Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18678g50449626780.0
Kwal_56.2308747648213380.0
AGR024C47747512461e-168
CAGL0K11968g49545811481e-153
YDR036C (EHD3)50046911171e-148
Scas_661.2652346710991e-145
Sklu_2005.264499780.17
Scas_707.11103868780.20
YLR284C (ECI1)280165740.42
KLLA0C04686g277125720.80
Scas_526.2304186701.2
Scas_613.1672794692.1
Scas_650.28*1090130666.1
AGR372W24244637.7
Kwal_56.23316278119638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18678g
         (496 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces...  1036   0.0  
Kwal_56.23087                                                         520   0.0  
AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978) [...   484   e-168
CAGL0K11968g complement(1153196..1154683) similar to sp|P28817 S...   446   e-153
YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of t...   434   e-148
Scas_661.26                                                           427   e-145
Sklu_2005.2 YBR094W, Contig c2005 1296-3230                            35   0.17 
Scas_707.11                                                            35   0.20 
YLR284C (ECI1) [3674] chr12 complement(706200..707042) Peroxisom...    33   0.42 
KLLA0C04686g complement(428962..429795) similar to sgd|S0004274 ...    32   0.80 
Scas_526.2                                                             32   1.2  
Scas_613.16                                                            31   2.1  
Scas_650.28*                                                           30   6.1  
AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH] complement(...    29   7.7  
Kwal_56.23316                                                          29   8.6  

>KLLA0F18678g 1716890..1718404 similar to sp|P28817 Saccharomyces
           cerevisiae YDR036c singleton, start by similarity
          Length = 504

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/496 (100%), Positives = 496/496 (100%)

Query: 1   MLRHSYCRAQQQSLRHVLKTRLAVNQLRFMSEVKFRVDSTARVVTLDRPKKLNALDVEMC 60
           MLRHSYCRAQQQSLRHVLKTRLAVNQLRFMSEVKFRVDSTARVVTLDRPKKLNALDVEMC
Sbjct: 1   MLRHSYCRAQQQSLRHVLKTRLAVNQLRFMSEVKFRVDSTARVVTLDRPKKLNALDVEMC 60

Query: 61  SAILPTLQEYAKSTVNNVVILNSSASPRAFCSGGDVAQVAKLVKEGNFDYAREFFTKEYS 120
           SAILPTLQEYAKSTVNNVVILNSSASPRAFCSGGDVAQVAKLVKEGNFDYAREFFTKEYS
Sbjct: 61  SAILPTLQEYAKSTVNNVVILNSSASPRAFCSGGDVAQVAKLVKEGNFDYAREFFTKEYS 120

Query: 121 LNLALATLNKPVISIMDGITMGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFS 180
           LNLALATLNKPVISIMDGITMGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFS
Sbjct: 121 LNLALATLNKPVISIMDGITMGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFS 180

Query: 181 IPKLTTVGGSNGQLAQYLCMTGDILNGADAYVAGVASHYVPHDQISNLQARLAELHLTEA 240
           IPKLTTVGGSNGQLAQYLCMTGDILNGADAYVAGVASHYVPHDQISNLQARLAELHLTEA
Sbjct: 181 IPKLTTVGGSNGQLAQYLCMTGDILNGADAYVAGVASHYVPHDQISNLQARLAELHLTEA 240

Query: 241 TSQSTNRDDEIFDVVNHAIEEFNAPLPRDYKFKYTADELNVIEQCFDIGNSLKQIYSKLD 300
           TSQSTNRDDEIFDVVNHAIEEFNAPLPRDYKFKYTADELNVIEQCFDIGNSLKQIYSKLD
Sbjct: 241 TSQSTNRDDEIFDVVNHAIEEFNAPLPRDYKFKYTADELNVIEQCFDIGNSLKQIYSKLD 300

Query: 301 EVIAGKTVSQTAQEFAAKTKQMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITATKM 360
           EVIAGKTVSQTAQEFAAKTKQMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITATKM
Sbjct: 301 EVIAGKTVSQTAQEFAAKTKQMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITATKM 360

