Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18656g38437818900.0
Kwal_27.1095138137714330.0
AGR025W37936112561e-173
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18656g
         (378 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18656g complement(1714588..1715742) similar to ca|CA2493|I...   732   0.0  
Kwal_27.10951                                                         556   0.0  
AGR025W [4335] [Homologous to NOHBY] complement(761515..762654) ...   488   e-173

>KLLA0F18656g complement(1714588..1715742) similar to
           ca|CA2493|IPF7227 Candida albicans putative fatty acid
           desaturase (by homology), start by similarity
          Length = 384

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/378 (94%), Positives = 356/378 (94%)

Query: 1   MTIVHRDLKVSEKFVDVPSADEDFKVLDNFYWSAHKEPHAIRRHAIIKKHPEVQRLMGHE 60
           MTIVHRDLKVSEKFVDVPSADEDFKVLDNFYWSAHKEPHAIRRHAIIKKHPEVQRLMGHE
Sbjct: 1   MTIVHRDLKVSEKFVDVPSADEDFKVLDNFYWSAHKEPHAIRRHAIIKKHPEVQRLMGHE 60

Query: 61  PLTKWIIIGVVXXXXXXXXXXRNTHPFTWKFFIIAYVIGATANQNIFLAIHELSHNLAFK 120
           PLTKWIIIGVV          RNTHPFTWKFFIIAYVIGATANQNIFLAIHELSHNLAFK
Sbjct: 61  PLTKWIIIGVVSLQLSLSYYLRNTHPFTWKFFIIAYVIGATANQNIFLAIHELSHNLAFK 120

Query: 121 KPVHNKLFAIFTNTPIGIPYSASFGPYHQLHHKFLGDEIYDTDIPTRFEAVLLSNILGKS 180
           KPVHNKLFAIFTNTPIGIPYSASFGPYHQLHHKFLGDEIYDTDIPTRFEAVLLSNILGKS
Sbjct: 121 KPVHNKLFAIFTNTPIGIPYSASFGPYHQLHHKFLGDEIYDTDIPTRFEAVLLSNILGKS 180

Query: 181 XXXXXXXXXXXXRPMFVTRIKFTYIHLLNVLYQFMFNFIWIANFGWYSYCYFLMSSFLAG 240
                       RPMFVTRIKFTYIHLLNVLYQFMFNFIWIANFGWYSYCYFLMSSFLAG
Sbjct: 181 FFATFQIFFYAFRPMFVTRIKFTYIHLLNVLYQFMFNFIWIANFGWYSYCYFLMSSFLAG 240

Query: 241 SLHPCSGHFIAEHYLLNIEEAIIGGKLMLKLTPAERQPINVTDESNVSREDVEFRKKYAL 300
           SLHPCSGHFIAEHYLLNIEEAIIGGKLMLKLTPAERQPINVTDESNVSREDVEFRKKYAL
Sbjct: 241 SLHPCSGHFIAEHYLLNIEEAIIGGKLMLKLTPAERQPINVTDESNVSREDVEFRKKYAL 300

Query: 301 ETYSYYGLLNFFTWNVGLHNEHHDFPFVAWSRLWELNSLCPEFYNHLPKHSSWCKVLYDF 360
           ETYSYYGLLNFFTWNVGLHNEHHDFPFVAWSRLWELNSLCPEFYNHLPKHSSWCKVLYDF
Sbjct: 301 ETYSYYGLLNFFTWNVGLHNEHHDFPFVAWSRLWELNSLCPEFYNHLPKHSSWCKVLYDF 360

Query: 361 ITHDDVVLYNRVKRVNKE 378
           ITHDDVVLYNRVKRVNKE
Sbjct: 361 ITHDDVVLYNRVKRVNKE 378

>Kwal_27.10951
          Length = 381

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/377 (67%), Positives = 306/377 (81%)

Query: 1   MTIVHRDLKVSEKFVDVPSADEDFKVLDNFYWSAHKEPHAIRRHAIIKKHPEVQRLMGHE 60
           M I H+ L +  + +D P+  E   VL NFYWS HKEPHA+RRHAI+K HPEV++LMGHE
Sbjct: 1   MPITHKGLSLGSETMDAPAVSEPVPVLHNFYWSTHKEPHAVRRHAILKSHPEVKKLMGHE 60

Query: 61  PLTKWIIIGVVXXXXXXXXXXRNTHPFTWKFFIIAYVIGATANQNIFLAIHELSHNLAFK 120
           P TK+I+ GVV          RNTHP ++KF++ AYVIGATANQNIFLAIHELSHNLAF+
Sbjct: 61  PRTKFIVAGVVALQCTVAYLLRNTHPLSFKFWLCAYVIGATANQNIFLAIHELSHNLAFR 120

Query: 121 KPVHNKLFAIFTNTPIGIPYSASFGPYHQLHHKFLGDEIYDTDIPTRFEAVLLSNILGKS 180
           KP+HNKLF++FTNTPIG+PY+ASF PYHQLHHKFLGDE+YDTDIPT  E ++LSNILGK+
Sbjct: 121 KPLHNKLFSVFTNTPIGVPYAASFAPYHQLHHKFLGDELYDTDIPTNLEVLVLSNILGKA 180

