Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18612g81480136920.0
Sklu_1752.285842415820.0
Kwal_27.1094593544715280.0
Scas_661.27109542315060.0
YBR059C (AKL1)110839014660.0
AGR027C96140714490.0
CAGL0H10208g102739513531e-173
CAGL0K11990g99137712731e-161
Kwal_27.115427913198064e-95
CAGL0G02607g6883747688e-91
Scas_601.66613177537e-89
Sklu_2226.77953097565e-88
ADL217W7503127501e-87
YIL095W (PRK1)8103197513e-87
KLLA0E08371g7773117423e-86
Scas_671.167233177351e-85
YNL020C (ARK1)6383067107e-83
CAGL0J03432g6223087062e-82
KLLA0C06138g7083262509e-22
Scas_644.157262922331e-19
ACL006W7082912322e-19
Sklu_2419.96952922312e-19
YPL150W9012972285e-19
Scas_700.288961952251e-18
Kwal_56.224766972922241e-18
Sklu_1962.23643562172e-18
CAGL0J11638g7462982222e-18
CAGL0M02299g8932042223e-18
Kwal_56.242743463352136e-18
YPL236C3643392128e-18
Sklu_2361.38843022171e-17
YMR001C (CDC5)7052872152e-17
ACR133C8511952099e-17
Kwal_26.87518481942091e-16
Kwal_33.131125053022061e-16
KLLA0F11319g8431942062e-16
Kwal_55.215458653012062e-16
Sklu_2419.105662281945e-15
CAGL0L11550g10722281921e-14
AFL101C3672381871e-14
KLLA0E21780g10162291902e-14
YDR477W (SNF1)6333211882e-14
Kwal_23.52908193181883e-14
Scas_580.610152291875e-14
Scas_693.1710492031875e-14
YHR102W (KIC1)10802781875e-14
AFR377C7262871866e-14
ACL104C9472301849e-14
KLLA0C12485g9252651831e-13
Kwal_56.226939842231822e-13
AEL230W6083011812e-13
Kwal_56.237178581931803e-13
AFR724C4402911773e-13
Scas_598.67903321803e-13
AGR058W10711931794e-13
ABL034W14252811794e-13
KLLA0A03806g6023081775e-13
KLLA0F13552g12672691795e-13
Kwal_26.778812673471786e-13
YDL159W (STE7)5153121757e-13
CAGL0M11396g11922031778e-13
Scas_707.369153251769e-13
Kwal_47.182335982911741e-12
Scas_660.286232951741e-12
AFR696C11422341741e-12
YOL100W (PKH2)10812341741e-12
CAGL0B01925g9442351742e-12
KLLA0B02332g3612941692e-12
AFR335C10332001723e-12
CAGL0M08910g6122961694e-12
KLLA0A07403g8793031705e-12
Scas_502.211161971705e-12
YDR523C (SPS1)4901951676e-12
CAGL0I07513g10761971696e-12
ACR196C5302871677e-12
AEL205W7932421679e-12
YNL298W (CLA4)8423101671e-11
Scas_458.13673021641e-11
KLLA0C01650g11122341661e-11
ABR014W9711771662e-11
KLLA0C00979g4833001642e-11
YKL101W (HSL1)15182011662e-11
CAGL0G04609g9653161652e-11
CAGL0J03872g6612371642e-11
Kwal_23.632515422671652e-11
CAGL0E05720g3582381612e-11
YDR122W (KIN1)10642041642e-11
Scas_675.25272021623e-11
Scas_544.64892521613e-11
Kwal_26.735514463201633e-11
Sklu_2437.1610711991634e-11
Scas_564.712102021625e-11
KLLA0F19536g11042041615e-11
Scas_627.73491641575e-11
YDR490C (PKH1)7663001606e-11
Kwal_47.1726311272851617e-11
YJL095W (BCK1)14783041617e-11
KLLA0C08525g15512251617e-11
YOR233W (KIN4)8001431607e-11
KLLA0F07623g12291761607e-11
YCR073C (SSK22)13312381607e-11
Sklu_2366.54662381589e-11
Sklu_2323.34002591579e-11
Scas_616.1014612521591e-10
CAGL0K08514g14892011591e-10
Kwal_26.715412131741591e-10
YLR096W (KIN2)11471931591e-10
Sklu_2086.42431711511e-10
CAGL0J00539g4882321561e-10
Kwal_26.87098292371571e-10
KLLA0E17127g8521901571e-10
CAGL0K05709g11032341572e-10
Scas_700.348642351572e-10
KLLA0B11902g4952331552e-10
AER264C14832741562e-10
Scas_685.245152911542e-10
Scas_668.228932361562e-10
YGL179C (TOS3)5601851543e-10
YAR019C (CDC15)9742491553e-10
YBR274W (CHK1)5271851534e-10
CAGL0M03729g8613101535e-10
CAGL0G09020g3611501505e-10
CAGL0M10153g8671631535e-10
CAGL0L03520g14473071535e-10
KLLA0F14190g13382651536e-10
YHL007C (STE20)9392321518e-10
AER232C5692491509e-10
Kwal_56.245844352281499e-10
Kwal_33.138463752791489e-10
Scas_688.144792361491e-09
Scas_493.211172371511e-09
CAGL0H00979g3993751471e-09
Sklu_2436.147842421491e-09
CAGL0K02673g9151761491e-09
KLLA0B13112g7301991482e-09
Sklu_1603.24883831472e-09
YCL024W (KCC4)10372341492e-09
Kwal_23.55765042331472e-09
KLLA0F01276g5191471472e-09
Scas_548.613821831482e-09
Kwal_26.78619551761482e-09
CAGL0C05005g10762511482e-09
KLLA0C16577g5042171462e-09
Scas_640.14*7282361472e-09
YDR507C (GIN4)11422371482e-09
KLLA0B13607g9891761472e-09
CAGL0F03311g10451901472e-09
YHR030C (SLT2)4842341462e-09
Scas_711.2515152641473e-09
Scas_477.57031991463e-09
Sklu_1995.27291991463e-09
AFR092W14232701473e-09
KLLA0B07205g4552381443e-09
Scas_584.1110741941454e-09
ABL011C7012671454e-09
YKL161C4331801434e-09
AEL185C5152511444e-09
YNR047W8932761446e-09
AAR009W4532541426e-09
ACR281C12591681446e-09
Sklu_2186.45212361427e-09
YAL017W (PSK1)13561251437e-09
YPL141C8652401438e-09
CAGL0F00913g12061241438e-09
YHR082C (KSP1)10291601439e-09
YPL140C (MKK2)5061651419e-09
YER129W (PAK1)11421651439e-09
ACR117W5242511419e-09
Kwal_56.240913811961409e-09
Scas_653.256662311421e-08
Scas_651.183712401401e-08
CAGL0H06259g13361721421e-08
Kwal_23.566816891951421e-08
CAGL0C03509g8953011411e-08
CAGL0M08404g4622401392e-08
Scas_720.9416832351412e-08
AEL284C4791791382e-08
YJL187C (SWE1)8192491392e-08
KLLA0C04191g7972461392e-08
AFL143C3613501362e-08
CAGL0I03498g4512191372e-08
YPL203W (TPK2)3802631362e-08
Kwal_27.100047351591383e-08
Scas_629.169183011383e-08
KLLA0D03190g372921363e-08
Sklu_2073.311821761383e-08
KLLA0C04213g3943351363e-08
Sklu_2104.12992271343e-08
Scas_683.123561931353e-08
Kwal_55.203267502011374e-08
YDL025C6201471364e-08
YLR362W (STE11)7171991374e-08
Scas_643.2010821251374e-08
CAGL0M02519g7562451364e-08
AEL115C386921354e-08
ADR300C8901911374e-08
YDR466W (PKH3)8981661365e-08
YJL164C (TPK1)397921345e-08
YPR054W (SMK1)3882961345e-08
CAGL0F04741g4422621345e-08
ACR119W9312331365e-08
Scas_720.1038042731356e-08
Kwal_33.141925771491356e-08
YKL166C (TPK3)3982391346e-08
YNR031C (SSK2)15793511366e-08
KLLA0E03487g6472931356e-08
KLLA0E07414g3651451337e-08
CAGL0H01639g5212301347e-08
YCR091W (KIN82)7202431347e-08
KLLA0F01507g4723521338e-08
ADL168C3621451328e-08
YPL209C (IPL1)3671101329e-08
YKL048C (ELM1)6401671339e-08
CAGL0B02739g6762001331e-07
CAGL0I05390g4542231321e-07
AER223C9022261331e-07
Scas_689.25*4091071321e-07
KLLA0D07304g4652061321e-07
Kwal_56.240593531061311e-07
CAGL0K02167g11622021331e-07
ACL053C11813441331e-07
CAGL0H07535g2982231291e-07
YOL045W (PSK2)11011701331e-07
Scas_660.20957931321e-07
Kwal_23.64588682581321e-07
KLLA0D07348g9092261321e-07
YOL113W (SKM1)6552471312e-07
YFR014C (CMK1)4462661302e-07
Kwal_55.201898121911312e-07
Sklu_1843.34861691302e-07
Kwal_55.220013631451292e-07
CAGL0J04290g3571961292e-07
KLLA0E15378g7242651302e-07
Scas_640.165052101293e-07
Scas_667.184372021283e-07
AFL090W346921273e-07
Scas_703.57492881293e-07
YBR160W (CDC28)2982231263e-07
Scas_602.1111862991293e-07
KLLA0C18568g7742011293e-07
CAGL0D02244g4872001284e-07
AAL083W16982021294e-07
Sklu_2354.43631451264e-07
ADR058C2952241254e-07
YNL307C (MCK1)3751711264e-07
KLLA0D09328g10461671285e-07
ADR313W5781461275e-07
CAGL0J03828g4671441265e-07
Scas_713.79831991275e-07
Scas_635.13781451256e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18612g
         (801 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...  1426   0.0  
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement         613   0.0  
Kwal_27.10945                                                         593   0.0  
Scas_661.27                                                           584   0.0  
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...   569   0.0  
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...   562   0.0  
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...   525   e-173
CAGL0K11990g complement(1155395..1158370) some similarities with...   494   e-161
Kwal_27.11542                                                         315   4e-95
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...   300   8e-91
Scas_601.6                                                            294   7e-89
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                          295   5e-88
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...   293   1e-87
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...   293   3e-87
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...   290   3e-86
Scas_671.16                                                           287   1e-85
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...   278   7e-83
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...   276   2e-82
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   100   9e-22
Scas_644.15                                                            94   1e-19
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    94   2e-19
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                          94   2e-19
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    92   5e-19
Scas_700.28                                                            91   1e-18
Kwal_56.22476                                                          91   1e-18
Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement          88   2e-18
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    90   2e-18
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    90   3e-18
Kwal_56.24274                                                          87   6e-18
YPL236C (YPL236C) [5213] chr16 complement(101608..102702) Serine...    86   8e-18
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            88   1e-17
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    87   2e-17
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    85   9e-17
Kwal_26.8751                                                           85   1e-16
Kwal_33.13112                                                          84   1e-16
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    84   2e-16
Kwal_55.21545                                                          84   2e-16
Sklu_2419.10 , Contig c2419 14439-16135                                79   5e-15
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    79   1e-14
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    77   1e-14
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    78   2e-14
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    77   2e-14
Kwal_23.5290                                                           77   3e-14
Scas_580.6                                                             77   5e-14
Scas_693.17                                                            77   5e-14
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    77   5e-14
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    76   6e-14
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    75   9e-14
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    75   1e-13
Kwal_56.22693                                                          75   2e-13
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    74   2e-13
Kwal_56.23717                                                          74   3e-13
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    73   3e-13
Scas_598.6                                                             74   3e-13
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    74   4e-13
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    74   4e-13
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    73   5e-13
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    74   5e-13
Kwal_26.7788                                                           73   6e-13
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    72   7e-13
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    73   8e-13
Scas_707.36                                                            72   9e-13
Kwal_47.18233                                                          72   1e-12
Scas_660.28                                                            72   1e-12
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    72   1e-12
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    72   1e-12
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    72   2e-12
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    70   2e-12
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    71   3e-12
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    70   4e-12
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    70   5e-12
Scas_502.2                                                             70   5e-12
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    69   6e-12
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    70   6e-12
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    69   7e-12
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    69   9e-12
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    69   1e-11
Scas_458.1                                                             68   1e-11
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    69   1e-11
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    69   2e-11
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    68   2e-11
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    69   2e-11
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    68   2e-11
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    68   2e-11
Kwal_23.6325                                                           68   2e-11
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    67   2e-11
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    68   2e-11
Scas_675.2                                                             67   3e-11
Scas_544.6                                                             67   3e-11
Kwal_26.7355                                                           67   3e-11
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      67   4e-11
Scas_564.7                                                             67   5e-11
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    67   5e-11
Scas_627.7                                                             65   5e-11
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    66   6e-11
Kwal_47.17263                                                          67   7e-11
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    67   7e-11
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    67   7e-11
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    66   7e-11
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    66   7e-11
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    66   7e-11
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       65   9e-11
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            65   9e-11
Scas_616.10                                                            66   1e-10
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    66   1e-10
Kwal_26.7154                                                           66   1e-10
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    66   1e-10
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                63   1e-10
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    65   1e-10
Kwal_26.8709                                                           65   1e-10
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    65   1e-10
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    65   2e-10
Scas_700.34                                                            65   2e-10
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    64   2e-10
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    65   2e-10
Scas_685.24                                                            64   2e-10
Scas_668.22                                                            65   2e-10
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    64   3e-10
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    64   3e-10
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    64   4e-10
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    64   5e-10
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    62   5e-10
CAGL0M10153g complement(1010688..1013291) some similarities with...    64   5e-10
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    64   5e-10
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    64   6e-10
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    63   8e-10
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    62   9e-10
Kwal_56.24584                                                          62   9e-10
Kwal_33.13846                                                          62   9e-10
Scas_688.14                                                            62   1e-09
Scas_493.2                                                             63   1e-09
CAGL0H00979g complement(94328..95527) similar to tr|Q12003 Sacch...    61   1e-09
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         62   1e-09
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    62   1e-09
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    62   2e-09
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         61   2e-09
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    62   2e-09
Kwal_23.5576                                                           61   2e-09
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    61   2e-09
Scas_548.6                                                             62   2e-09
Kwal_26.7861                                                           62   2e-09
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    62   2e-09
KLLA0C16577g complement(1451181..1452695) some similarities with...    61   2e-09
Scas_640.14*                                                           61   2e-09
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    62   2e-09
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    61   2e-09
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    61   2e-09
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    61   2e-09
Scas_711.25                                                            61   3e-09
Scas_477.5                                                             61   3e-09
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            61   3e-09
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    61   3e-09
KLLA0B07205g complement(624606..625973) some similarities with s...    60   3e-09
Scas_584.11                                                            60   4e-09
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    60   4e-09
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    60   4e-09
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    60   4e-09
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    60   6e-09
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    59   6e-09
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    60   6e-09
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         59   7e-09
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    60   7e-09
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    60   8e-09
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    60   8e-09
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    60   9e-09
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    59   9e-09
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    60   9e-09
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    59   9e-09
Kwal_56.24091                                                          59   9e-09
Scas_653.25                                                            59   1e-08
Scas_651.18                                                            59   1e-08
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    59   1e-08
Kwal_23.5668                                                           59   1e-08
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    59   1e-08
CAGL0M08404g complement(836791..838179) some similarities with s...    58   2e-08
Scas_720.94                                                            59   2e-08
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    58   2e-08
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    58   2e-08
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    58   2e-08
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    57   2e-08
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    57   2e-08
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    57   2e-08
Kwal_27.10004                                                          58   3e-08
Scas_629.16                                                            58   3e-08
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    57   3e-08
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            58   3e-08
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    57   3e-08
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             56   3e-08
Scas_683.12                                                            57   3e-08
Kwal_55.20326                                                          57   4e-08
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    57   4e-08
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    57   4e-08
Scas_643.20                                                            57   4e-08
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    57   4e-08
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    57   4e-08
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    57   4e-08
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    57   5e-08
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    56   5e-08
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    56   5e-08
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    56   5e-08
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    57   5e-08
Scas_720.103                                                           57   6e-08
Kwal_33.14192                                                          57   6e-08
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    56   6e-08
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    57   6e-08
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    57   6e-08
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    56   7e-08
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    56   7e-08
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    56   7e-08
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    56   8e-08
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    55   8e-08
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    55   9e-08
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    56   9e-08
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    56   1e-07
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    55   1e-07
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    56   1e-07
Scas_689.25*                                                           55   1e-07
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    55   1e-07
Kwal_56.24059                                                          55   1e-07
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    56   1e-07
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    56   1e-07
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    54   1e-07
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    56   1e-07
Scas_660.20                                                            55   1e-07
Kwal_23.6458                                                           55   1e-07
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    55   1e-07
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    55   2e-07
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    55   2e-07
Kwal_55.20189                                                          55   2e-07
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         55   2e-07
Kwal_55.22001                                                          54   2e-07
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    54   2e-07
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    55   2e-07
Scas_640.16                                                            54   3e-07
Scas_667.18                                                            54   3e-07
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    54   3e-07
Scas_703.5                                                             54   3e-07
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    53   3e-07
Scas_602.11                                                            54   3e-07
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    54   3e-07
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    54   4e-07
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    54   4e-07
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         53   4e-07
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    53   4e-07
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    53   4e-07
KLLA0D09328g complement(788565..791705) some similarities with s...    54   5e-07
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    54   5e-07
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    53   5e-07
Scas_713.7                                                             54   5e-07
Scas_635.1                                                             53   6e-07
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    53   6e-07
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        53   6e-07
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    53   6e-07
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    54   6e-07
Kwal_26.8347                                                           53   6e-07
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    53   7e-07
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    52   7e-07
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    53   7e-07
Kwal_27.9763                                                           53   7e-07
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    53   8e-07
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    53   8e-07
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    52   8e-07
KLLA0C03938g complement(358851..360632) some similarities with s...    53   8e-07
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        53   8e-07
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    52   9e-07
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    53   9e-07
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    52   9e-07
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    52   9e-07
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    53   9e-07
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    53   1e-06
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    52   1e-06
Kwal_26.8941                                                           52   1e-06
Kwal_23.3590                                                           52   1e-06
Kwal_27.12559                                                          52   1e-06
Kwal_26.8703                                                           52   1e-06
Kwal_27.11919                                                          50   1e-06
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    52   1e-06
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    52   1e-06
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    52   2e-06
Kwal_14.2497                                                           52   2e-06
Kwal_33.14434                                                          52   2e-06
Scas_690.13                                                            51   2e-06
Scas_710.28                                                            51   2e-06
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    52   2e-06
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    51   2e-06
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    52   2e-06
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         51   2e-06
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    52   2e-06
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    51   2e-06
Scas_713.21                                                            52   2e-06
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    51   2e-06
Scas_692.24                                                            52   2e-06
Kwal_26.7552                                                           51   2e-06
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    52   3e-06
Kwal_33.14081                                                          51   3e-06
Scas_633.29                                                            51   3e-06
Kwal_14.1416                                                           50   3e-06
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            51   3e-06
Kwal_14.1273                                                           50   3e-06
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    51   3e-06
Kwal_33.14167                                                          51   3e-06
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    51   3e-06
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    51   3e-06
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    51   3e-06
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    51   3e-06
Scas_683.6                                                             50   4e-06
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    51   4e-06
Scas_201.1*                                                            50   4e-06
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    50   4e-06
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            50   4e-06
Scas_718.90                                                            50   4e-06
Scas_628.9                                                             50   4e-06
Scas_721.46                                                            49   5e-06
Kwal_27.10581                                                          50   5e-06
Kwal_47.16761                                                          50   6e-06
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    50   6e-06
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          50   6e-06
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    50   6e-06
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    50   7e-06
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    49   7e-06
Scas_721.61                                                            49   8e-06
Scas_623.11                                                            49   8e-06
Scas_715.34                                                            50   8e-06
Kwal_0.96                                                              49   8e-06
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    50   8e-06
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    49   8e-06
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            49   8e-06
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           50   9e-06
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    50   9e-06
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    49   1e-05
Kwal_47.18307                                                          49   1e-05
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    49   1e-05
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    49   1e-05
Kwal_26.7635                                                           49   1e-05
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    49   1e-05
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    49   1e-05
Kwal_47.17868                                                          49   1e-05
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    49   1e-05
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    49   1e-05
Scas_700.35                                                            49   1e-05
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    49   1e-05
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    49   1e-05
YPL026C (SKS1) [5412] chr16 complement(500671..502179) Serine/th...    49   1e-05
Scas_717.69                                                            49   1e-05
Scas_678.24                                                            49   1e-05
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    49   1e-05
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    48   1e-05
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    49   2e-05
Scas_721.124                                                           49   2e-05
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    48   2e-05
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    48   2e-05
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 48   2e-05
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    49   2e-05
Scas_649.30                                                            49   2e-05
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    48   2e-05
Kwal_56.22788                                                          48   2e-05
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    49   2e-05
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    48   2e-05
Scas_568.9*                                                            47   2e-05
Scas_707.34                                                            49   2e-05
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    48   2e-05
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    48   2e-05
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    48   2e-05
CAGL0K01661g complement(146952..148400) some similarities with t...    48   2e-05
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    48   3e-05
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    48   3e-05
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    48   3e-05
Scas_673.20*                                                           48   3e-05
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    47   4e-05
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    47   4e-05
Scas_619.5*                                                            47   4e-05
Scas_582.1                                                             47   4e-05
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    47   4e-05
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    48   4e-05
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    47   4e-05
Kwal_55.20221                                                          47   4e-05
Kwal_47.17252                                                          47   4e-05
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    47   4e-05
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            47   5e-05
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    47   5e-05
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    47   5e-05
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    46   5e-05
Sklu_2307.1 YPL042C, Contig c2307 215-1945                             47   6e-05
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         47   6e-05
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    47   6e-05
Scas_698.37                                                            46   6e-05
Scas_680.20                                                            47   6e-05
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    47   6e-05
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    47   6e-05
Scas_593.14d                                                           47   7e-05
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    47   7e-05
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    47   7e-05
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    47   7e-05
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    47   7e-05
Scas_697.12                                                            46   8e-05
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    46   8e-05
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    46   8e-05
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    46   8e-05
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    46   8e-05
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    46   8e-05
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    47   8e-05
Scas_610.7                                                             46   9e-05
Kwal_17.2687                                                           46   9e-05
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    46   9e-05
Scas_721.110                                                           46   9e-05
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    46   1e-04
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    45   1e-04
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    46   1e-04
Scas_634.5                                                             46   1e-04
Kwal_27.11777                                                          46   1e-04
Kwal_56.23841                                                          46   1e-04
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    46   1e-04
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    45   1e-04
Scas_613.13*                                                           45   1e-04
Scas_655.2                                                             45   2e-04
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    45   2e-04
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    46   2e-04
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    45   2e-04
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    45   2e-04
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             45   2e-04
KLLA0B06501g complement(576636..579089) some similarities with s...    45   2e-04
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    45   2e-04
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         45   2e-04
Kwal_27.11830                                                          45   2e-04
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    44   2e-04
Kwal_33.13681                                                          45   3e-04
Scas_700.54                                                            45   3e-04
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    45   3e-04
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    45   3e-04
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    44   3e-04
Scas_704.50                                                            44   3e-04
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    44   3e-04
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    44   3e-04
Sklu_2342.5 YMR291W, Contig c2342 6908-8599 reverse complement         45   3e-04
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      44   3e-04
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    44   3e-04
KLLA0E11979g complement(1060048..1061892) some similarities with...    44   3e-04
Sklu_1484.2 YDL108W, Contig c1484 2977-3825 reverse complement         44   3e-04
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    44   4e-04
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    44   4e-04
Kwal_23.3471                                                           43   4e-04
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    44   4e-04
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    44   4e-04
Scas_22.1                                                              43   4e-04
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    44   5e-04
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    44   5e-04
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    44   5e-04
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    44   5e-04
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    44   5e-04
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    44   5e-04
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    44   5e-04
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    44   5e-04
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    44   5e-04
KLLA0D12100g complement(1031728..1033161) some similarities with...    44   6e-04
Scas_618.8                                                             44   6e-04
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    43   6e-04
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    43   7e-04
Kwal_33.13831                                                          44   7e-04
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    44   7e-04
Kwal_26.8796                                                           44   7e-04
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    43   7e-04
Scas_713.38                                                            43   8e-04
Kwal_27.9773                                                           43   8e-04
Scas_651.19                                                            43   8e-04
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    43   9e-04
YPL042C (SSN3) [5397] chr16 complement(473035..474702) Cyclin-de...    43   9e-04
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    43   0.001
Scas_336.1                                                             43   0.001
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    43   0.001
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    43   0.001
CAGL0M08360g complement(833220..835520) some similarities with s...    43   0.001
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    43   0.001
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          42   0.001
Sklu_1436.3 YIL035C, Contig c1436 2418-3536 reverse complement         42   0.001
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    42   0.001
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    42   0.001
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    42   0.001
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    42   0.002
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    42   0.002
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    42   0.002
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    42   0.002
Kwal_14.1159                                                           42   0.002
Sklu_1436.2 , Contig c1436 2420-3329 reverse complement                41   0.002
Kwal_55.21900                                                          42   0.002
Kwal_47.18098                                                          42   0.002
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    42   0.002
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    42   0.002
Scas_684.28                                                            42   0.003
Kwal_14.1249                                                           41   0.003
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    41   0.003
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    41   0.003
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    41   0.003
Scas_689.24                                                            41   0.003
Kwal_27.9804                                                           41   0.003
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    41   0.003
Scas_568.13                                                            41   0.003
Scas_654.12                                                            41   0.003
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    41   0.004
Scas_654.17                                                            41   0.004
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    41   0.004