Query: 361 SESPDLCEFAEATSHKLLEKNKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLVTF 420
           SESPDLCEFAEATSHKLLEKNKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLVTF
Sbjct: 361 SESPDLCEFAEATSHKLLEKNKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLVTF 420

Query: 421 SEYPHHSKYQLPNETLVEKYITGADNHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVG 480
           SEYPHHSKYQLPNETLVEKYITGADNHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVG
Sbjct: 421 SEYPHHSKYQLPNETLVEKYITGADNHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVG 480

Query: 481 FIIDRKCVPNPDGFLR 496
           FIIDRKCVPNPDGFLR
Sbjct: 481 FIIDRKCVPNPDGFLR 496

>Kwal_56.23087
          Length = 476

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/482 (52%), Positives = 338/482 (70%), Gaps = 11/482 (2%)

Query: 17  VLKTRLAVNQLR-FMSE-VKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKST 74
           +L++ +  +Q+R  MSE VKF     +RVVTL RP+KLNAL  +MC  I+PTLQEYAKS 
Sbjct: 1   MLRSSIRCHQVRRLMSEHVKFGSKGVSRVVTLARPEKLNALSTQMCQRIIPTLQEYAKSD 60

Query: 75  VNNVVILNSSASPRAFCSGGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVIS 134
           VNN+VI+ SS +PR+ C+GGDVA VA     G  D + EFF  EYSLNL LAT NKPV+ 
Sbjct: 61  VNNIVIIKSSNAPRSLCAGGDVANVALQNLAGKLDSSLEFFQSEYSLNLLLATYNKPVVV 120

Query: 135 IMDGITMGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQL 194
           +MDGITMGGGVGL+TH+PFRIATENTRW MPEMDIGFFPDVG TFS+PK+TTVGG  GQL
Sbjct: 121 LMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPDVGTTFSLPKITTVGGVKGQL 180

Query: 195 AQYLCMTGDILNGADAYVAGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDEIFDV 254
           A YLC+TGD+L+G D Y+AG+ASHYVP   + +LQARL EL +T +        +E++ +
Sbjct: 181 ALYLCLTGDLLSGVDVYMAGLASHYVPSHNLEDLQARLGELPVTNS--------EEMWKI 232

Query: 255 VNHAIEEFNAPLPRDYKFKYTADELNVIEQCFDIGNSLKQIYSKLDEVIAGKTVSQTAQE 314
              A+EEF+  +P DY FKY+  +LNVIE CF   N LK I + L++++   + S   +E
Sbjct: 233 TGDALEEFSVAIPEDYNFKYSNAQLNVIETCFGPENGLKGIRAALEKIVNSSSASPEEKE 292

Query: 315 FAAKTKQMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITATKMSESPDLCEFAEATS 374
           F+  T Q LASKSPVSL++A E F RNS +DI++AL QDL+TA+ M E   + EF++AT 
Sbjct: 293 FSRVTLQKLASKSPVSLQVAIEQFHRNSQSDIESALKQDLVTASNMCED-TVSEFSQATK 351

Query: 375 HKLLEKNKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNE 434
           HKL++K+K P+QW    L + ++S L+S  ++  VSL +  + +T+ +YP+HS++ LP E
Sbjct: 352 HKLVDKSKAPFQWTKTALTVEELSRLVSPRAATSVSLQKFPDSLTWKKYPYHSQFMLPTE 411

Query: 435 TLVEKYITGADNHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRKCVPNPDGF 494
             ++ YITG DN GR  A    E +K+F Q NP++K KTG+ YL   I  RKC     G 
Sbjct: 412 QNLKDYITGNDNSGRSLAANHAEVLKYFSQYNPSSKGKTGIRYLCDQICSRKCSVGDAGE 471

Query: 495 LR 496
           LR
Sbjct: 472 LR 473

>AGR024C [4334] [Homologous to ScYDR036C - SH] (759545..760978)
           [1434 bp, 477 aa]
          Length = 477

 Score =  484 bits (1246), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/475 (48%), Positives = 323/475 (68%), Gaps = 8/475 (1%)

Query: 21  RLAVNQLRFMSEVKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVI 80
           R  V + +  S VKF+ ++TARVVTL+RP+KLNA++ E+C +ILP +QEYAKS V NV++
Sbjct: 7   RGMVQRRQMSSLVKFKTNNTARVVTLNRPEKLNAINHEICHSILPVMQEYAKSDVANVIV 66

Query: 81  LNSSASPRAFCSGGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVISIMDGIT 140
            +S+ +PRAFC+GGD+  +AK ++    +   +FF  EY++N  LAT  KPV+++MDGIT
Sbjct: 67  FDSACAPRAFCAGGDIVLMAKAMRRDMLEKVDDFFQGEYTMNWMLATYPKPVVALMDGIT 126

Query: 141 MGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQLAQYLCM 200
           MGGGVGL+ H+PFR+ATENT+WAMPE+DIG  PDVG +F++P++ T+GG  GQL  YLC+
Sbjct: 127 MGGGVGLTIHVPFRVATENTKWAMPELDIGLHPDVGVSFALPRIMTLGGQEGQLGYYLCL 186

Query: 201 TGDILNGADAYVAGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDEIFDVVNHAIE 260
           TG++L GAD Y+AG+ASHYV   Q   L+ RL  + +T        + DE F   N  IE
Sbjct: 187 TGEVLQGADVYMAGLASHYVESTQHGALKERLGTVPITR-------KADETFANTNAVIE 239

Query: 261 EFNAPLPRDYKFKYTADELNVIEQCFDIGNSLKQIYSKLDEVIAGKTVSQTAQEFAAKTK 320
           EF++PLP  Y+FKY  +EL+VIE+ F    S K++   L+   +    S+ A+ FA  T 
Sbjct: 240 EFSSPLPDGYQFKYNKEELDVIERFFHYDVSYKELRKNLEAFASSNANSEVARNFAKATL 299

Query: 321 QMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITATKMSESPDLCEFAEATSHKLLEK 380
           + L++KS VS EI +E F+RNS  DIQ+A+ QDLIT+T +  + +L EF  A  HKL+EK
Sbjct: 300 EKLSTKSTVSAEITREQFRRNSQRDIQSAMKQDLITSTNLLRNNELAEFENAVIHKLVEK 359

Query: 381 NKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNETLVEKY 440
            KTPY+WK     +A IS L++ + +NP+ L+     VTF  Y +H+K+ LP E  V+ Y
Sbjct: 360 AKTPYEWKNTSPSVADISKLLAADPANPIDLLETFG-VTFKNYRYHNKFTLPTEAAVQAY 418

Query: 441 ITGADNHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRKCVPNPDGFL 495
           ITG D  GR  AVT+ E VK+F + NP ++ K G +Y+V  IIDRKC  + D FL
Sbjct: 419 ITGTDQSGRSMAVTRAETVKYFTEFNPVSRGKVGTEYVVNLIIDRKCRMDNDSFL 473

>CAGL0K11968g complement(1153196..1154683) similar to sp|P28817
           Saccharomyces cerevisiae YDR036c, hypothetical start
          Length = 495

 Score =  446 bits (1148), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 300/458 (65%), Gaps = 14/458 (3%)

Query: 33  VKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSSASPRAFCS 92
           V F V  TAR+VTL+RPKKLNAL+ EMCS+I  TL EY+KS   N++++ S+ SPR+ C+
Sbjct: 35  VLFSVQETARIVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCA 94

Query: 93  GGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVISIMDGITMGGGVGLSTHIP 152
           GGDVA VA+   + NF+ +   F  EYSLN  LAT  KPV+  MDGITMGGGVGLS H P
Sbjct: 95  GGDVASVAQSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTP 154

Query: 153 FRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQLAQYLCMTGDILNGADAYV 212
           FRIATENT+WAMPE DIGFFPDVG TF++P+L T+   N Q+A YLC+TGD+++G DAY+
Sbjct: 155 FRIATENTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAYL 214

Query: 213 AGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDEIFDVVNHAIEEFNAPLPRDYKF 272
            G+ASHY+PH  +  LQ RL EL             DE FD VN AIEEF  PLP ++KF
Sbjct: 215 LGLASHYIPHSNLEKLQTRLGELR---PALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKF 271