Query: 181 XXXXXXXXXXXXRPMFVTRIKFTYIHLLNVLYQFMFNFIWIANFGWYSYCYFLMSSFLAG 240
                       RPMFVT I  +++HL+NV YQ  F++IWI  FGW S+ YF++SSFLAG
Sbjct: 181 FFATFQIFFYALRPMFVTSIPMSFLHLINVAYQLTFDYIWINTFGWKSFMYFIISSFLAG 240

Query: 241 SLHPCSGHFIAEHYLLNIEEAIIGGKLMLKLTPAERQPINVTDESNVSREDVEFRKKYAL 300
           SLHPCSGHFIAEHY+LN+EEAI GGKL+ K TP E + I+ TD S V+R+DVEF+++YAL
Sbjct: 241 SLHPCSGHFIAEHYMLNLEEAIAGGKLVFKNTPCETEAIHSTDASQVNRKDVEFKREYAL 300

Query: 301 ETYSYYGLLNFFTWNVGLHNEHHDFPFVAWSRLWELNSLCPEFYNHLPKHSSWCKVLYDF 360
           ETYSYYG LNFFTWNVGLHNEHHDFPF+AWS+LWELN +CPE+Y +LPKH SWCKV++DF
Sbjct: 301 ETYSYYGCLNFFTWNVGLHNEHHDFPFIAWSKLWELNRMCPEYYQNLPKHHSWCKVIWDF 360

Query: 361 ITHDDVVLYNRVKRVNK 377
           + HDDV LYNRVKRVNK
Sbjct: 361 VLHDDVTLYNRVKRVNK 377

>AGR025W [4335] [Homologous to NOHBY] complement(761515..762654)
           [1140 bp, 379 aa]
          Length = 379

 Score =  488 bits (1256), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/361 (64%), Positives = 275/361 (76%), Gaps = 1/361 (0%)

Query: 18  PSADEDFKVLDNFYWSAHKEPHAIRRHAIIKKHPEVQRLMGHEPLTKWIIIGVVXXXXXX 77
           PSAD D +VL NFYW++ KEPHA RR  I++ HPEV++LMGHEP TK+++  VV      
Sbjct: 15  PSADADVEVLHNFYWTSLKEPHAHRRKEILRAHPEVKKLMGHEPRTKYLVALVVGLQLLS 74

Query: 78  XXXXRNTHPFTWKFFIIAYVIGATANQNIFLAIHELSHNLAFKKPVHNKLFAIFTN-TPI 136
               R+T P + KF   AYV+GATA QN++LAIHELSHNLAFKKP HN+LF+IF      
Sbjct: 75  AYMLRDTDPLSLKFLAWAYVVGATATQNLYLAIHELSHNLAFKKPKHNRLFSIFCKPAES 134

Query: 137 GIPYSASFGPYHQLHHKFLGDEIYDTDIPTRFEAVLLSNILGKSXXXXXXXXXXXXRPMF 196
           GIP++ASFGPYHQLHHKFLGDE+YDTD+PT  EAVLLSN+LGK+            RPM 
Sbjct: 135 GIPFAASFGPYHQLHHKFLGDEVYDTDVPTVLEAVLLSNVLGKTFFATFQIFFYALRPMM 194

Query: 197 VTRIKFTYIHLLNVLYQFMFNFIWIANFGWYSYCYFLMSSFLAGSLHPCSGHFIAEHYLL 256
           V RI  T  H+LNV+ QF+F+ IWI  FG   + YFL+SSFLAGSLHPCSGHFIAEHYL 
Sbjct: 195 VVRIPITGFHVLNVVCQFVFDVIWIRQFGLNGFFYFLLSSFLAGSLHPCSGHFIAEHYLF 254

Query: 257 NIEEAIIGGKLMLKLTPAERQPINVTDESNVSREDVEFRKKYALETYSYYGLLNFFTWNV 316
           +IEEAI+GGK+ +K    E +P+ VTDES V R DVEFRK YALETYSYYG+LN  TWNV
Sbjct: 255 SIEEAIVGGKVAMKSAAGEAEPVYVTDESAVKRPDVEFRKDYALETYSYYGILNAVTWNV 314

Query: 317 GLHNEHHDFPFVAWSRLWELNSLCPEFYNHLPKHSSWCKVLYDFITHDDVVLYNRVKRVN 376
           GLHNEHHDFPF+AWS+LWELN +CPEFY  LPKH SW +VL+DFI   DV LYNRV+RVN
Sbjct: 315 GLHNEHHDFPFIAWSKLWELNRMCPEFYETLPKHDSWVRVLWDFIFKYDVTLYNRVRRVN 374

Query: 377 K 377
           K
Sbjct: 375 K 375

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.141    0.459 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,805,873
Number of extensions: 554653
Number of successful extensions: 1516
Number of sequences better than 10.0: 5
Number of HSP's gapped: 1539
Number of HSP's successfully gapped: 5
Length of query: 378
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 275
Effective length of database: 13,030,455
Effective search space: 3583375125
Effective search space used: 3583375125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 62 (28.5 bits)