>KLLA0F18612g 1711131..1713575 some similarities with sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 814

 Score = 1426 bits (3692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/801 (87%), Positives = 702/801 (87%)

Query: 1   MSKSDTISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVK 60
           MSKSDTISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVK
Sbjct: 1   MSKSDTISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVK 60

Query: 61  FLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYD 120
           FLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYD
Sbjct: 61  FLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYD 120

Query: 121 SNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHY 180
           SNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHY
Sbjct: 121 SNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHY 180

Query: 181 LPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYR 240
           LPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYR
Sbjct: 181 LPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYR 240

Query: 241 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKL 300
           SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKL
Sbjct: 241 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKL 300

Query: 301 INLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQ 360
           INLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQ
Sbjct: 301 INLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQ 360

Query: 361 YQMFELYKNEKVTSGDVDKLNDLFIQNFEIAPKQPIDKGIGSVDQQEAPEDLETDIAKMD 420
           YQMFELYKNEKVTSGDVDKLNDLFIQNFEIAPKQPIDKGIGSVDQQEAPEDLETDIAKMD
Sbjct: 361 YQMFELYKNEKVTSGDVDKLNDLFIQNFEIAPKQPIDKGIGSVDQQEAPEDLETDIAKMD 420

Query: 421 ECYPTVEKLESANAKERDDHHXXXXXXXXXXXXXXXXXXXXXXXQVSLDSNERHSSHGIR 480
           ECYPTVEKLESANAKERDDHH                       QVSLDSNERHSSHGIR
Sbjct: 421 ECYPTVEKLESANAKERDDHHLQVLSTSLKQSSSRSISDLSNKSQVSLDSNERHSSHGIR 480

Query: 481 AXXXXXXXXXXXNTANMSAARQHKQHNPFQSQFQPEVDASEYFDANNEQYFKGTPPAHPK 540
           A           NTANMSAARQHKQHNPFQSQFQPEVDASEYFDANNEQYFKGTPPAHPK
Sbjct: 481 APSPLPSSQQPQNTANMSAARQHKQHNPFQSQFQPEVDASEYFDANNEQYFKGTPPAHPK 540

Query: 541 NEKNVSYFQQSPMKENNLNNLSIQQSDQARTFDTTMPISDVPNNGNVVNDEYLIDISPPR 600
           NEKNVSYFQQSPMKENNLNNLSIQQSDQARTFDTTMPISDVPNNGNVVNDEYLIDISPPR
Sbjct: 541 NEKNVSYFQQSPMKENNLNNLSIQQSDQARTFDTTMPISDVPNNGNVVNDEYLIDISPPR 600

Query: 601 NNVPYSTPAAITANMQDQIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTRASL 660
           NNVPYSTPAAITANMQDQII                                  NTRASL
Sbjct: 601 NNVPYSTPAAITANMQDQIISSQPLSQSQSQSKPQPLPPPQPQPQPQPQAQAQPNTRASL 660

Query: 661 RPERQQQIPAQPRLDLTFDQLDLSKNSLTRQXXXXXXXXXXXXXXXXXXXKQPKLKEPVT 720
           RPERQQQIPAQPRLDLTFDQLDLSKNSLTRQ                   KQPKLKEPVT
Sbjct: 661 RPERQQQIPAQPRLDLTFDQLDLSKNSLTRQSDTELEESIISDESISLDLKQPKLKEPVT 720

Query: 721 QPRQTTSPGSESKEFLKPAKVPKRRSLDLKYQEINLSNDDQRKHRKNKXXXXXXXXXXXX 780
           QPRQTTSPGSESKEFLKPAKVPKRRSLDLKYQEINLSNDDQRKHRKNK            
Sbjct: 721 QPRQTTSPGSESKEFLKPAKVPKRRSLDLKYQEINLSNDDQRKHRKNKTSFSRTSVRRSV 780

Query: 781 EMERMKHDSNSTSNSNARDET 801
           EMERMKHDSNSTSNSNARDET
Sbjct: 781 EMERMKHDSNSTSNSNARDET 801

>Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement
          Length = 858

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/424 (69%), Positives = 344/424 (81%), Gaps = 25/424 (5%)

Query: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83
           P    L+P T ++VG+H+ EI+++LAEGGFA+IY VKF+E +NE++    S  LK GD+A
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSS--LKEGDLA 84

Query: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143
           CLKRV+V DENGLNELRNEVE MKQL+ S NIVQYYDSNASR  DGSPG+E+LLLMELCP
Sbjct: 85  CLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCP 144

Query: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203
            KSLLDYMN +LATKL+E E+LKIMYDV+ A+AQMH+LPTPLIHRDIKIENVLVD ++NF
Sbjct: 145 NKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNF 204

Query: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
           KLCDFGSTS CFPI++THQDIA+LTNNIYVHTTPQYR+PEMIDLYRCLPI+EKSDIWALG
Sbjct: 205 KLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALG 264

Query: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMH 323
           IFLYKLLFYTTPFELTGQFAILHSKY+IP N YSSKLINLIIIMLAENP+LRPNIYQV++
Sbjct: 265 IFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNLRPNIYQVIY 324