Query: 273 KYTADELNVIEQCFDI--GNSLKQIYSKLDEVIAGKTVSQTAQEFAAKTKQMLASKSPVS 330
           K++ D+L VIE+CFDI  G S+  I+SKL E   G   +    +FA  TK+ L SKS  S
Sbjct: 272 KFSKDQLEVIEKCFDISSGESINAIFSKL-EAFEG---TPEMMQFARDTKKKLESKSMTS 327

Query: 331 LEIAKELFQRNSFTDIQTALTQDLITATKMS-ESPDLCEFAEATSHKLLEKNKTPYQWKI 389
           +++   L Q NS  DI++AL +DL TA  M      + EF+ AT HKLL+K K PY WK 
Sbjct: 328 MQVGIRLMQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQ 387

Query: 390 K-DLKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNETLVEKYITGADNHG 448
           + +L   Q++ LI+   S PVSLIR ++ VT+S+YPH  KYQLP +  +E+ +      G
Sbjct: 388 RTELTPQQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKRG 447

Query: 449 RQTAVTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRK 486
               + K + VK+F   NP TK+K GV+     + D K
Sbjct: 448 ---PIKKNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWK 482

>YDR036C (EHD3) [889] chr4 complement(523206..524708) Member of the
           enoyl-coA hydratase/isomerase protein family [1503 bp,
           500 aa]
          Length = 500

 Score =  434 bits (1117), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 223/469 (47%), Positives = 307/469 (65%), Gaps = 17/469 (3%)

Query: 33  VKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSSASPRAFCS 92
           V F V  TARV+TL+RPKKLNAL+ EM  ++  TL EYAKS   N+VIL SS  PR+FC+
Sbjct: 39  VLFTVQDTARVITLNRPKKLNALNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCA 98

Query: 93  GGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVISIMDGITMGGGVGLSTHIP 152
           GGDVA VA       F  + +FFT EYSLN  +AT  KP+++ MDGITMGGGVGLS H P
Sbjct: 99  GGDVATVAIFNFNKEFAKSIKFFTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTP 158

Query: 153 FRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQLAQYLCMTGDILNGADAYV 212
           FRIATENT+WAMPEMDIGFFPDVG+TF++P++ T+  SN Q+A YLC+TG+++ GADAY+
Sbjct: 159 FRIATENTKWAMPEMDIGFFPDVGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYM 218

Query: 213 AGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDE---IFDVVNHAIEEFNAPLPRD 269
            G+ASHYV  + +  LQ RL E+      S   N D +    F +VN +I+EF +PLP+D
Sbjct: 219 LGLASHYVSSENLDALQKRLGEI------SPPFNNDPQSAYFFGMVNESIDEFVSPLPKD 272

Query: 270 YKFKYTADELNVIEQCFDIG--NSLKQIYSKLDEVIAGKTVSQTAQEFAAKTKQMLASKS 327
           Y FKY+ ++LNVIE CF++    +++ I + L +       S   + FA + K  L +KS
Sbjct: 273 YVFKYSNEKLNVIEACFNLSKNGTIEDIMNNLRQYEG----SAEGKAFAQEIKTKLLTKS 328

Query: 328 PVSLEIAKELFQRNSFTDIQTALTQDLITATKMSESPD-LCEFAEATSHKLLEKNKTPYQ 386
           P SL+IA  L Q NS   I++A+ +DL TA  M  + D L EF+EAT HKL++K + PY 
Sbjct: 329 PSSLQIALRLVQENSRDHIESAIKRDLYTAANMCMNQDSLVEFSEATKHKLIDKQRVPYP 388

Query: 387 WKIKD-LKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNETLVEKYITGAD 445
           W  K+ L ++Q++ + S   S P+SL+R ++ VT+++YP+HSKYQLP E  +  YI    
Sbjct: 389 WTKKEQLFVSQLTSITSPKPSLPMSLLRNTSNVTWTQYPYHSKYQLPTEQEIAAYIEKRT 448

