Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18634g84833681e-47
AGR026C107642131e-23
Kwal_27.1094984832074e-23
Scas_718.48*88791841e-19
YBR058C-A (TSC3)80771405e-13
KLLA0D18480g64247640.26
YKR105C58257620.47
YCL069W45857620.56
Kwal_14.72856838600.95
CAGL0C01375g68323572.6
CAGL0K06193g44523563.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18634g
         (83 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521 Sac...   146   1e-47
AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH] (762745.....    87   1e-23
Kwal_27.10949                                                          84   4e-23
Scas_718.48*                                                           75   1e-19
YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein a...    59   5e-13
KLLA0D18480g 1558735..1560663 similar to sp|P22213 Saccharomyces...    29   0.26 
YKR105C (YKR105C) [3356] chr11 complement(658352..660100) Member...    28   0.47 
YCL069W (YCL069W) [480] chr3 (9706..11082) Member of the multidr...    28   0.56 
Kwal_14.728                                                            28   0.95 
CAGL0C01375g 146471..148522 similar to sp|P40483 Saccharomyces c...    27   2.6  
CAGL0K06193g 600985..602322 highly similar to sp|Q02336 Saccharo...    26   3.3  

>KLLA0F18634g 1713947..1714201 weakly similar to sgd|S0007521
          Saccharomyces cerevisiae YBR058ca required for optimal
          serine palmitoyltransferase activity, start by
          similarity
          Length = 84

 Score =  146 bits (368), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 70/83 (84%)

Query: 1  MAAEKIYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDA 60
          MAAEKIYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDA
Sbjct: 1  MAAEKIYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDA 60

Query: 61 FCLHTIXXXXXXXXXXXXXKYIF 83
          FCLHTI             KYIF
Sbjct: 61 FCLHTIFLVVVSLSLFGLLKYIF 83

>AGR026C [4336] [Homologous to ScYBR058C-A (TSC3) - SH]
          (762745..763068) [324 bp, 107 aa]
          Length = 107

 Score = 86.7 bits (213), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 50/64 (78%)

Query: 1  MAAEKIYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDA 60
          M++++    YKK RGTM+YTPT+ Q + G + EK+  F ++LYW+YYIHLP+YLMTS D+
Sbjct: 8  MSSKRADNCYKKDRGTMVYTPTDAQQATGKVHEKVYKFFESLYWMYYIHLPYYLMTSFDS 67

Query: 61 FCLH 64
          FCLH
Sbjct: 68 FCLH 71

>Kwal_27.10949
          Length = 84

 Score = 84.3 bits (207), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 54/83 (65%)

Query: 1  MAAEKIYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDA 60
          M   ++ +  + + GTMIY PT++++S G   EK+++F +NLYW+YYIHLP+YLMT+ DA
Sbjct: 1  MNKNEVEKGQETNNGTMIYRPTDEELSNGSFLEKVSNFGENLYWMYYIHLPYYLMTTGDA 60

Query: 61 FCLHTIXXXXXXXXXXXXXKYIF 83
          FCLHT              KYIF
Sbjct: 61 FCLHTFFLAMLTLGLFGLVKYIF 83

>Scas_718.48*
          Length = 88

 Score = 75.5 bits (184), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 47/79 (59%), Gaps = 8/79 (10%)

Query: 13 SRGTMIYTPTNQQMS--------RGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDAFCLH 64
          S+ TMI+ PTN+++         RG I EK+ + V+ LYW+YYIHLP+YLMTS D+FCLH
Sbjct: 9  SQCTMIFVPTNKELKEKRRAANGRGSIMEKVEEIVEKLYWMYYIHLPYYLMTSFDSFCLH 68

Query: 65 TIXXXXXXXXXXXXXKYIF 83
                         KYIF
Sbjct: 69 LFFLTIFSLSVFAVIKYIF 87

>YBR058C-A (TSC3) [249] chr2 complement(356284..356526) Protein
          associated with serine palmitoyltransferase and
          required for optimal enzyme activity [243 bp, 80 aa]
          Length = 80