Query: 324 HVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMFELYKNEKVTSGDVDKLNDL 383
            VC+I+K DVPF DKY+ GPYDF KYS+Y  KLQ  QYQ++  Y  ++    DVD LNDL
Sbjct: 325 QVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQKQ----DVDTLNDL 380

Query: 384 FIQNFEIAPKQPIDKGIGSVDQQEAPEDLET-----------------DIAKMDECYPTV 426
           FI  FEIAPKQP+D  +G  D  E PE+LE                  DI  + + +P+V
Sbjct: 381 FINCFEIAPKQPMD--MGKRDLAEKPENLEKIQNQQDSRKQIPIRDEEDIKMVQQHFPSV 438

Query: 427 EKLE 430
           E LE
Sbjct: 439 EDLE 442

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 13/15 (86%)

Query: 742 PKRRSLDLKYQEINL 756
           P RRSLDLK+QEIN 
Sbjct: 772 PSRRSLDLKFQEINF 786

>Kwal_27.10945
          Length = 935

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/447 (65%), Positives = 344/447 (76%), Gaps = 22/447 (4%)

Query: 1   MSKSDTISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVK 60
           MSKS+T S        ++ S  +P    L   +QV+VG HR EI+++LAEGGFA+IY V+
Sbjct: 43  MSKSETSSHHVVSGLNSSRSGTLPVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVR 102

Query: 61  FLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYD 120
           F+E  NE++  + +  L+ GD+ACLKRV+V DENGLNE+RNEV  MKQL G PNIVQYYD
Sbjct: 103 FIEYANELEQ-VPTIKLEVGDLACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYD 161

Query: 121 SNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHY 180
           S+ASR  DGS GFE+ LLMELCP  SLLDYMN +LATKL+E EILKIM+DV+ A+AQMHY
Sbjct: 162 SHASRARDGSSGFEVTLLMELCPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHY 221

Query: 181 LPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYR 240
           LP PLIHRD+KIENVLVD + NFKLCDFGSTS CFP+ +THQ+IAVLTNNIYVHTTPQYR
Sbjct: 222 LPVPLIHRDVKIENVLVDANHNFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYR 281

Query: 241 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKL 300
           SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYE P N YSSKL
Sbjct: 282 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKL 341

Query: 301 INLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQ 360
           INLIIIMLAENP+LRPNIYQVM ++CSILK   P  DKY+LG Y F KYSQY  KLQ++Q
Sbjct: 342 INLIIIMLAENPNLRPNIYQVMDNLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQ 401

Query: 361 YQMFELYKNEKVTSGDVDKLNDLFIQNFEIAPKQPID-------KGIGSVDQQE---APE 410
           YQM+  Y+N++     +D LND+FI  FE+APKQP+D        G  S   +E    PE
Sbjct: 402 YQMYLAYENKQ----QIDTLNDMFINCFEVAPKQPVDISDKKWASGPSSYKTRENKTVPE 457

Query: 411 ---DL----ETDIAKMDECYPTVEKLE 430
              D+    E DI  + + +P+VE L+
Sbjct: 458 VNPDVTLAGEEDIGLVQQQFPSVEDLD 484

>Scas_661.27
          Length = 1095

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/423 (65%), Positives = 333/423 (78%), Gaps = 9/423 (2%)

Query: 6   TISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELT 65
           T S P SV +T       PN+   +P TQV VG H+ EI++++AEGGFA IY VKF+E  
Sbjct: 3   TTSGPVSVNNTTVK----PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFL 58

Query: 66  NEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASR 125
           NE +       L+ GD+ACLKRV+V DENGLNE+RNEVE MKQL+G+PNIVQYYDSNASR
Sbjct: 59  NEFENNRMKPKLQMGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASR 118

Query: 126 HPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPL 185
             +G PGFE+LLLMELCP KSLLDYMN +LATKLTE EILKIMYDV+ A++QMHYLPTPL
Sbjct: 119 RHNGFPGFEVLLLMELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPL 178

Query: 186 IHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI 245
           +HRDIKIENVLVD  +NFKLCDFGSTS  FP+V+THQDIAVLT NIYVHTTPQYRSPEMI
Sbjct: 179 LHRDIKIENVLVDAQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMI 238

Query: 246 DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLII 305
           DLYRCLPI+EKSDIWALGIFLYKLLF+TTPFELTGQFAILHSKYE P+N YSSKLINLII
Sbjct: 239 DLYRCLPIDEKSDIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLII 298

Query: 306 IMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMFE 365
           IMLAENP+LRPNIYQV+H++CSI    VP  D+Y  GPYDF KY+ +  K+Q +QYQ++ 
Sbjct: 299 IMLAENPNLRPNIYQVLHNICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVQYQLYL 358

Query: 366 LYK-----NEKVTSGDVDKLNDLFIQNFEIAPKQPIDKGIGSVDQQEAPEDLETDIAKMD 420
           L +     N K+   D++ LNDLF+ +F+IA K P +  + +     + E  E++ AK +
Sbjct: 359 LQEKKFKTNGKLPQADINLLNDLFVTSFDIASKVPFELKVPTPLPGYSAEIPESNFAKQE 418

Query: 421 ECY 423
           + Y
Sbjct: 419 QQY 421

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%)

Query: 741 VPKRRSLDLKYQEINLSNDDQRKHRKN 767
           +  RRSLDL+YQEIN S  D RK + N
Sbjct: 933 ITGRRSLDLRYQEINFS-PDLRKDKSN 958

>YBR059C (AKL1) [250] chr2 complement(356821..360147)
           Serine/threonine protein kinase of unknown function
           [3327 bp, 1108 aa]
          Length = 1108

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/390 (68%), Positives = 316/390 (81%), Gaps = 7/390 (1%)

Query: 18  ATSAMI-PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKL 76
           + SAM  P     +P   V VGTH+ E++ +LAEGGFA IY VKFLE  NE D    S  
Sbjct: 10  SVSAMGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFD-NTASVP 68

Query: 77  LKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEIL 136
           LK GD+ACLKRV+V DENGLNE+RNEVE MK+L+G+PNIVQY+DSNASR  DG  GFE+L
Sbjct: 69  LKIGDVACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVL 128

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           LLMELCP KSLLDYMN +L+TKLTEAEI+KIMYDV+ +I+QMHYLP  LIHRDIKIENVL
Sbjct: 129 LLMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVL 188

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 256
           VD  +NFKL DFGSTS CFPIV+THQDIA+LT NIYVHTTPQYRSPEMIDLYRCLPINEK
Sbjct: 189 VDAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEK 248

Query: 257 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRP 316
           SDIWALG+FLYKLLF+TTPFE+TGQFAILHSKYE P N YSSKLINLIIIMLAENP+LRP
Sbjct: 249 SDIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPVNKYSSKLINLIIIMLAENPNLRP 308

Query: 317 NIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMFEL-----YKNEK 371
           NIYQV++H+C IL  +VP  DKY  G Y+F+KY+Q+  KLQ +Q QM++L      +N K
Sbjct: 309 NIYQVLYHLCEILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKIMQNNK 368

Query: 372 VTSGDVDKLNDLFIQNFEIAPKQPIDKGIG 401
           ++  + + LND+F+ +FEI+ K P++   G
Sbjct: 369 LSDSEENLLNDMFLSSFEISSKLPMNASDG 398

>AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH]
           (763309..766194) [2886 bp, 961 aa]
          Length = 961

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/407 (65%), Positives = 318/407 (78%), Gaps = 2/407 (0%)

Query: 1   MSKSDTISRPNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVK 60
           MSK  T  + +       T A+     +L   + V+VG H+ E++E+LAEGGFA+IYKV 
Sbjct: 1   MSKRHTGEQSSPTEPVPGTGALTGPLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVS 60

Query: 61  FLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYD 120
           F+  TNE+D     ++L+ GD  CLKRV V DENGLNELRNEVE MK+LR   NIVQYYD
Sbjct: 61  FVGYTNELDR--QDRILQPGDTVCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYD 118

Query: 121 SNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHY 180
           SNASR  DG PG+E+LLLMELCP  SLLDYMN +LATKL+EAE+LKIMYD++  ++ MHY
Sbjct: 119 SNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHY 178

Query: 181 LPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYR 240
             TPLIHRDIKIENVLVD D+NFKLCDFGSTS C P V++HQ+IA+L NNIYVHTTPQYR
Sbjct: 179 QRTPLIHRDIKIENVLVDADNNFKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYR 238

Query: 241 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKL 300
           SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIP+N +SSKL
Sbjct: 239 SPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPRNSFSSKL 298

Query: 301 INLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQ 360
           INL+IIMLAENP LRPN+YQVM+H+CS+++C+V   D Y  GPY+F  Y +Y  KLQ++Q
Sbjct: 299 INLVIIMLAENPYLRPNVYQVMYHICSMMECEVKIDDLYGQGPYNFDMYGRYQEKLQRLQ 358

Query: 361 YQMFELYKNEKVTSGDVDKLNDLFIQNFEIAPKQPIDKGIGSVDQQE 407
           Y M   ++  +    + DK+NDLFI  FE APKQP+  G  +V QQ+
Sbjct: 359 YDMLMSHQLAQRGIINTDKVNDLFISTFECAPKQPMVMGQNAVAQQQ 405

>CAGL0H10208g complement(996853..999936) similar to sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 1027

 Score =  525 bits (1353), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 255/395 (64%), Positives = 306/395 (77%), Gaps = 10/395 (2%)

Query: 7   ISRPNSVAHTAATSAMIPNSHLLSPNTQVV-VGTHRCEILEHLAEGGFANIYKVKFLELT 65
           + RPNS + T+  S   PN     PN Q++ VG HR EI+ +LAEGGFA IY VKF+E  
Sbjct: 1   MERPNSRSMTSLNS---PNEEKY-PNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYL 56

Query: 66  NEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASR 125
           NE ++      +  GDIACLKRVIV DE GLNE+RNEVE MK+L+ SPNIVQY+DSNASR
Sbjct: 57  NEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASR 116

Query: 126 HPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPL 185
             DG PGFE+LLLMELCP KSLLDYMN +L TKL+E+EILKIMYDVS  I+ MHYL  PL
Sbjct: 117 RTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPL 176

Query: 186 IHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI 245
           IHRDIKIENVLVD ++NFKLCD GSTS C P + ++QDIA++T NIYVHTTPQYR+PEMI
Sbjct: 177 IHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI 236

Query: 246 DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLII 305
           DLYR LPINEKSDIWALGIFLYKLLFYTTPFE+TGQ AILHSKY+ P N YSSK+INLII
Sbjct: 237 DLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLII 296

Query: 306 IMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMFE 365
           IMLAENP+LRPNI+QV++H+CSI+   VP  D+Y LGPY+F  Y+++  K+Q IQ Q+  
Sbjct: 297 IMLAENPNLRPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINY 356

Query: 366 LY-----KNEKVTSGDVDKLNDLFIQNFEIAPKQP 395
           L         K++  D   L++L+I+ FE+ PK P
Sbjct: 357 LQNKVVSSKSKLSKEDGLVLDELYIKTFEMIPKIP 391

>CAGL0K11990g complement(1155395..1158370) some similarities with
           sp|P38080 Saccharomyces cerevisiae YBR059c AKL1
           Ark-family Kinase-Like protein, hypothetical start
          Length = 991

 Score =  494 bits (1273), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 233/377 (61%), Positives = 292/377 (77%), Gaps = 15/377 (3%)

Query: 35  VVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKL---LKAGDIACLKRVIVP 91
           V VG+HR E++ +LAEGGFA IY VKF+E TNE +   D  +   LK G  ACLKRV+V 
Sbjct: 102 VTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLVQ 161

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSP----GFEILLLMELCPKKSL 147
           DE GLN++R+EVE MK+L+G+PNIVQY+DSNASR  D S     GFE+LLLMELCP KSL
Sbjct: 162 DEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPNKSL 221

Query: 148 LDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCD 207
           LDYMN +LATKLTE EI KIMYD++ A+AQMHYLP PLIHRDIKIENVLVD ++NFKLCD
Sbjct: 222 LDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFKLCD 281

Query: 208 FGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 267
           FGSTS CFP  ++ QDIA+L+ ++Y+HTTPQYRSPEMIDL++ +PINEKSDIWALG+FLY
Sbjct: 282 FGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGVFLY 341

Query: 268 KLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCS 327
           KLLF+TTPFE TGQFA+LHSK+E P N YSSKLINLII+MLAENPSLRPNIYQV++++  
Sbjct: 342 KLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNIYQVLYYLSE 401

Query: 328 ILKCDVP---FTDKYELGPYDFAKYSQYHLKLQQIQYQMFELYK-----NEKVTSGDVDK 379
           +   +VP    +DKY  GPY+F KY+++  + QQ+Q Q+  L       N  +   D + 
Sbjct: 402 VTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLSTLQAKINDPNSTMQPADWEL 461

Query: 380 LNDLFIQNFEIAPKQPI 396
            + +++  F I P+ P+
Sbjct: 462 YDRMYMSAFTIVPQLPV 478

>Kwal_27.11542
          Length = 791

 Score =  315 bits (806), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 207/319 (64%), Gaps = 11/319 (3%)

Query: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83
           P+S + +  T + VG+H+  I+++L  GGFA+IY     E++      I       G++A
Sbjct: 4   PSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSA---EISPADPNSI-------GNVA 53

Query: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143
           CLKRV+VPD+  LN LR EV+ MK LRG+ ++V Y DS+A++       +E+ LLME C 
Sbjct: 54  CLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCS 113

Query: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203
              L+D+MN +L  +LTE E+LKIM D++  IA MH L  PLIHRDIKIENVL+  D  F
Sbjct: 114 AGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTF 173

Query: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
           K+CDFGS           Q+ + + N+I  +TT QYRSPEMIDLYR  PINEKSDIWALG
Sbjct: 174 KVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALG 233

Query: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVM 322
           +FLYKL +YTTPFE  G  AILHS+++ P    YS +L NLI +ML+ENP+ RPNI QV+
Sbjct: 234 VFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVL 293

Query: 323 HHVCSILKCDVPFTDKYEL 341
             V  I     P  + Y L
Sbjct: 294 EEVSRIQNVPCPLRNFYLL 312

>CAGL0G02607g complement(240244..242310) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1, start by
           similarity
          Length = 688

 Score =  300 bits (768), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 164/374 (43%), Positives = 224/374 (59%), Gaps = 21/374 (5%)

Query: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91
            TQ+ VGTH  +IL++L  GGFA IY V+ L +           L    ++ACLKRV VP
Sbjct: 12  GTQLTVGTHSVKILKYLTSGGFAQIYAVEILSM----------GLFNGSNVACLKRVKVP 61

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
           D+  LN LR EV+ MK L  + ++V Y DS+A+R P     +E+ LLME C    L+D+M
Sbjct: 62  DKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDFM 121

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
           N +L  +LTE EIL IM   +  IA MH L  PL+HRDIKIENVL+ K   +K+CDFGS 
Sbjct: 122 NTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGSV 181

Query: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
           S         Q++  + ++I  +TT QYR PEM+DLYR LPI+EK+DIWALG+FLYKL +
Sbjct: 182 SGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLCY 241

Query: 272 YTTPFELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILK 330
           YTTPFE  G+ AILH++++ P    YS +L NLI  ML E+PS RPN+ QV+  V  +  
Sbjct: 242 YTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQN 301