Query: 446 NHGRQTAVTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRKCVPNPDGF 494
           N      VT++E +  F  + P+ + K G+  L   + +RKC    DG 
Sbjct: 449 NDDTGAKVTEREVLNHFANVIPSRRGKLGIQSLCKIVCERKCEEVNDGL 497

>Scas_661.26
          Length = 523

 Score =  427 bits (1099), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 221/467 (47%), Positives = 305/467 (65%), Gaps = 12/467 (2%)

Query: 33  VKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSSASPRAFCS 92
           V F +  TARVVTL+RP KLNAL+ EMC ++   L EY+KS   N++I+ SS   R+ C+
Sbjct: 52  VLFSMQDTARVVTLNRPAKLNALNFEMCQSMFQILNEYSKSDATNLIIVKSSDKGRSLCA 111

Query: 93  GGDVAQVAKLVKEGNFDYAREFFTKEYSLNLALATLNKPVISIMDGITMGGGVGLSTHIP 152
           GGDVA VA     GN   A EFF  EYSLNL +AT  KP+++ M+GITMGGGVGLS H P
Sbjct: 112 GGDVATVAVQNLNGNHKKAIEFFEAEYSLNLQMATYPKPIVTYMNGITMGGGVGLSVHTP 171

Query: 153 FRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVGGSNGQLAQYLCMTGDILNGADAYV 212
           FRIATENT+WAMPEMDIGFFPDVG TF++P+L T+  ++ Q+A YLC+TG++LNG DAY+
Sbjct: 172 FRIATENTKWAMPEMDIGFFPDVGTTFALPRLVTMANNHSQMALYLCLTGEVLNGEDAYM 231

Query: 213 AGVASHYVPHDQISNLQARLAELHLTEATSQSTNRDDEI-FDVVNHAIEEFNAPLPRDYK 271
            G+ASHYV  + + +L+ RL EL  T+  +    +   I FD+VN  I EF+  LP DYK
Sbjct: 232 LGLASHYVNSENLQSLEVRLGELTPTKHITADPAKSSAIFFDMVNGTINEFSTNLPMDYK 291

Query: 272 FKYTADELNVIEQCFDIG--NSLKQIYSKLDEVIAGKTVSQTAQEFAAKTKQMLASKSPV 329
           FK+T D+L+VIE CFDI    S+++I   LD+       S+    F  + K  LA+KS  
Sbjct: 292 FKFTTDQLDVIESCFDITRHTSIEEILRSLDQYAK----SEAGISFCTEIKNKLATKSMT 347

Query: 330 SLEIAKELFQRNSFTDIQTALTQDLITATKMSESPD-LCEFAEATSHKLLEKNKTPYQWK 388
           S++IA ++ + NS  DI +AL +DL TA+ M  + + + EF+EAT HKL++K KTPY WK
Sbjct: 348 SMQIALKVLKENSRDDINSALRRDLFTASNMCVNEEGVSEFSEATKHKLVDKQKTPYPWK 407

Query: 389 IKD-LKLAQISVLISQNSSNPVSLIRPSNLVTFSEYPHHSKYQLPNETLVEKYITGADNH 447
               +    +  ++S   S PVSL    + +T+ +YP+HSKYQLP+E  +++Y+     H
Sbjct: 408 HNSVISPNLLRAMVSPKLSTPVSLWENFSNITWDQYPYHSKYQLPSEQSIKQYLRRVSGH 467

Query: 448 --GRQTA-VTKKEAVKFFQQLNPATKSKTGVDYLVGFIIDRKCVPNP 491
             G  +A +TK E +K F + N  TK K+ V  +   I +RKC  +P
Sbjct: 468 QDGATSAFITKNEVLKHFTRTNKLTKDKSDVALICNIICERKCNMDP 514

>Sklu_2005.2 YBR094W, Contig c2005 1296-3230
          Length = 644

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 9/99 (9%)

Query: 171 FFPDVGATFSIPKLTTVGGSNGQLAQYLCMTGDILNGADAYV--------AGVASHYVPH 222
           + P VG   S+P L+T  G   Q   Y  M  D L+  D Y         A +  HY+ H
Sbjct: 269 YLPQVGILNSLPDLSTFQGKIFQFGDYEHMDMDQLSRNDRYFTNSYIYRKALIRKHYLSH 328