 Score = 58.5 bits (140), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 12 KSRGTMIYTPTNQQMSR-----GGIGEKLADFVKNLYWVYYIHLPFYLMTSLDAFCLHTI 66
          + + +M+Y PT ++  R      GI   + + V+ LYW YYIHLPFYLM S D+F LH  
Sbjct: 3  QHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVF 62

Query: 67 XXXXXXXXXXXXXKYIF 83
                       KY F
Sbjct: 63 FLTIFSLSFFGILKYCF 79

>KLLA0D18480g 1558735..1560663 similar to sp|P22213 Saccharomyces
           cerevisiae YDR189w SLY1 hydrophilic suppressor of YPT1
           and member of the SEC1P family, start by similarity
          Length = 642

 Score = 29.3 bits (64), Expect = 0.26,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 6   IYEPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPF 52
           +++ +K SR T+    TN+Q     + +K+    K+ +W+   HLPF
Sbjct: 269 VFDVFKLSRNTITMPTTNEQNEE--VIKKMDIDPKDFFWIANSHLPF 313

>YKR105C (YKR105C) [3356] chr11 complement(658352..660100) Member of
           the multidrug-resistance 14-spanner (DHA14) family of
           the major facilitator superfamily (MFS-MDR) [1749 bp,
           582 aa]
          Length = 582

 Score = 28.5 bits (62), Expect = 0.47,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 8   EPY--KKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDAFC 62
           EPY  K     ++Y   N   S   IG  L+D +KN++W   + L FY +  L  FC
Sbjct: 507 EPYEGKTVDDMILYRLQNYDGSHSTIGNILSDSIKNVFW---MDLGFYALGFL--FC 558

>YCL069W (YCL069W) [480] chr3 (9706..11082) Member of the
           multidrug-resistance 14-spanner family of the major
           facilitator superfamily (MFS-MDR) [1377 bp, 458 aa]
          Length = 458

 Score = 28.5 bits (62), Expect = 0.56,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 8   EPY--KKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWVYYIHLPFYLMTSLDAFC 62
           EPY  K     ++Y   N   S   IG  L+D +KN++W   + L FY +  L  FC
Sbjct: 383 EPYEGKTVDDMILYRLQNYDGSHSTIGNILSDSIKNVFW---MDLGFYALGFL--FC 434

>Kwal_14.728
          Length = 568

 Score = 27.7 bits (60), Expect = 0.95,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 8   EPYKKSRGTMIYTPTNQQMSRGGIGEKLADFVKNLYWV 45
           E Y K  G   Y  +N   +R  +G  L+D +KN +W+
Sbjct: 508 EEYMKLDGIASYRMSNFDGARSEMGYMLSDSIKNTFWM 545

>CAGL0C01375g 146471..148522 similar to sp|P40483 Saccharomyces
           cerevisiae YIL108w, start by similarity
          Length = 683

 Score = 26.6 bits (57), Expect = 2.6,   Method: Composition-based stats.
 Identities = 10/23 (43%), Positives = 13/23 (56%)

Query: 22  TNQQMSRGGIGEKLADFVKNLYW 44
           TN+QM R G G +   FV+   W
Sbjct: 141 TNEQMLRNGFGHRTIRFVEEYTW 163

>CAGL0K06193g 600985..602322 highly similar to sp|Q02336
           Saccharomyces cerevisiae YDR448w ADA2 general
           transcriptional adaptor, start by similarity
          Length = 445

 Score = 26.2 bits (56), Expect = 3.3,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 31  IGEKLADFVKNLYWVYYIHLPFY 53
           IG +  D V++ Y  YYI+ PFY
Sbjct: 92  IGSREKDEVRDHYIEYYINSPFY 114

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.141    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,309,039
Number of extensions: 74072
Number of successful extensions: 205
Number of sequences better than 10.0: 12
Number of HSP's gapped: 204
Number of HSP's successfully gapped: 12
Length of query: 83
Length of database: 16,596,109
Length adjustment: 55
Effective length of query: 28
Effective length of database: 14,692,119
Effective search space: 411379332
Effective search space used: 411379332
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 54 (25.4 bits)