Query: 331 CDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMFELYKNEKVTSGDVDKLNDLFIQNFEI 390
              P  + Y L   +  K S       +I Y   +L   +K+ +   D L++  I+   I
Sbjct: 302 VPCPIRNFYLLRAMEKVKLS------TEIDYPQLQL---QKLRNAQADNLSNPMIKPMPI 352

Query: 391 APKQPIDKGIGSVD 404
           A ++P   G G V+
Sbjct: 353 A-QRPTFSGNGMVN 365

>Scas_601.6
          Length = 661

 Score =  294 bits (753), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 202/317 (63%), Gaps = 19/317 (5%)

Query: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFL---ELTNEMDAGIDSKLLKAG 80
           P   L  P T + VG+H+ +++++L  GGFA IY V+     + TN              
Sbjct: 4   PQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNT------------- 50

Query: 81  DIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLME 140
           ++ACLKRVIVPD+  LN LR EV+TMK LR + ++V Y DS+A++       +E+ LLME
Sbjct: 51  NVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLME 110

Query: 141 LCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKD 200
            C    L+D+MN +L  +L E EIL IM  V+  IA MH L  PL+HRDIKIENVL+   
Sbjct: 111 YCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSK 170

Query: 201 DNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 260
             +K+CDFGS        S  Q+++ + ++I  +TT QYR+PEMIDLYR LPI+EKSDIW
Sbjct: 171 GEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIW 230

Query: 261 ALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIY 319
           ALG+FLYKL +YTTPFE  G+ AILH+ ++ P    YS +L  LI  ML E PS RPN Y
Sbjct: 231 ALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSY 290

Query: 320 QVMHHVCSI--LKCDVP 334
           QV+  V S+  ++C +P
Sbjct: 291 QVLEEVSSMQNVQCPIP 307

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score =  295 bits (756), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 196/309 (63%), Gaps = 12/309 (3%)

Query: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91
            T + VG+H+  I+++L  GGFA+IY            A I      +  IACLKRV+VP
Sbjct: 12  GTVLTVGSHKARIIKYLTSGGFAHIY-----------SAEISPPDPNSSSIACLKRVLVP 60

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
           D+  LN LR EV+ MK L+    +V Y DS+A++    +  +E+ LLME C +  L+D+M
Sbjct: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
           N +L  +L E E+LKIM  VS  +A MH L  PLIHRDIKIENVL+ +D NFK+CDFGS 
Sbjct: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180

Query: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
                     Q++  + ++I  +TT QYRSPEMIDLYR LP++EKSDIWALG+FLYKL +
Sbjct: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240

Query: 272 YTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILK 330
           YTTPFE  G+ AILHSK++ P    YS +L NLI  +L ENP  RPNI Q++  V  I  
Sbjct: 241 YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300

Query: 331 CDVPFTDKY 339
              P  + Y
Sbjct: 301 VPCPVKNFY 309

>ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C
           (ARK1) - SH] complement(321493..323745) [2253 bp, 750
           aa]
          Length = 750

 Score =  293 bits (750), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 199/312 (63%), Gaps = 12/312 (3%)

Query: 29  LSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRV 88
           L P   + VG+H  +I+++L  GGFA IY  + L           S     G +ACLKRV
Sbjct: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL-----------SPGPIQGSLACLKRV 57

Query: 89  IVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLL 148
            VPD+  LN LR EV+ MK L+G  ++V Y DS+A++ P     +E+ LLME C +  L+
Sbjct: 58  HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLI 117

Query: 149 DYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDF 208
           D+MN++L T+L+E E+LKIM  V+  I  MH L  PLIHRDIKIENVL+  D +FK+CDF
Sbjct: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177

Query: 209 GSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 268
           GS S          +   + ++I  +TT QYR+PEMIDLYR LP++EKSDIWALG+FLYK
Sbjct: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237

Query: 269 LLFYTTPFELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCS 327
           + ++TTPFE  G+ AIL +K++ P    Y+ +L NLI +ML+E+P  RPNI QV+  V  
Sbjct: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297

Query: 328 ILKCDVPFTDKY 339
           I     P  + Y
Sbjct: 298 IQGVPCPLPNFY 309

>YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization [2433 bp, 810 aa]
          Length = 810

 Score =  293 bits (751), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 200/319 (62%), Gaps = 12/319 (3%)

Query: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83
           P   L  P T + VG+H  +I+++L  GGFA +Y  +        +A          +IA
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNA----------NIA 53

Query: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143
           CLKRVIVP + GLN LR EV+ MK LR + ++V Y DS+A+R  +G   +E+ +LME C 
Sbjct: 54  CLKRVIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGI-AYEVFVLMEFCE 112

Query: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203
           +  L+D+MN +L  +L E+EIL+IM      I  MH L  PLIHRDIKIENVL+  D  +
Sbjct: 113 RGGLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLY 172

Query: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
           K+CDFGS S         Q+   + ++I  +TT QYRSPEMIDLYR LPI+EKSDIWALG
Sbjct: 173 KVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALG 232

Query: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVM 322
           +FLYK+ +YTTPFE +G+  ILH++Y+ P    YS +L NLI +ML E PS RPNI QV+
Sbjct: 233 VFLYKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVL 292

Query: 323 HHVCSILKCDVPFTDKYEL 341
             V  +     P  + Y L
Sbjct: 293 EEVSRLQNKPCPIRNFYLL 311

>KLLA0E08371g complement(756205..758538) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1 serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization, start by similarity
          Length = 777

 Score =  290 bits (742), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 198/311 (63%), Gaps = 11/311 (3%)

Query: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91
            T + VG+H+ ++L++LA GGFA++Y V   E++       D       ++ACLKRV+VP
Sbjct: 12  GTILPVGSHQVKVLKYLASGGFAHVYSV---EISPPDPVCPD-------NVACLKRVVVP 61

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
           D+  LN LR EV++MK LRG+  IV Y DS+A++ P     +E+ LLME C    L+D+M
Sbjct: 62  DKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDFM 121

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
           N +L  +L E EIL IM  VS  +A MH L  PLIHRDIKIENVL+ K+  FKLCDFGS 
Sbjct: 122 NTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGSV 181

Query: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
           S         ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIWALG+FLYK  +
Sbjct: 182 SGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTCY 241

Query: 272 YTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILK 330
           YTTPFE  G+ AIL SK+E P    YS ++ NLI +ML  +P  RPNI QV+  V  I  
Sbjct: 242 YTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQG 301

Query: 331 CDVPFTDKYEL 341
              P  + Y L
Sbjct: 302 IPCPIKNFYLL 312

>Scas_671.16
          Length = 723

 Score =  287 bits (735), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 196/317 (61%), Gaps = 11/317 (3%)

Query: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83
           PN     P T + VG+H C+I+++L  GGFA IY  +   +    ++            A
Sbjct: 4   PNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNS----------QTA 53

Query: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143
           CLKRVIVPD+ GLN LR EV+ MK L+ + ++V Y DS+A+R    +  +E+ LLME C 
Sbjct: 54  CLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCK 113

Query: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203
              L+D+MN +L  +LTE EIL I+      ++ MH L   LIHRDIKIENVL+     F
Sbjct: 114 GGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEF 173

Query: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
           K+CDFGS           Q++A + +++  +TT QYR+PEM+DLYR LPINEKSDIWALG
Sbjct: 174 KICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALG 233

Query: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVM 322
           +FLYKL +YTTPFE  G+ AILHS+Y+ P    Y+ KL NLI   L E+PS RPNI Q++
Sbjct: 234 VFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLL 293

Query: 323 HHVCSILKCDVPFTDKY 339
             +  I     P  + Y
Sbjct: 294 EEISRIQGIPCPINNFY 310

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score =  278 bits (710), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 141/306 (46%), Positives = 194/306 (63%), Gaps = 11/306 (3%)

Query: 33  TQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPD 92
           TQ+ VG+H+ EI+++L  GGFA +Y      L N  D   +S       +ACLKRVIVPD
Sbjct: 13  TQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPDPHSNS------SVACLKRVIVPD 62

Query: 93  ENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN 152
           +  LN LR EV+ M+ L+ +  +V Y DS+A++    +  +E+ +LME C +  L+D+MN
Sbjct: 63  KPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMN 122

Query: 153 NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
            +L  +L E EIL+IM  V+  +A MH L  PLIHRDIKIENVL+  ++ +KLCDFGS  
Sbjct: 123 TRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVC 182

Query: 213 MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272
                    Q+++ +  +I  +TT QYRSPEMID +R LPI+EKSDIWALGIFLYKL +Y
Sbjct: 183 GIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYY 242

Query: 273 TTPFELTGQFAILHSKYEIP-QNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKC 331
           TTPFE  G  AIL  K+E P    YS +L  LI  +L ++P  RPN+YQ++  +  +   
Sbjct: 243 TTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNV 302

Query: 332 DVPFTD 337
             P  D
Sbjct: 303 PCPIND 308

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score =  276 bits (706), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 195/308 (63%), Gaps = 15/308 (4%)

Query: 31  PNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIV 90
           P T V VG+H   IL++L  GG+A IY  + +     +            ++A LKRVIV
Sbjct: 11  PGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFL----------GTNMAVLKRVIV 60

Query: 91  PDENGLNELRNEVETMKQLRGSPNIVQYYDSNA--SRHPDGSPGFEILLLMELCPKKSLL 148
           PD++ LN LR EV+ MK+L+    IV Y DS+A  S++ DG+  +E+ L+ME C +  L+
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT--YEVFLIMEYCSRGGLI 118

Query: 149 DYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDF 208
           D+MN +L  +LTE EIL I   +S  +A MH L  PLIHRDIKIENVL+  D  +KLCDF
Sbjct: 119 DFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDF 178

Query: 209 GSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 268
           GS S       T +++A + ++I + TT QYR+PEM+DL +   +N+KSDIWALG+FLYK
Sbjct: 179 GSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYK 238

Query: 269 LLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCS 327
           L +YTTPFE TG+  IL+   E P    YS  +  LI+ MLA+NP  RPNI+Q++  V  
Sbjct: 239 LCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSK 298

Query: 328 ILKCDVPF 335
           +L  + P 
Sbjct: 299 LLNVNCPI 306

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  100 bits (250), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 153/326 (46%), Gaps = 58/326 (17%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMK 107
           L EGGFA  +++K        D G   K+  A  +A L    +  E    +L +E++  K
Sbjct: 96  LGEGGFARCFQMK-------DDKG---KVFAAKTVAKLS---IKSEKTRRKLLSEIQIHK 142

Query: 108 QLRGSPNIVQYYDSNASRHPDGSPGFE----ILLLMELCPKKSLLDYMNNKLATKLTEAE 163
            ++  PNIVQ+ D            FE    + +L+E+CP  S+++ +  +    LTE E
Sbjct: 143 SMK-HPNIVQFTDC-----------FEDDTNVYILLEICPNGSVMELLRQR--KHLTEPE 188

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
           +   M  +  AI  MH     +IHRD+K+ N+  DK+ N K+ DFG              
Sbjct: 189 VRFCMIQIIGAIRYMH--SRRVIHRDLKLGNIFFDKEYNLKIGDFGLA------------ 234

Query: 224 IAVLTNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL- 278
            AVL N+      +  TP Y +PE++   +    + + DIW++G+ LY LLF   PF+  
Sbjct: 235 -AVLANDKERKYTICGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAK 292

Query: 279 ---TGQFAILHSKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVMHHVC--SILKCD 332
              T    I    +  P +   SS   NLI  +L  NP+ RP++Y++  +V   +     
Sbjct: 293 EVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSR 352

Query: 333 VPFTDKYELGPYDFAKYSQYHLKLQQ 358
           +P T   E+  +D   +S+  + L+Q
Sbjct: 353 LPSTITKEIPNFDHLSFSESLINLKQ 378

>Scas_644.15
          Length = 726

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 137/292 (46%), Gaps = 58/292 (19%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMK 107
           L EGGFA  +++K     +E       K+  A  +A   ++ +  E    +L +E++  K
Sbjct: 98  LGEGGFARCFQIK-----DE-----SGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHK 144

Query: 108 QLRGSPNIVQYYDSNASRHPDGSPGFE----ILLLMELCPKKSLLDYMNNKLATKLTEAE 163
            ++  PNIV + D            FE    + +L+E+C   SL+D M  +    LTE E
Sbjct: 145 SMK-HPNIVHFVDC-----------FEDDTNVYILLEICSNGSLMDLMKKR--KTLTEPE 190

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
           +      +  A+  MH     +IHRD+K+ N+  DKD N K+ DFG              
Sbjct: 191 VRFFTTQICGAVKYMH--SRRVIHRDLKLGNIFFDKDYNLKVGDFGLA------------ 236

Query: 224 IAVLTNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELT 279
            AVL NN      V  TP Y +PE++ + +    + + DIW++G+ +Y LL    PF+  
Sbjct: 237 -AVLANNRERKYTVCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQ-A 293

Query: 280 GQFAILHSKYEIPQNGY------SSKLINLIIIMLAENPSLRPNIYQVMHHV 325
               +++ + +  Q GY      SS+   LI  +L  +P  RP+I +++  V
Sbjct: 294 KDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 138/291 (47%), Gaps = 56/291 (19%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMK 107
           L EGGFA  +++K        D+G   K+  A  +A   ++ +  E    +L +E++  K
Sbjct: 79  LGEGGFARCFQMK-------DDSG---KVFAAKTVA---KISIKSEKTRKKLLSEIQIHK 125

Query: 108 QLRGSPNIVQYYDSNASRHPDGSPGFE----ILLLMELCPKKSLLDYMNNKLATKLTEAE 163
            ++  PNIVQ+ D            FE    + +L+E+CP  SL+D +  +   +LTE E
Sbjct: 126 SMK-HPNIVQFTDC-----------FEDDTNVYILLEICPNGSLMDLLKQR--KQLTEPE 171

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
           +      +  AI  MH     +IHRD+K+ N+  DK  N K+ DFG              
Sbjct: 172 VRFFTTQIVGAIKYMH--SRRIIHRDLKLGNIFFDKHFNLKIGDFGLA------------ 217

Query: 224 IAVLTNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELT 279
            AVL N+      +  TP Y +PE++   +    + + DIW++G+ +Y LL    PF+  
Sbjct: 218 -AVLANDRERKYTICGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQAK 275

Query: 280 GQFAILH----SKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVMHHV 325
               I        +  P++   SS+   LI  +L+ +P  RP++ ++M +V
Sbjct: 276 EVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>Sklu_2419.9 YMR001C, Contig c2419 14049-16136
          Length = 695

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 140/292 (47%), Gaps = 58/292 (19%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMK 107
           L EGGFA  +++K        D+G   K+  A  +A   ++ +  E    +L +E++  K
Sbjct: 83  LGEGGFARCFQMK-------DDSG---KIFAAKTVA---KISIKSEKTRKKLLSEIQIHK 129

Query: 108 QLRGSPNIVQYYDSNASRHPDGSPGFE----ILLLMELCPKKSLLDYMNNKLATKLTEAE 163
            ++  PNIVQ+ D            FE    + +L+E+CP  SL+D +  +    LTE E
Sbjct: 130 SMK-HPNIVQFIDC-----------FEDDTNVYILLEICPNGSLMDLLKKRKV--LTEPE 175

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
           +      +  AI  MH     +IHRD+K+ N+  D + N K+ DFG              
Sbjct: 176 VRYFTTQIVGAIKYMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLA------------ 221

Query: 224 IAVLTNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELT 279
            AVL N+      V  TP Y +PE++         E  DIW++G+ +Y LL    PF+  
Sbjct: 222 -AVLANDRERKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-A 278