Query: 223 DQISNLQARLAELHLTEATSQSTNRDDEIFDVVNHAIEE 261
             I +   +  E  L +A  +S N D +  + ++ A++E
Sbjct: 329 -TIHSYIVKHPESILNKAYMESFNIDVDYAEFLDDALDE 366

>Scas_707.11
          Length = 1038

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 7/68 (10%)

Query: 59  MCSAILPTLQEYAKSTVNNVVILNS--SASPRAFCSGGDVAQVAKLVKE---GNFDYARE 113
           M + ++PTL+ +   ++N+++ L++  +ASP  F   GD+ ++ K   +   G F     
Sbjct: 247 MVARVMPTLENHIAGSINSILTLSTPHAASPVTF--DGDILKIYKKTNDYWRGQFGNKES 304

Query: 114 FFTKEYSL 121
           FF+K  SL
Sbjct: 305 FFSKNVSL 312

>YLR284C (ECI1) [3674] chr12 complement(706200..707042) Peroxisomal
           3,2-enoyl-CoA isomerase, required for beta-oxidation of
           unsaturated fatty acids [843 bp, 280 aa]
          Length = 280

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 67/165 (40%), Gaps = 10/165 (6%)

Query: 26  QLRFMSEVKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSSA 85
           ++R   ++ +R++    ++ L  P  LNAL+ E    +   L+   ++      I+ SS 
Sbjct: 4   EIRQNEKISYRIEGPFFIIHLMNPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSG 63

Query: 86  SPRAFCSGGDVAQVAKLVKEGNFDYARE-------FFTKEYSLNLALATLNKPVISIMDG 138
             R F SG D   +AK   +    Y  E       F  +   +  A    +K +I  ++G
Sbjct: 64  --RFFSSGADFKGIAKAQGDDTNKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNG 121

Query: 139 ITMGGGVGLSTHIPFRIATENTRWAM-PEMDIGFFPDVGATFSIP 182
             +G    L        +  +  + + P  ++G   + G T S+P
Sbjct: 122 PAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLP 166

>KLLA0C04686g complement(428962..429795) similar to sgd|S0004274
           Saccharomyces cerevisiae YLR284c ECI1
           delta3-cis-delta2-trans-enoyl-CoA isomerase, start by
           similarity
          Length = 277

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 12/125 (9%)

Query: 32  EVKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSSASPRAFC 91
            +++R +    ++     KKLNALD      +   L E  K       +L SS   R F 
Sbjct: 9   RIEYRKEGIFFIIQFTDQKKLNALDGNDYLYLAHLLVENDKDPETAFTVLQSSG--RFFS 66

Query: 92  SGGDVAQVAKLVKEGNFD-----YAREFFTKEYSLNLALATLNKPVISIMDGITMGGGVG 146
           +G D + + K     N D     +A  F ++   +  A    +KP+I  ++    G  VG
Sbjct: 67  AGADFSSIRK-ENTHNSDGTLPKWASAFLSRNTYVTNAFIVHSKPIICCLN----GPAVG 121

Query: 147 LSTHI 151
           LS  I
Sbjct: 122 LSAAI 126

>Scas_526.2
          Length = 304

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 73/186 (39%), Gaps = 28/186 (15%)

Query: 25  NQLRFMSEVKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSS 84
           N+ +    V + ++    ++ L+ P+ LN+L  +    I   L++        + +L SS
Sbjct: 28  NRQKMSKRVSYTIEGPIFIIKLNDPRHLNSLTFDDFVYIAMLLEKANSDDSIFITVLQSS 87

Query: 85  ASPRAFCSGGDVAQVAK----------------LVKEGNFDYAREFFTKEYSLNLALATL 128
           A  + F SGG    V +                ++   N   A  F T E    L +  L
Sbjct: 88  A--KFFSSGGKFEAVLESKGKEDDIGSLNNLIGMISSPNVFVANAFRTHE---KLLVCCL 142

