+GN+CYLNS+LQ   +   +R + L+
Sbjct: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYVLE 766

>CAGL0K10252g complement(997315..1001118) similar to sp|Q01476
           Saccharomyces cerevisiae YOR124c UBP2 ubiquitin-specific
           proteinase, hypothetical start
          Length = 1267

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 11/16 (68%), Positives = 15/16 (93%)

Query: 317 GLLNLGNSCYLNSVLQ 332
           G+ N+GN+CYLNS+LQ
Sbjct: 723 GINNIGNTCYLNSLLQ 738

>KLLA0D17138g complement(1452972..1455731) similar to sp|P89102
           Saccharomyces cerevisiae YDR166c SEC5 required for
           exocytosis singleton, start by similarity
          Length = 919

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 369 RNAMTLQQSRYPEGIKPTTFKKVIGGSHEEFSSGRQQDSLEFFSYLSDKLDREIFKNTTT 428
           RN+ T+      + IK  TF KV+    E F       +LE ++ L+ K++  IF N  +
Sbjct: 708 RNSHTVLTLNNLKHIKSQTFPKVLNHFDEAFEMSLSSKNLELYNLLA-KMESSIFGNYLS 766

Query: 429 NPNDLFRFNIQDKIK 443
           +     +F+++DK++
Sbjct: 767 D----LKFSLRDKLE 777

>Sklu_2341.7 YMR290C, Contig c2341 11365-12867 reverse complement
          Length = 500

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 446 NCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYF 481
           +CN VK+  ++   I LP+ +L G+Q    R N +F
Sbjct: 293 SCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFF 328

>KLLA0A09669g complement(847036..848529) highly similar to sp|Q03532
           Saccharomyces cerevisiae YMR290c HAS1 helicase
           associated with SET1P, start by similarity
          Length = 497

 Score = 29.6 bits (65), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 446 NCNKVKFMDQVSEVIQLPLRKLDGEQNLIDRLNDYF 481
           +CN VK+  ++   I LP+ +L G+Q    R N +F
Sbjct: 290 SCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFF 325

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,921,906
Number of extensions: 1153894
Number of successful extensions: 3456
Number of sequences better than 10.0: 107
Number of HSP's gapped: 3470
Number of HSP's successfully gapped: 152
Length of query: 758
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 649
Effective length of database: 12,822,747
Effective search space: 8321962803
Effective search space used: 8321962803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)