Query: 280 GQFAILHSK-----YEIPQNGYSSKLINLIII-MLAENPSLRPNIYQVMHHV 325
            +  I++ +     Y  P+   +SK + ++I  +L+ +P  RP++ ++M +V
Sbjct: 279 KEVNIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 137/297 (46%), Gaps = 59/297 (19%)

Query: 37  VGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGL 96
           VG ++  IL+ + EG F  +Y    L L       +           CLK     D+N  
Sbjct: 38  VGNYK--ILKQIGEGSFGKVY----LALHRPTHRKV-----------CLK---TSDKNDP 77

Query: 97  NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA 156
           N +R EV   +Q    P I + Y+   +         ++ + +E CP K L D++ +   
Sbjct: 78  NIVR-EVFYHRQF-DFPYITKLYEVIVTES-------KVWMALEYCPGKELYDHLLSLRR 128

Query: 157 TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216
             L E    ++   +S A+   H +    +HRD+K+EN+L+DK+ N KL DFG T  C  
Sbjct: 129 ISLLECG--ELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTRECMT 184

Query: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
             +             V  T  Y +PE+I+  R      K DIW+LG+ LY L+    PF
Sbjct: 185 KTTLET----------VCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILYTLITGYLPF 232

Query: 277 ----ELTGQFAILHSKYEIPQNGYSSKLI-----NLIIIMLAENPSLRPNIYQVMHH 324
               E   ++ I++   E P+  Y +K+I     +LI  +LA+NP  RP++ QV+ H
Sbjct: 233 DDDDEAKTKWKIVN---EEPK--YDAKVIPDDARDLISRLLAKNPGERPSLSQVLRH 284

>Scas_700.28
          Length = 896

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 100/195 (51%), Gaps = 20/195 (10%)

Query: 134 EILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           ++ + +E CP K L D + +    ++   E +++   +   +   H L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 194 NVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 253
           N+L+DK  + KL DFG T  C    +             +  T  Y +PE+I+  R    
Sbjct: 159 NILLDKSGDAKLTDFGFTRECMTKTTLET----------ICGTTVYMAPELIE--RKSYD 206

Query: 254 NEKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPQNGYSSKLINLIIIMLA 309
             K DIW+LG+ LY ++  + PF    E   ++ I+H   ++ +N  ++   +LI+ +LA
Sbjct: 207 GFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRLLA 266

Query: 310 ENPSLRPNIYQVMHH 324
           +NP+ RP + Q++ H
Sbjct: 267 KNPNDRPTVEQILKH 281

>Kwal_56.22476
          Length = 697

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 140/292 (47%), Gaps = 58/292 (19%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMK 107
           L EGGFA  +++K        D G   K+  A  +A   ++ +  E    +L +E++  K
Sbjct: 85  LGEGGFARCFQIK--------DDG--GKIFAAKTVA---KISIKSEKTRKKLLSEIQIHK 131

Query: 108 QLRGSPNIVQYYDSNASRHPDGSPGFE----ILLLMELCPKKSLLDYMNNKLATKLTEAE 163
            +R + NIVQ+ D            FE    + +L+E+CP  SL+D +  +    LTE E
Sbjct: 132 SMRHT-NIVQFVDC-----------FEDDTNVYILLEICPNGSLMDLLKRR--KMLTEPE 177

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
           +      +  A+  MH     +IHRD+K+ N+  DK  N K+ DFG              
Sbjct: 178 VRFFTTQIVGAVKYMH--SRRVIHRDLKLGNIFFDKHYNLKVGDFGLA------------ 223

Query: 224 IAVLTNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELT 279
            AVL N+      V  TP Y +PE++   +    + + DIW+ G+ +Y LL    PF+  
Sbjct: 224 -AVLANDRERKYTVCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-A 280

Query: 280 GQFAILHSK-----YEIPQNGY-SSKLINLIIIMLAENPSLRPNIYQVMHHV 325
            +  I++ +     +  P++ + S + + LI  +L+ +P  RP++ +++ +V
Sbjct: 281 KEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement
          Length = 364

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 144/356 (40%), Gaps = 83/356 (23%)

Query: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91
           N+ V++      I   L EGGF+ +Y V+  E                 D+  LK++  P
Sbjct: 18  NSSVLINGQHYAIQRLLGEGGFSFVYLVQSRE---------------NNDLFALKKIHCP 62

Query: 92  DEN--GLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLD 149
             N   ++E   EV + K+ R SP I     S   +  DGS    + +L+   P  SLLD
Sbjct: 63  FGNIESVSEAMREVNSYKKFR-SPYITHCVSSQVLQEQDGSK--TVFILLPYFPTGSLLD 119

Query: 150 YMNNKL--ATKLTEAEI------------------------------------------- 164
            +N  L   T ++E EI                                           
Sbjct: 120 KINTHLLDGTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMT 179

Query: 165 ----LKIMYD------VSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMC 214
               L+++ D      +S   +      T   H+DIK  N++   D    +CD GS S  
Sbjct: 180 YNEDLRLLNDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRA 239

Query: 215 FPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 274
              +S+   +         H T  +RSPE++++     I+EK DIW+LG  LY + F  +
Sbjct: 240 HVDISSRSQLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGIS 299

Query: 275 PFE----LTGQ---FAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVM 322
           PFE    L+G    +AI   K+ IP N  YS +LI +I   +  +   RP+I +++
Sbjct: 300 PFEREEQLSGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELL 355

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 142/298 (47%), Gaps = 64/298 (21%)

Query: 46  EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVET 105
           + L EGGFA  +++K        D+G   K+  A  +A   ++ +  E    +L +E++ 
Sbjct: 85  QFLGEGGFARCFQIK-------DDSG---KIFAAKTVA---KISIKSEKTRKKLLSEIQI 131

Query: 106 MKQLRGSPNIVQYYDSNASRHPDGSPGFE----ILLLMELCPKKSLLDYMNNKLATKLTE 161
            K +  + NIVQ+ D            FE    + +L+E+CP  SL++ +  +    +TE
Sbjct: 132 HKSMSHT-NIVQFIDC-----------FEDNVNVYILLEICPNGSLMELIKKR--KTITE 177

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTH 221
            E+   M  +   I  MH     +IHRD+K+ N+  D+  N K+ DFG            
Sbjct: 178 PEVRFFMTQICGGIQYMH--SNRVIHRDLKLGNIFFDEHYNLKIGDFGLA---------- 225

Query: 222 QDIAVLTNN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
              AVL N+      +  TP Y +PE++ + +    + + DIW++G+ LY LL    PF 
Sbjct: 226 ---AVLANDRERKFTICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPF- 280

Query: 278 LTGQFAILHSKYE-IPQNGYS---SKLIN-----LIIIMLAENPSLRPNIYQVMHHVC 326
              Q   +++ YE I Q  ++    K I+     LI  +L+ NP  RP+I ++M +V 
Sbjct: 281 ---QAKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVW 335

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 104/204 (50%), Gaps = 38/204 (18%)

Query: 134 EILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           ++ + +E CP K L D++ +K  ++L   E  ++   ++ A+   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 194 NVLVDKDDNFKLCDFGST--SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCL 251
           NVL+DK+ N KL DFG T  SM   ++ T            V  T  Y +PEMI   +  
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLET------------VCGTTVYMAPEMI---QHK 207

Query: 252 PINE-KSDIWALGIFLYKLLFYTTPFE-----LTGQFAI-----LHSKYEIPQNGYSSKL 300
           P +  K DIW+LG+ LY LL    PF+     LT Q  I     +  +  IP+       
Sbjct: 208 PYDGFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPE------A 261

Query: 301 INLIIIMLAENPSLRPNIYQVMHH 324
            NLI  +L+++P+ RPN   ++ H
Sbjct: 262 QNLIEQLLSKDPTERPNTSAILLH 285

>Kwal_56.24274
          Length = 346

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 142/335 (42%), Gaps = 66/335 (19%)

Query: 35  VVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP--D 92
           V +   +  I + L EGG + +Y V+                 K G++  LK+   P   
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVYLVES----------------KEGELFALKKTRCPFGS 62

Query: 93  ENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN 152
              ++    EV   ++   SP I Q  DS   +  DGS    + +L+    K SL D +N
Sbjct: 63  IGSISPAMKEVANYQRF-SSPYIAQIVDSQVVQEKDGSK--TVYVLLPYFAKGSLQDLIN 119

Query: 153 NKL--ATKLTEAEILKIMYDVSNAIAQMH-------------YLPTPLI----------- 186
             L   T+++E +IL++   ++  +  +H              +  P             
Sbjct: 120 RHLLDCTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLEL 179

Query: 187 -----------HRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHT 235
                      HRD+K  N+++  +D   + D GS S     +++ Q +         + 
Sbjct: 180 DTFGESQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNC 239

Query: 236 TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE----LTGQ---FAILHSK 288
           T  Y +PE++D+     I EK DIW+ G  +Y + F  +PFE    ++G    +AI   K
Sbjct: 240 TLSYAAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGK 299

Query: 289 YEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVM 322
           Y +P+   YSS LI LI   L+ NP  RP++ +++
Sbjct: 300 YTVPRGTSYSSSLIELIGKCLSVNPEQRPSVNELI 334

>YPL236C (YPL236C) [5213] chr16 complement(101608..102702)
           Serine/threonine protein kinase of unknown function
           [1095 bp, 364 aa]
          Length = 364

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 87/339 (25%), Positives = 142/339 (41%), Gaps = 62/339 (18%)

Query: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP 91
           +  + V   R  I   L EGG + +Y V+  + +  +D GI +  L A     LK++I P
Sbjct: 20  DATIRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYA-----LKKIICP 74

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
               ++    E+E  K+ + SP +++  DS   +  DGS    I +++      SL D +
Sbjct: 75  SVESISNGMREIENYKRFQ-SPYVIKSIDSQVMQEKDGSK--TIYIVLPYYSLGSLQDSI 131

Query: 152 NNKL--ATKLTEAEILKIMYDVSNAIAQMH-----------------------------Y 180
           N +L   T ++EAE ++IM  V+  +  +H                              
Sbjct: 132 NRRLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLL 191

Query: 181 LPTPL---------------IHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIA 225
             TPL                HRDI   N+L   D    + D GS S     +     ++
Sbjct: 192 EDTPLEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLS 251

Query: 226 VLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ---- 281
            L   +  + T  Y  PE+++L     ++ K DIW+LG   Y L+F  +PFE   Q    
Sbjct: 252 ELQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGA 311

Query: 282 ---FAILHSKYEIPQNG-YSSKLINLIIIMLAENPSLRP 316
              +AI   KY  P+N  +S  L+++I   +  +P  RP
Sbjct: 312 SLTYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 139/302 (46%), Gaps = 53/302 (17%)

Query: 29  LSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRV 88
            S N  V +G ++  I++ + EG F  +Y      LT++        +LK G+       
Sbjct: 26  FSSNELVDIGNYK--IVKLIGEGSFGKVYLANH-RLTHQ------KVVLKTGN------- 69

Query: 89  IVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLL 148
               +N  N +R EV   +Q    P+I + Y+   +         ++ + +E CP K L 
Sbjct: 70  ----KNDPNVVR-EVFYHRQF-DFPHITKLYEVIVTES-------KVWMALEYCPGKELY 116

Query: 149 DYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDF 208
           +Y+   +  +++  E  K+   + +A+   H L    +HRD+K+EN+L+DK    K+ DF
Sbjct: 117 EYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDF 172

Query: 209 GSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDL--YRCLPINEKSDIWALGIFL 266
           G T  C          A  T    V  T  Y +PE+I+   Y    I    DIW+LG+ L
Sbjct: 173 GFTREC----------ATKTMLETVCGTTVYMAPELIERKSYDGFKI----DIWSLGVIL 218

Query: 267 YKLLFYTTPF----ELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVM 322
           Y ++  T PF    E   ++ I++ +     +  S    +LI  +L ++PS RP + QV+
Sbjct: 219 YTMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

Query: 323 HH 324
            H
Sbjct: 279 AH 280

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 134/287 (46%), Gaps = 48/287 (16%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMK 107
           L EGGFA  +++K        D+G   ++  A  +A   +  +  E    +L +E++  K
Sbjct: 88  LGEGGFARCFQIK-------DDSG---EIFAAKTVA---KASIKSEKTRKKLLSEIQIHK 134

Query: 108 QLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKI 167
            +   PNIVQ+ D       D S    + +L+E+CP  SL++ +  +    LTE E+   
Sbjct: 135 SM-SHPNIVQFIDC----FEDDS---NVYILLEICPNGSLMELLKRRKV--LTEPEVRFF 184

Query: 168 MYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVL 227
              +  AI  MH     +IHRD+K+ N+  D + N K+ DFG               AVL
Sbjct: 185 TTQICGAIKYMH--SRRVIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVL 229

Query: 228 TN----NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA 283
            N       +  TP Y +PE++ + +    + + DIW+LG+ LY LL    PF+      
Sbjct: 230 ANESERKYTICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT 288

Query: 284 ILH----SKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVMHHV 325
           I        +  P++   S +   LI  +L+ +P  RP++ ++M +V
Sbjct: 289 IYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 85.1 bits (209), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 94/195 (48%), Gaps = 22/195 (11%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           + + +E CP   L DY+   L  ++   E  ++   + +A+   H L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 254
           +L+DK+    L DFG T  C          A  T    V  T  Y +PE+I   R     
Sbjct: 159 ILLDKNGYAMLTDFGFTREC----------ATKTQLETVCGTTVYMAPELIK--REAYDG 206

Query: 255 EKSDIWALGIFLYKLLFYTTPFE-----LTGQFAILHSKYEIPQNGYSSKLINLIIIMLA 309
            K D W+LGI LY +L    PF+      TG   I+H +  +     S +  +LI+ +L 
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTG-LKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 310 ENPSLRPNIYQVMHH 324
           +N + RPN+ +V+ H
Sbjct: 266 KNAAQRPNLNEVLQH 280

>Kwal_26.8751
          Length = 848

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 95/194 (48%), Gaps = 20/194 (10%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           + + +E CP K L +Y+  K    L E    ++   +  A+   H +    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 254
           +L+DK  + KL DFG T  C    +T   +  +        T  Y +PE+I+  R     
Sbjct: 159 ILLDKKGHAKLTDFGFTREC----ATKGILETICG------TTVYMAPELIE--RKPYEG 206

Query: 255 EKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAE 310
            K D W+LGI LY ++  T PF    E+  ++ I+H       +   S    LI  +L +
Sbjct: 207 YKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQLLEK 266

Query: 311 NPSLRPNIYQVMHH 324
           +P+ RP++ QV+ H
Sbjct: 267 DPNQRPSLTQVLQH 280

>Kwal_33.13112
          Length = 505

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 138/302 (45%), Gaps = 48/302 (15%)

Query: 31  PNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIV 90
           P+T V   +   +I E + +G F ++Y+             ID +    G++  +K + +
Sbjct: 25  PDTAVEKPSQLYDIKECVGKGSFGDVYR------------AIDKE---TGEMVAVKIINL 69

Query: 91  PD-ENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLD 149
            + ++ ++ L  E+  + +LR +P +  YY +             + ++ME C   S  D
Sbjct: 70  EETQDDIDVLAQEIYFLSELR-APFVTTYYKTYVE-------DVSMWIVMEFCGGGSCAD 121