Query: 129 NKPVISIMDGITMGGGVGLSTHIPFRIATENTRWAMPEMDIGFFPDVGATFSIPKLTTVG 188
           N P + +   I M     L   +  R   ++     P  ++GF  +VG++ ++P    + 
Sbjct: 143 NGPAVGLSACIVM-----LCDLVYAR--DDSVYLLFPFSNLGFVAEVGSSVTLPMKLGIN 195

Query: 189 GSNGQL 194
            +N  L
Sbjct: 196 KANEHL 201

>Scas_613.16
          Length = 727

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 45/94 (47%), Gaps = 5/94 (5%)

Query: 273 KYTADELNVIEQCFDIGNSLKQIYSKLDEVIAGKTVSQTAQEFAAKTKQMLASKSPVSLE 332
           +YT DE   I   F I ++ K +   ++ ++ GK  +   +   A +++ L +    +L+
Sbjct: 488 EYTPDE--EISVSFGITDTDKHLILAVEWLLQGKLFTDALESVLALSRRFLINGKVKALD 545

Query: 333 IAKELFQRNSFTDIQTALTQDLITATKMSESPDL 366
                F+RNS  D+  A   ++I+     E P+L
Sbjct: 546 Y---FFRRNSMDDLLKAYKLEIISQRDSDEGPEL 576

>Scas_650.28*
          Length = 1090

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 58/130 (44%), Gaps = 7/130 (5%)

Query: 299 LDEVIAGKTVSQTAQEFAAKTKQMLASKSPVSLEIAKELFQRNSFTDIQTALTQDLITAT 358
           L E+IA   ++   Q+F+   +  L     +SL   K+L +R    DI+  L ++L    
Sbjct: 240 LREIIAISILNPLIQKFSDPDRWNLML---ISLG-EKKLEERTQMKDIRRILRKELEDQN 295

Query: 359 KMSESPDLCEFAEATSHKLLEKNKTPYQWKIKDLKLAQISVLISQNSSNPVSLIRPSNLV 418
           K++  P L +      H  LE N T  Q+   +L L QIS L      N    +  + L+
Sbjct: 296 KVNTQPVLLKNNVQYPHVELELNSTGKQF---ELYLRQISSLSLITDLNVQKFVLMTKLL 352

Query: 419 TFSEYPHHSK 428
              +YP  SK
Sbjct: 353 EVRKYPVLSK 362

>AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH]
           complement(1419828..1420556) [729 bp, 242 aa]
          Length = 242

 Score = 28.9 bits (63), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 29/44 (65%), Gaps = 1/44 (2%)

Query: 306 KTVSQTAQEFAAKTKQMLASKSPVSLEIAKELFQRNSFTDIQTA 349
           ++   T +++AAK+K+  A++SP+  +I  EL ++N   DI+ A
Sbjct: 126 ESTDSTKRKYAAKSKEHNATRSPIFCQIFPELAEQNR-RDIEEA 168

>Kwal_56.23316
          Length = 278

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 51/119 (42%), Gaps = 9/119 (7%)

Query: 31  SEVKFRVDSTARVVTLDRPKKLNALDVEMCSAILPTLQEYAKSTVNNVVILNSSASPRAF 90
           S++  R+D    V+T   P+ LN+        +   L+   K    +  +L SS   R F
Sbjct: 10  SKMSHRIDGLFFVITFTDPQSLNSFSGTDFLYLAHLLEIADKCDSVSFTVLQSSG--RFF 67

Query: 91  CSGGDVAQVAKLVKEGNFD-------YAREFFTKEYSLNLALATLNKPVISIMDGITMG 142
            +G DV+ + ++      +       +  EF ++   +    AT +K ++  ++G  +G
Sbjct: 68  SAGADVSNIERVQAAARREPGGMLGQWLSEFVSRNLFVTHTFATHSKVLVCCLNGPAIG 126

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,295,835
Number of extensions: 635579
Number of successful extensions: 2151
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2197
Number of HSP's successfully gapped: 28
Length of query: 496
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 390
Effective length of database: 12,926,601
Effective search space: 5041374390
Effective search space used: 5041374390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)