Query: 150 YMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG 209
            + +    +L E ++  I+ +V   +  +H      IHRD+K  N+L+  +   KL DFG
Sbjct: 122 LLKHLPEHRLPENKVAYIIREVLYGLEYLH--SQRKIHRDVKAANILLTDEGEVKLGDFG 179

Query: 210 STSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 269
            +          Q +A L  N +V  TP + +PE+I   R    +EK+DIW+LGI   +L
Sbjct: 180 VSG---------QIMATLKRNTFV-GTPYWMAPEIIA--RDNGYDEKADIWSLGITAMEL 227

Query: 270 LFYTTPFELTGQFAILHSKYEIP-------QNGYSSKLINLIIIMLAENPSLRPNIYQVM 322
           L    P+       +L +   IP       Q  ++S   + I + L ++P+LRP    ++
Sbjct: 228 LTGQPPYAKYDPMKVLMN---IPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

Query: 323 HH 324
            H
Sbjct: 285 SH 286

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 102/194 (52%), Gaps = 20/194 (10%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           + +++E C    L +++  +    L E++  K+   +++A+   H L    +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLKEQRLSLEESK--KLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 254
           VL+D + + KL DFG T          +++A  +    +  T  Y +PE+I+  +C    
Sbjct: 159 VLLDGNGHAKLTDFGFT----------REMATRSQLETICGTTVYMAPELIE-RKCYD-G 206

Query: 255 EKSDIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAE 310
            K DIW+LGI LY ++    PF    ++  +  I++ + +  Q   S   I+LI  ML +
Sbjct: 207 FKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLRK 266

Query: 311 NPSLRPNIYQVMHH 324
           NP+ R ++ QV+ H
Sbjct: 267 NPNERISLAQVLSH 280

>Kwal_55.21545
          Length = 865

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 133/301 (44%), Gaps = 42/301 (13%)

Query: 46  EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVET 105
           E +  G F  +YK            G  +K  +   I  L      DE  + +++ E++ 
Sbjct: 23  EVIGRGKFGVVYK------------GYYTKTKQVCAIKVLNLDSADDE--VEDVQKEIQF 68

Query: 106 MKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEIL 165
           +  L+  PNI  YY S  +         ++ ++ME C   SL   +      K+ E  I 
Sbjct: 69  LSSLKQVPNITHYYGSYLNDT-------KLWVIMEYCAGGSLRTLLR---PGKIGEQYIG 118

Query: 166 KIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIA 225
            IM ++  A+  MH     +IHRDIK  NVL+  D + KLCDFG  +         Q +A
Sbjct: 119 VIMRELLTAL--MHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMA 176

Query: 226 VLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELTGQFAI 284
                     TP + +PE+I     +  + K DIW+LGI  Y++     P+ E+    A+
Sbjct: 177 ---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAM 225

Query: 285 -LHSKYEIPQ---NGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYE 340
            L +K + P+     +SS L  +I + L E+P  RP+   ++      L  +VP +   E
Sbjct: 226 QLITKSKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVSILKE 285

Query: 341 L 341
           L
Sbjct: 286 L 286

>Sklu_2419.10 , Contig c2419 14439-16135
          Length = 566

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 109/228 (47%), Gaps = 44/228 (19%)

Query: 113 PNIVQYYDSNASRHPDGSPGFE----ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIM 168
           PNIVQ+ D            FE    + +L+E+CP  SL+D +  +    LTE E+    
Sbjct: 4   PNIVQFIDC-----------FEDDTNVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFT 50

Query: 169 YDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLT 228
             +  AI  MH     +IHRD+K+ N+  D + N K+ DFG               AVL 
Sbjct: 51  TQIVGAIKYMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLA-------------AVLA 95

Query: 229 NN----IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAI 284
           N+      V  TP Y +PE++         E  DIW++G+ +Y LL    PF+   +  I
Sbjct: 96  NDRERKYTVCGTPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQ-AKEVNI 153

Query: 285 LHSK-----YEIPQNGYSSKLINLIII-MLAENPSLRPNIYQVMHHVC 326
           ++ +     Y  P+   +SK + ++I  +L+ +P  RP++ ++M +V 
Sbjct: 154 IYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVW 201

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 104/228 (45%), Gaps = 28/228 (12%)

Query: 93  ENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN 152
           E+ + +++ E++ +  L+  PNI +YY S          G  + ++ME C   SL   + 
Sbjct: 53  EDEVEDVQREIQFLASLKQIPNITRYYGSYLR-------GTSLWIIMEYCAGGSLRSLLR 105

Query: 153 NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
                K+ E  I  IM ++  A+  +H     +IHRDIK  NVL+  +   KLCDFG  +
Sbjct: 106 ---PGKIDEKYIGVIMRELLVALKVIHK--DNVIHRDIKAANVLITNEGQVKLCDFGVAA 160

Query: 213 MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272
                    Q +A          TP + +PE+I     +  + K DIW+LGI  Y++   
Sbjct: 161 QLNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATG 209

Query: 273 TTPF----ELTGQFAILHSK-YEIPQNGYSSKLINLIIIMLAENPSLR 315
             P+     L     I+ SK   + +  Y+ +L   I + L E+P  R
Sbjct: 210 NPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQER 257

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 104/238 (43%), Gaps = 43/238 (18%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPD---ENGLNEL 99
           EI + L +G F  +Y V+ +E               +G +  LK +   D    N   + 
Sbjct: 110 EIGKVLGKGKFGRVYCVRHIE---------------SGFVCALKAMEKKDIIQYNIEKQF 154

Query: 100 RNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKL 159
           R EVE    LR  PN+ Q Y               + LLME      L  ++  +  +  
Sbjct: 155 RREVEIQSSLR-HPNLTQLYGYFHDEK-------RVYLLMEYLVNGELYKHLKGR--SHF 204

Query: 160 TEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVS 219
            +      +Y +++A+  MH     ++HRDIK EN+++  ++  KL DFG  S+  P  S
Sbjct: 205 NDVVASYYVYQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG-WSVITPKGS 261

Query: 220 THQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
             + +           T  Y SPE+I   R    NEK D+WALG+  Y+LL  + PFE
Sbjct: 262 KRKTLC---------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFE 307

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 104/229 (45%), Gaps = 28/229 (12%)

Query: 93  ENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN 152
           E+ + ++R E++ +  L+ +PNI  YY S            ++ ++ME C   SL   + 
Sbjct: 53  EDEVEDIRKEIQFLSSLKQTPNITHYYGSYLID-------TKLWVIMEYCAGGSLRTLLR 105

Query: 153 NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
             +   + E  I  IM ++  A+  +H     +IHRDIK  N+L+  + + KLCDFG  +
Sbjct: 106 PGI---IEEKYIGVIMREILVALISIHR--DNVIHRDIKAANILIANNGSVKLCDFGVAA 160

Query: 213 MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272
                +   Q +A          TP + +PE+I     +  + K DIW+LGI  Y++   
Sbjct: 161 QLSQSMLKRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATG 209

Query: 273 TTPF----ELTGQFAILHSK-YEIPQNGYSSKLINLIIIMLAENPSLRP 316
             P+     +     I  SK   +    YS  L   I + L E+P  RP
Sbjct: 210 NPPYCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 149/321 (46%), Gaps = 56/321 (17%)

Query: 25  NSHLLSPNTQVVVGTH--RCEILEHLAEGGFANIYKVKFLELTNEMDAG--IDSKLLKAG 80
           NS L +P + +  G H    +I++ L EG F  + K+ +   T +  A   I+ K+L   
Sbjct: 36  NSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKV-KLAYHTTTGQKVALKIINKKVLAKS 94

Query: 81  DIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLME 140
           D+                +  E+  ++ LR  P+I++ YD   S+        EI++++E
Sbjct: 95  DMQ-------------GRIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIE 133

Query: 141 LCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKD 200
               + L DY+  +   K++E E  +    + +A+   H     ++HRD+K EN+L+D+ 
Sbjct: 134 YAGNE-LFDYIVQR--DKMSEQEARRFFQQIISAVEYCHR--HKIVHRDLKPENLLLDEH 188

Query: 201 DNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKS 257
            N K+ DFG ++             ++T+  ++ T   +P Y +PE+I     L    + 
Sbjct: 189 LNVKIADFGLSN-------------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEV 233

Query: 258 DIWALGIFLYKLLFYTTPFE---LTGQFA-ILHSKYEIPQNGYSSKLINLIIIMLAENPS 313
           D+W+ G+ LY +L    PF+   +   F  I +  Y +P+   S     LI  ML  NP 
Sbjct: 234 DVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPK-FLSPGAAGLIKRMLIVNPL 292

Query: 314 LRPNIYQVMHHVCSILKCDVP 334
            R +I+++M       K D+P
Sbjct: 293 NRISIHEIMQD--DWFKVDLP 311

>Kwal_23.5290
          Length = 819

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 136/318 (42%), Gaps = 41/318 (12%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKA--GDIACLKRVIVPDENGLNELR 100
           +++E   +G   ++Y  +  +L    + G++ ++ +   GD   +K++I+  +     + 
Sbjct: 526 QMMEKAGQGASGSVYLAQRTQLPAYGEGGLNEQIGEPEIGDKVAIKQMILSKQPRKELIV 585

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA---- 156
           NE+  MK  +   NIV + ++      D      + ++ME     SL D + N  A    
Sbjct: 586 NEILVMKDSQHK-NIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDLIENSPANGSS 638

Query: 157 -TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
            + LTE +I  I+ +    +  +H     +IHRDIK +NVL+D     K+ DFG    C 
Sbjct: 639 HSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDNRARVKITDFG---FCA 693

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
            +       A +        TP + +PE++        +EK D+W+LGI   ++L    P
Sbjct: 694 KLTDKRSKRATMVG------TPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLEGEPP 744

Query: 276 FELTGQFAILHSKYEIPQNG---------YSSKLINLIIIMLAENPSLRPNIYQVMHHVC 326
           +        L   Y I  NG          S K+   + + L  +   R +  +++HH  
Sbjct: 745 YLNEDPLKAL---YLIATNGTPKLKQPEVLSLKIKRFLSVCLCVDVKYRASTEELLHHSF 801

Query: 327 SILKCD-VPFTDKYELGP 343
             + C+ V  T   E  P
Sbjct: 802 FDMSCEPVDLTSLLEWRP 819

>Scas_580.6
          Length = 1015

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 109/229 (47%), Gaps = 28/229 (12%)

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
           DE+ + +++ EV+ +  L+  PNI +YY    S   D S    + ++ME C   SL   +
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYY---GSYLKDTS----LWIIMEYCAGGSLRSLL 125

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
                 K+ E  I  IM ++  A+  +H     +IHRDIK  NVL+  + + KLCDFG  
Sbjct: 126 R---PGKIDEKYIGVIMRELLVALKYIHK--DNVIHRDIKAANVLITNEGSVKLCDFGVA 180

Query: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
           +         Q +A          TP + +PE+I     +  + K DIW+LGI  Y++  
Sbjct: 181 AQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIAT 229

Query: 272 YTTPF-ELTGQFAI-LHSKYEIPQ---NGYSSKLINLIIIMLAENPSLR 315
              P+ E+    A+ L +K + P+     Y+  L   I + L E+P  R
Sbjct: 230 GNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>Scas_693.17
          Length = 1049

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 98/203 (48%), Gaps = 23/203 (11%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           +L E      LLDY+    + K + A        + +A+  +H     ++HRD+KIEN++
Sbjct: 177 MLFEYVSGGQLLDYIIQHGSLKESRARTF--TRQICSALKYLH--SHNIVHRDLKIENIM 232

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP-INE 255
           + KD N KL DFG +++          +     ++Y      + +PE++   +  P I  
Sbjct: 233 ISKDGNIKLIDFGLSNL----YDKCNKLKTYCGSLY------FAAPELL---KATPYIGP 279

Query: 256 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGY----SSKLINLIIIMLAEN 311
           + D+W+ G+ LY L+    PF+      +LH K +  +  Y    S ++I+L+  ML  +
Sbjct: 280 EIDVWSFGVVLYVLVCGKVPFDDENS-NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVD 338

Query: 312 PSLRPNIYQVMHHVCSILKCDVP 334
           P  R  + QVM+H   +  CD P
Sbjct: 339 PFKRATLDQVMNHHWMVRDCDGP 361

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 123/278 (44%), Gaps = 31/278 (11%)

Query: 46  EHLAEGGFANIYKVKFLELTNEMDAGIDSKL--LKAGDIACLKRV-IVPDENGLNELRNE 102
           + LAEG        K  E+      G+  K   +K G +  +K + +  D + + +++ E
Sbjct: 10  QGLAEGEMDVSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQRE 69

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEA 162
           ++ +  L+   NI +YY    S   D S    + ++ME C   SL   +      K+ E 
Sbjct: 70  IQFLASLKQISNITRYY---GSYLKDTS----LWIIMEHCAGGSLRSLLR---PGKIDEK 119

Query: 163 EILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQ 222
            I  IM ++  A+  +H     +IHRDIK  NVL+  + N KLCDFG  +         Q
Sbjct: 120 YIGVIMRELLVALKCIHK--DNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQ 177

Query: 223 DIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF----EL 278
            +A          TP + +PE+I     +  + K DIW+LGI  Y++     P+     L
Sbjct: 178 TMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEAL 226

Query: 279 TGQFAILHSK-YEIPQNGYSSKLINLIIIMLAENPSLR 315
                I+ SK   +    YS+ L   I + L E+P  R
Sbjct: 227 RAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKER 264

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 127/287 (44%), Gaps = 40/287 (13%)

Query: 46  EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVET 105
           E L  G ++ +Y+V  +E +++    I           C KR I+  EN +  +  E  T
Sbjct: 14  EELGHGSYSTVYRV--VERSSQHQYAIK---------ICSKRHII-GENKVKYVTIEKNT 61

Query: 106 MKQLRGS--PNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAE 163
           +  L  +  P I++ Y +   +         +  +M+L P   LL  +  +     +EA 
Sbjct: 62  LNLLGQANHPGIIKLYYTFHDQE-------NLYFVMDLAPGGELLQLLRRQRV--FSEAW 112

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
               M  + + +  +H +   +IHRD+K ENVL+DK+    + DFG+        +    
Sbjct: 113 ARHYMCQLVDTVEYIHSMG--VIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDG 170

Query: 224 IAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF------E 277
               T+ +    T +Y SPE++   +       SD+WALG  LY+ L  T PF      E
Sbjct: 171 DKPATSFV---GTAEYVSPELLLENKSY---YSSDVWALGCMLYQFLQGTPPFRGQNEME 224

Query: 278 LTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHH 324
              Q   L   + IP N  ++ L++ I+++   +PS R  + Q+  H
Sbjct: 225 TFEQIVNLDYTWRIPANPLAAGLVSKILVL---DPSQRYTLEQIKKH 268

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 75.5 bits (184), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 103/230 (44%), Gaps = 30/230 (13%)

Query: 93  ENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN 152
           E+ + +++ E++ +  L+  PNI +YY S            ++ ++ME C   SL   + 
Sbjct: 62  EDEVEDVQKEIQFLASLKQVPNITRYYGSYLYD-------TKLWVIMEYCAGGSLRTLLR 114

Query: 153 -NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
             K+  K     + K++      IA ++     +IHRDIK  NVL+  + + KLCDFG  
Sbjct: 115 PGKIDEKYLGVIVRKLL------IALVYIHKDNVIHRDIKAANVLITNEGHVKLCDFGVA 168

Query: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
           +         Q +A          TP + +PE+I     +  N K+DIW+LGI  Y++  
Sbjct: 169 AQLTAANHKRQTMA---------GTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIAT 217

Query: 272 YTTPF----ELTGQFAILHSK-YEIPQNGYSSKLINLIIIMLAENPSLRP 316
              P+     L     I  SK   +    YS  L   I + L E+P  RP
Sbjct: 218 GNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERP 267

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 119/265 (44%), Gaps = 51/265 (19%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN-----NKLA 156
           E  T+++L+ +  I+  Y +      D S    +  L+E  P   LL  M      N+  
Sbjct: 203 EKNTLQRLKNTKGIISLYFT----FQDES---SLYFLLEYAPNGDLLSLMRKHGSVNEKC 255

Query: 157 TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216
           T+   A+I+       +A+  MH     +IHRD+K EN+L+D D   KL DFG+  +   
Sbjct: 256 TQYYAAQII-------DALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTARL--- 303

Query: 217 IVSTHQD---IAVLTNNIYVHTTPQYRSPEMID----LYRCLPINEKSDIWALGIFLYKL 269
           + ST +D     +LT +     T +Y SPE+++     +RC       DIWA G  L+++
Sbjct: 304 LDSTSEDDLKYDLLTRSNSFVGTAEYVSPELLNDNYVDFRC-------DIWAFGCILFQM 356

Query: 270 LFYTTPFELTGQFAILHSKYEIP---QNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVC 326
           +    PF+   ++       ++      G+   + +L+  +L +NP  R  I Q+  H  
Sbjct: 357 IAGKPPFKANNEYLTFQKVMKVQFAFTAGFPMTVRDLVKNILIKNPERRLLINQIKAHQ- 415

Query: 327 SILKCDVPFT-------DKYELGPY 344
                DV F        D  ELGPY
Sbjct: 416 --FFADVNFGNGSVWDKDPPELGPY 438

>Kwal_56.22693
          Length = 984

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 104/223 (46%), Gaps = 27/223 (12%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           +  L+E  P    L  +  K    L++   +     + +AI  +H+    ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVI--KKFGSLSQECAVYYSAQILDAIDYLHH--KGIVHRDIKPEN 287

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI-DLYRCLPI 253
           +L+DKD   KL DFG T+       T Q   +L  +     T +Y SPE++ D Y    +
Sbjct: 288 ILLDKDMKVKLTDFG-TARILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY----V 342

Query: 254 NEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEIPQNGYSSKLINLIIIMLA 309
           + K DIWA G  L++++    PF+ T ++     ++  +Y     G+   + +LI  +L 
Sbjct: 343 DYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAF-TAGFPLVIRDLIKKILV 401

Query: 310 ENPSLRPNIYQV-MHHVCSILKCDVPFTDKY-------ELGPY 344
           ++P  R +  Q+  HH       DV F D         EL PY
Sbjct: 402 KSPEQRLDASQIKKHHFFK----DVNFNDGSVWDSDPPELAPY 440

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 139/301 (46%), Gaps = 50/301 (16%)

Query: 41  RCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR 100
           + ++++ L EG F  +      +L + +  G    L        + + ++   +    + 
Sbjct: 38  KYQVIKTLGEGSFGKV------KLAHHVSTGQKVAL------KIINKKVLAKSDMQGRIE 85

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
            E+  ++ LR  P+I++ YD   S+        EI++++E    + L DY+  +   K++
Sbjct: 86  REISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR--DKMS 134

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
           E E  +    + +A+   H     ++HRD+K EN+L+D+  N K+ DFG ++        
Sbjct: 135 ENEARRFFQQIISAVEYCHR--HKIVHRDLKPENLLLDEHLNVKIADFGLSN-------- 184

Query: 221 HQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
                ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L    PF+
Sbjct: 185 -----IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVMLCRRLPFD 237

Query: 278 ---LTGQFA-ILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDV 333
              +   F  I +  Y IP+   S    NLI  ML  NP  R  I+++M       K D+
Sbjct: 238 DESIPVLFKNISNGVYSIPKF-LSQGAANLIKRMLIVNPLNRITIHEIMED--EWFKVDL 294

Query: 334 P 334
           P
Sbjct: 295 P 295

>Kwal_56.23717
          Length = 858

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 94/193 (48%), Gaps = 23/193 (11%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           +L E      LLDY+       L E    K    +++A+  +H     ++HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLHM--NNIVHRDLKIENIM 65

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 256
           +      K+ DFG ++M  P    H        ++Y      + +PE+  L  C     +
Sbjct: 66  ISTSGEIKIIDFGLSNMYNPKKQLH----TFCGSLY------FAAPEL--LKACPYTGPE 113

Query: 257 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPQNGYSSKLINLIIIMLAEN 311
            D+W+ G+ L+ L+    PF+     ++LH      K E PQ+  S ++I+L+  ML  +
Sbjct: 114 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH-LSIEVISLLSKMLVVD 171

Query: 312 PSLRPNIYQVMHH 324
           P+ R ++ QV++H
Sbjct: 172 PTKRASLKQVVNH 184

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 134/291 (46%), Gaps = 49/291 (16%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENG-LNELRN 101
           EIL+ +  G F ++YK               ++ L + +I  +K V + D +  ++ L  
Sbjct: 21  EILQCIGRGNFGDVYK---------------ARDLTSNEIVAIKVVNLEDTDEPIDLLAQ 65

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           E+  + +LR SP I  Y     +   D S    + ++ME C   S  + +      K+TE
Sbjct: 66  EIFFLSELR-SPYITNY---KTAFLVDVS----MWIVMEYCGGGSCAELLKYTPEHKVTE 117

Query: 162 AEILKIMYDVSNAIAQMHYLPTPL-IHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
            +   I   VS  +  + YL +   IHRDIK  N+L+  + + KL DFG +     +V+ 
Sbjct: 118 EQCAFI---VSEVLIGLDYLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSGQM--MVTR 172

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG 280
            +D  V         TP + +PE+ID  +    NE +DIW+LGI + +LL    P +   
Sbjct: 173 KRDTFV--------GTPFWMAPEVIDRNK-QGYNEMADIWSLGITVIELLMGHPPLD--- 220

Query: 281 QFAILHSKYEIPQNG-------YSSKLINLIIIMLAENPSLRPNIYQVMHH 324
           ++  + +   IP+         +SS   + +   L ++PS RP   +++ H
Sbjct: 221 KYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKH 271

>Scas_598.6
          Length = 790

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/332 (23%), Positives = 140/332 (42%), Gaps = 47/332 (14%)

Query: 19  TSAMIPNSHLLSPNTQVVVGTHRC---EILEHLAEGGFANIYKVKFLELT-NEMDAGIDS 74
           T   + N+ ++S    V + T      +++E   +G   ++Y  + + +   E D     
Sbjct: 476 TKPSMSNAEIMSKLKSVTINTDPSPYFQMIEKAGQGASGSVYLAERIAIPPGEFD----- 530

Query: 75  KLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFE 134
           +  + GD   +K++I+  +     + NE+  MK  R   NIV + ++      D      
Sbjct: 531 ETPEVGDKVAIKQMILSKQPRKELIVNEILVMKDSRHK-NIVNFLEAYLKTEDD------ 583

Query: 135 ILLLMELCPKKSLLDYMNNKLATK-----LTEAEILKIMYDVSNAIAQMHYLPTPLIHRD 189
           + ++ME     SL D + N  AT      LTE +I  I+ +    +  +H     +IHRD
Sbjct: 584 LWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLHD--KHIIHRD 641

Query: 190 IKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYR 249
           IK +NVL+D +   K+ DFG    C  +       A +        TP + +PE++    
Sbjct: 642 IKSDNVLLDNNARVKITDFG---FCAKLTDQRSKRATMVG------TPYWMAPEVVKQRE 692

Query: 250 CLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNG---------YSSKL 300
               +EK D+W+LGI   ++L    P+        L   Y I  NG          S ++
Sbjct: 693 ---YDEKVDVWSLGIMTIEMLESEPPYLNEDPLKAL---YLIATNGTPKLKNPESLSLEI 746

Query: 301 INLIIIMLAENPSLRPNIYQVMHHVCSILKCD 332
              + + L  +   R +  +++HH    + C+
Sbjct: 747 KRFLSVCLCVDVRYRASTEELLHHGFFDMACE 778

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 91/193 (47%), Gaps = 23/193 (11%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           +L E      LLDY+       L E    K    +++A+  +H     ++HRD+KIEN++
Sbjct: 157 MLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLHL--NNIVHRDLKIENIM 212

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 256
           +      ++ DFG ++M  P    H        ++Y      + +PE++  +       +
Sbjct: 213 ISSSGEIRIIDFGLSNMYDPKKQLH----TFCGSLY------FAAPELLKAHPY--TGPE 260

Query: 257 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPQNGYSSKLINLIIIMLAEN 311
            DIW+ G+ LY L+    PF+     ++LH      K E PQ+  S  +I+L+  ML  +
Sbjct: 261 VDIWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYPQH-LSIDVISLLSKMLVVD 318

Query: 312 PSLRPNIYQVMHH 324
           P  R  + QV+HH
Sbjct: 319 PYKRATLKQVVHH 331

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 126/281 (44%), Gaps = 53/281 (18%)

Query: 74  SKLLKAGDIACLKRVIVPDENGLNE----------LRNEVETMKQLRGSPNIVQYYDSNA 123
           +K +++G +A +K  IVP  N  +           +  E+  MK L   PNI+  Y+   
Sbjct: 78  AKNMQSGKLAAIK--IVPKRNVRHNQKQVTALPYGIEREIIIMK-LITHPNIMALYEVWE 134

Query: 124 SRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPT 183
           ++        E+ L++E      L DY+  +   KL E E +     +   ++  H    
Sbjct: 135 NKS-------ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN- 184

Query: 184 PLIHRDIKIENVLVDKDD-NFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTT---PQY 239
            + HRD+K EN+L+DK +   K+ DFG               A+ T N  + T+   P Y
Sbjct: 185 -ICHRDLKPENLLLDKKNKTVKIADFGMA-------------ALETTNRLLETSCGSPHY 230

Query: 240 RSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPQ 293
            SPE++    Y   P    SD+W+ GI L+ LL    PF       +L    H +Y++P 
Sbjct: 231 ASPEIVMGQKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS 286

Query: 294 NGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDVP 334
           N  S +  +LI  +L  +P  R  + +++ H   ++K D P
Sbjct: 287 N-VSKEAKDLISKILVVDPEKRITVDKILEHPL-LVKYDNP 325

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 142/308 (46%), Gaps = 56/308 (18%)

Query: 38  GTH--RCEILEHLAEGGFANIYKVKFLELTNEMDAG--IDSKLLKAGDIACLKRVIVPDE 93
           G H  + +I++ L EG F  + K+ +   T +  A   I+ K+L   D+           
Sbjct: 29  GQHIGKYQIIKTLGEGSFGKV-KLAYHISTGQKVALKIINKKVLAKSDMQ---------- 77

Query: 94  NGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNN 153
                +  E+  ++ LR  P+I++ YD   S+        EI++++E    + L DY+  
Sbjct: 78  ---GRIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQ 125

Query: 154 KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
           +   K+ E E  +    + +A+   H     ++HRD+K EN+L+D+  N K+ DFG ++ 
Sbjct: 126 R--DKMPEQEARRFFQQIISAVDYCHR--HKIVHRDLKPENLLLDEHLNVKIADFGLSN- 180

Query: 214 CFPIVSTHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270
                       ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L
Sbjct: 181 ------------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVML 226

Query: 271 FYTTPFE---LTGQFA-ILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVC 326
               PF+   +   F  I +  Y IP N  S    +LI  ML  NP  R  ++++M    
Sbjct: 227 CRRLPFDDESIPVLFKNISNGVYTIP-NFLSQGAASLIKKMLIVNPVNRITVHEIMQD-- 283

Query: 327 SILKCDVP 334
              K D+P
Sbjct: 284 EWFKVDLP 291

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 126/269 (46%), Gaps = 50/269 (18%)

Query: 74  SKLLKAGDIACLKRVIVPDE----NGLNEL----RNEVETMKQLRGSPNIVQYYDSNASR 125
           +K ++ G ++ +K  IVP +    N + +L      E+  MK L   PN++  Y+   ++
Sbjct: 90  AKNMETGKLSAIK--IVPKKFVKSNQIKQLPYGIEREIIIMK-LISHPNVMGLYEVWENK 146

Query: 126 HPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPL 185
                   E+ L++E      L DY+ +K   KL E+E +     +  A+A  H     +
Sbjct: 147 S-------ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--I 195

Query: 186 IHRDIKIENVLVDKDD-NFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTT---PQYRS 241
            HRD+K EN+L+DK   + K+ DFG               A+ T++  + T+   P Y S
Sbjct: 196 CHRDLKPENLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYAS 242

Query: 242 PEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPQNG 295
           PE++    Y   P    SD+W+ GI L+ LL    PF       +L      KY++PQ  
Sbjct: 243 PEIVLGRKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ-W 297

Query: 296 YSSKLINLIIIMLAENPSLRPNIYQVMHH 324
            S +  +LI  +L  +P+ R  I Q++ H
Sbjct: 298 LSVEAKDLISRILVVDPNRRITIDQILQH 326

>Kwal_26.7788
          Length = 1267

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 93/347 (26%), Positives = 149/347 (42%), Gaps = 72/347 (20%)

Query: 74  SKLLKAGDIACLKRVIVPDENGLNE------LRNEVETMKQLRGSPNIVQYYDSNASRHP 127
           +K ++ G +A +K  IVP             +  E+  MK L   PN++  Y+   ++  
Sbjct: 75  AKNMETGKLAAIK--IVPKTKSSRTGSLPYGIEREIIIMK-LISHPNVMGLYEVWENK-- 129

Query: 128 DGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIH 187
                 E+ L++E      L DY+ ++   +L E E +     +    A  H     + H
Sbjct: 130 -----LELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICH 180

Query: 188 RDIKIENVLVDKDDN-FKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTT---PQYRSPE 243
           RD+K EN+L+DK +   K+ DFG               A+ T+N  + T+   P Y SPE
Sbjct: 181 RDLKPENLLLDKKNKRIKIADFGMA-------------ALQTSNKLLETSCGSPHYASPE 227

Query: 244 MI--DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPQNGYS 297
           ++    Y   P    SD+W+ GI L+ LL    PF       +L      KY++PQ+  S
Sbjct: 228 IVMGKNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQS-VS 282

Query: 298 SKLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQ 357
           S   +LI  +L  +P  R +I +++ H         P   KY  G       S  H+ L 
Sbjct: 283 SGAQDLISRILVVDPDKRISINEILAH---------PLLAKY--GNKRSKSNSDLHI-LS 330

Query: 358 QIQYQMFELYKNEKVTSGDVDKLNDLFIQNFEI----APKQPIDKGI 400
             + Q+  +      +  DVD      +QN +I    APK+ I KG+
Sbjct: 331 HSKPQISTIK-----SESDVDP---TILQNLQILWHGAPKESILKGL 369

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 76/312 (24%), Positives = 135/312 (43%), Gaps = 53/312 (16%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENG----LNE 98
           + L   + G +  +  +  L      ++G   K L   D   + +  +P E      +N+
Sbjct: 175 DTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQ 234

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN------ 152
           L  E+  +K ++   NI+ +Y +  ++H +     EI++LME     SL   ++      
Sbjct: 235 LVRELSIVKNVKPHENIITFYGAYYNQHINN----EIIILMEYSDCGSLDKILSVYKRFV 290

Query: 153 -----NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCD 207
                +   T   E  I KI Y V N +  + Y    +IHRDIK  NVL++     KLCD
Sbjct: 291 QRGTVSSKKTWFNELTISKIAYGVLNGLDHL-YRQYKIIHRDIKPSNVLINSKGQIKLCD 349

Query: 208 FGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIF 265
           FG +     ++++  D  V         T  Y SPE I  ++Y       K D+W+LG+ 
Sbjct: 350 FGVSK---KLINSIADTFV--------GTSTYMSPERIQGNVYSI-----KGDVWSLGLM 393

Query: 266 LYKLLFYTTPFELTG------------QFAILHSKYEIPQNG-YSSKLINLIIIMLAENP 312
           + +L+  T  F L G            Q  +      +P++  YS ++ + +     +N 
Sbjct: 394 IIELV--TGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNE 451

Query: 313 SLRPNIYQVMHH 324
             R +I++++HH
Sbjct: 452 RERSSIHELLHH 463

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 97/203 (47%), Gaps = 23/203 (11%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           +L E      LLDY+    +  L E    K    V++A+  +H     ++HRD+KIEN++
Sbjct: 209 MLFEYVAGGQLLDYIIQHGS--LREHHARKFARGVASALQYLHA--NNIVHRDLKIENIM 264

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 256
           +      K+ DFG ++    +  T + +     ++Y      + +PE++  +       +
Sbjct: 265 ISNSGEIKIIDFGLSN----VYDTRKQLHTFCGSLY------FAAPELLKAHPY--TGPE 312

Query: 257 SDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPQNGYSSKLINLIIIMLAEN 311
            D+W+ G+ LY L+    PF+     ++LH      K E PQ+  S ++++L+  ML  +
Sbjct: 313 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEYPQH-LSIEVMSLLSKMLVVD 370

Query: 312 PSLRPNIYQVMHHVCSILKCDVP 334
           PS R ++ QV+ H       D P
Sbjct: 371 PSRRASLKQVVEHPWMTKGYDTP 393

>Scas_707.36
          Length = 915

 Score = 72.4 bits (176), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 142/325 (43%), Gaps = 71/325 (21%)

Query: 63  ELTNEMDAGIDSKLLKAGDIACLKRVIV--------------PDENGLNELRNEVETMKQ 108
           E+  E+  G   K+  A DI   + V +              P  N  N+++ E+  MK+
Sbjct: 94  EIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAGPKRNDPNKIKKEIAIMKK 153

Query: 109 L--RGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLAT------KLT 160
              +    +++  D  +SR        +I L++E C K  +L    ++L        +L+
Sbjct: 154 CNNKHVVKLIEILDDLSSR--------KIYLVLEYCEKGPILWCPRDQLEIDSRGPPQLS 205

Query: 161 EAEILKIMYDVSNAIAQMHYLPT-PLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVS 219
                +I  DV   I  + YL +  +IHRDIK  N+L+DK+   K+ DFG +      + 
Sbjct: 206 FQRAREIFRDV---ILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSLAANGNID 262

Query: 220 THQDIAVLTNNIYVHTTPQYRSPEMI--------------DLYRCLPINEKSDIWALGIF 265
           T+ D   LT  +    TP + +PE+               +L+    I+ K DIWALGI 
Sbjct: 263 TNDDELELTKTV---GTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDIWALGIT 319

Query: 266 LYKLLF----YTTPFELTGQFAILHSKYEIP-----QNGYSSKLI---------NLIIIM 307
           LY LLF    + + FEL     I++ K   P     Q+ + S++          +L+  +
Sbjct: 320 LYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIREFVHAKDLLNKL 379

Query: 308 LAENPSLRPNIYQVMHH--VCSILK 330
           L +NP+ R +I  +  H  VC   K
Sbjct: 380 LEKNPAKRISIPDIKVHPFVCWDFK 404

>Kwal_47.18233
          Length = 598

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 137/291 (47%), Gaps = 52/291 (17%)

Query: 41  RCEILEHLAEGGFANIYKVKFLELTNEMDAG--IDSKLLKAGDIACLKRVIVPDENGLNE 98
           + +I++ L EG F  + K+ +   T +  A   I+ K+L   D+                
Sbjct: 30  KYQIIKTLGEGSFGKV-KLAYHVTTGQKVALKIINKKVLAKSDMQ-------------GR 75

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           +  E+  ++ LR  P+I++ YD   S+        EI++++E    + L DY+  +   K
Sbjct: 76  IEREISYLRLLR-HPHIIKLYDVVKSKD-------EIVMVIEYAGNE-LFDYIVQR--DK 124

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           ++E E  +    + +A+   H     ++HRD+K EN+L+D+  N K+ DFG ++      
Sbjct: 125 MSENEARRFFQQIISAVEYCHR--HKIVHRDLKPENLLLDEHLNVKIADFGLSN------ 176

Query: 219 STHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
                  ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L    P
Sbjct: 177 -------IMTDGNFLRTSCGSPNYAAPEVIS--GKLYAGPEVDVWSSGVILYVMLCRRLP 227

Query: 276 FE---LTGQFA-ILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVM 322
           F+   +   F  I +  Y +P+   S    NLI  ML  NP  R  I+++M
Sbjct: 228 FDDESIPVLFKNISNGIYTLPK-FLSPGAANLIKRMLIVNPLNRITIHEIM 277

>Scas_660.28
          Length = 623

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 135/295 (45%), Gaps = 50/295 (16%)

Query: 38  GTH--RCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENG 95
           G+H    +I++ L EG F  +      +L   M  G    L        + + ++   + 
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKV------KLAYHMTTGQKVAL------KIINKKVLAKSDM 87

Query: 96  LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
              +  E+  ++ LR  P+I++ YD   S+        EI+++ME    + L DY+  + 
Sbjct: 88  QGRIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVMEYAGNE-LFDYIVQR- 137

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
             K++E E  +    + +A+   H     ++HRD+K EN+L+D+  N K+ DFG ++   
Sbjct: 138 -DKMSEDEARRFFQQIISAVEYCHR--HKIVHRDLKPENLLLDEHLNVKIADFGLSN--- 191

Query: 216 PIVSTHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272
                     ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L  
Sbjct: 192 ----------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSCGVILYVMLCR 239

Query: 273 TTPFE---LTGQFA-ILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMH 323
             PF+   +   F  I +  Y IP+   S     LI  ML  NP  R +I ++M 
Sbjct: 240 RLPFDDESIPVLFKNINNGVYTIPKF-LSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 110/234 (47%), Gaps = 33/234 (14%)

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           +  E+  MK L   PN+++ YD   +         ++ +++E   K  L + +  +    
Sbjct: 75  IEREIIIMKLL-NHPNVLRLYDVWETAQ-------DLYMVLEYVEKGELFNLLVQR--GP 124

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           L E E ++    +   I+  H L   ++HRD+K EN+L+D   N KL DFG  ++     
Sbjct: 125 LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAAL----- 177

Query: 219 STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 276
              +D  + T+      +P Y +PE++     LP +  +SD+W+ G+ LY LL    PF 
Sbjct: 178 -ESKDKLLETS----CGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 229

Query: 277 ELTGQ-----FAILHSKYEIP-QNGYSSKLINLIIIMLAENPSLRPNIYQVMHH 324
           E  G        +   KYEIP ++  S +  +LI+ +L   P  R    +++ H
Sbjct: 230 EEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKH 283

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 104/234 (44%), Gaps = 31/234 (13%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           E   +++L  SP++V+ +    S   D S    +  L+E  P    L  M  K    L E
Sbjct: 227 EKTALQKLNNSPSVVRLF----STFQDES---SLYFLLEYAPNGDFLSLM--KKYGSLDE 277

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP----I 217
                    + +AI  +H     +IHRDIK EN+L+D +   KL DFG+  +  P    +
Sbjct: 278 TCARYYAAQIIDAIDYLH--SNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSV 335

Query: 218 VSTHQDIAVLTNNIYVHTTPQYRSPEMID----LYRCLPINEKSDIWALGIFLYKLLFYT 273
                D++  + +     T +Y SPE+++     YRC       DIWA G  L++++   
Sbjct: 336 SKPEYDLSTRSKSFV--GTAEYVSPELLNDSFTDYRC-------DIWAFGCILFQMIAGK 386

Query: 274 TPFELTGQFAILHSKYEIPQN---GYSSKLINLIIIMLAENPSLRPNIYQVMHH 324
            PF+ T ++       ++      G+   + +L+  +L +N   R  I Q+  H
Sbjct: 387 PPFKATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKEH 440

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 107/235 (45%), Gaps = 30/235 (12%)

Query: 105 TMKQLRGSPNIVQYYDSNA-SRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAE 163
           ++ Q+   PN+ + Y+    S H          +  E      LLDY+    + K   A 
Sbjct: 143 SLGQILFHPNVCKLYEMQTLSNH--------YYMFFEFISGGQLLDYIIQHGSLKENHAR 194

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
             K+   + +A+  +H     ++HRD+KIEN+++ K    KL DFG ++M  P     + 
Sbjct: 195 --KVSRGILSALQYLH--ANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYDP----RKS 246

Query: 224 IAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFA 283
           +     ++Y      + +PE++  +  L    + D+W+ G+ LY L+    PF+     A
Sbjct: 247 LQTFCGSLY------FAAPELLKAHPYL--GPEVDVWSFGVVLYVLVCGKVPFDDENSSA 298

Query: 284 ILHSKYEIPQNGY----SSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDVP 334
            LH K +  +  Y    S  +I+L+  +L  +P  R  + QV++H   +   D P
Sbjct: 299 -LHEKIKKGKVTYPQFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLKGYDFP 352

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/294 (27%), Positives = 123/294 (41%), Gaps = 54/294 (18%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNE 102
           EI + L +G F  +Y VK  E          + L+ A  +  +++  +       + R E
Sbjct: 101 EIGKILGKGKFGKVYCVKHRE----------TGLICA--LKAMEKKEIVQYTIQKQFRRE 148

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGF-----EILLLMELCPKKSLLDYMNNKLAT 157
           VE     +   N+ Q Y            GF      + LLME      L  ++ N    
Sbjct: 149 VEIQGSFK-HKNLTQLY------------GFFYDEKRVYLLMEYVYYGELYKFLKNN--G 193

Query: 158 KLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPI 217
            L E      +Y ++NA+  MH     ++HRDIK EN+L+  ++  KL DFG +      
Sbjct: 194 PLNETLASYFVYQMANALDYMH--SKNILHRDIKPENILIGFNNTIKLTDFGWSVYN--- 248

Query: 218 VSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF- 276
               Q    L   I       Y SPE+I   +    N K D+WALG+  Y+LL  + PF 
Sbjct: 249 -EDGQKRKTLCGTI------DYLSPELI---KSREYNNKVDVWALGVLTYELLVGSPPFE 298

Query: 277 ----ELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVC 326
               E+T +  IL    + P N  S +  +LI+ +L   PS R  + +V  H  
Sbjct: 299 EDTKEMTYR-RILRCDLKFPLN-VSPQARDLIVRLLQFEPSKRIPLSEVKSHAW 350

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 94/200 (47%), Gaps = 25/200 (12%)

Query: 135 ILLLMELCPKKSLLDYMN-----NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRD 189
           +  L+E  P    L  M      ++  TK   A+IL       +AI  +H     +IHRD
Sbjct: 276 LYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQIL-------DAIHHLH--KQGIIHRD 326

Query: 190 IKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI-DLY 248
           +K EN+L+DK    KL DFG T+        ++   + T +     T +Y SPE++ D Y
Sbjct: 327 VKPENILLDKTMKIKLTDFG-TAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELLNDNY 385

Query: 249 RCLPINEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEIPQNGYSSKLINLI 304
               ++ + DIWA G  L++++    PF+ T ++     ++  +Y     G+   L +LI
Sbjct: 386 ----VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTA-GFPMILRDLI 440

Query: 305 IIMLAENPSLRPNIYQVMHH 324
             +L + P  R  I Q+  H
Sbjct: 441 KQLLVKKPEQRLTILQIEKH 460

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 140/296 (47%), Gaps = 54/296 (18%)

Query: 37  VGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAG--IDSKLLKAGDIACLKRVIVPDEN 94
           VG +  +I++ L EG F  + K+ +   T +  A   I+ K+L   D+            
Sbjct: 36  VGNY--QIVKTLGEGSFGKV-KLAYHVTTGQKVALKIINKKVLAKSDMQ----------- 81

Query: 95  GLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNK 154
               +  E+  ++ LR  P+I++ YD   S+        EI++++E    + L DY+  +
Sbjct: 82  --GRIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR 130

Query: 155 LATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMC 214
              K++E E  +    + +A+   H     ++HRD+K EN+L+D+  N K+ DFG ++  
Sbjct: 131 --NKMSEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFGLSN-- 184

Query: 215 FPIVSTHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
                      ++T+  ++ T   +P Y +PE+I     L    + D+W+ G+ LY +L 
Sbjct: 185 -----------IMTDGNFLKTSCGSPNYAAPEVIS--GKLYAGPEVDVWSCGVILYVMLC 231

Query: 272 YTTPFE---LTGQFA-ILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMH 323
              PF+   +   F  I +  Y +P+   S    +LI  ML  NP  R +I+++M 
Sbjct: 232 RRLPFDDESIPVLFKNISNGVYTLPK-FLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 132/303 (43%), Gaps = 39/303 (12%)

Query: 44  ILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEV 103
           ++E   +G   ++Y  + L+L    D  ++++  + G+   +K++I+  +     + NE+
Sbjct: 590 MVEKAGQGASGSVYLAERLQLPPYKDE-LEAEKNQLGNKVAIKQMILSKQPRKELIVNEI 648

Query: 104 ETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA-----TK 158
             MK  + + NIV + ++      D      + ++ME     SL D + N        + 
Sbjct: 649 LVMKDSKHN-NIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDIIENSPTGSSGQSP 701

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           LTE +I  I+ +    +  +H     +IHRDIK +NVL+D     K+ DFG    C  + 
Sbjct: 702 LTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTRGRVKITDFG---FCAKLT 756

Query: 219 STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL 278
                 A +        TP + +PE++   +    +EK D+W+LGI   ++L    P+  
Sbjct: 757 DKRSKRATMVG------TPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPPYLN 807

Query: 279 TGQFAILHSKYEIPQNG---------YSSKLINLIIIMLAENPSLRPNIYQVMHHVCSIL 329
                 L   Y I  NG          S ++   + + L  +   R +  +++HH    +
Sbjct: 808 EEPLKAL---YLIATNGTPKLKHPEYLSLEIKRFLSVCLCVDVKYRASTEELLHHSFFNM 864

Query: 330 KCD 332
            C+
Sbjct: 865 SCE 867

>Scas_502.2
          Length = 1116

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 95/197 (48%), Gaps = 19/197 (9%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           +  L+E  P   LL  M  K    L E         + +AI  MH     +IHRDIK EN
Sbjct: 248 LYFLLEYAPNGDLLSLM--KKFGSLNEECCCYYGAQIIDAIKFMH--SKGIIHRDIKPEN 303

Query: 195 VLVDKDDNFKLCDFGSTSMC--FPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI-DLYRCL 251
           +L+DKD   K+ DFG+  +    P  +++    +LT +     T +Y SPE++ D Y   
Sbjct: 304 ILLDKDMKVKITDFGTAKILDNKPPGTSYD---LLTRSKSFVGTAEYVSPELLNDNY--- 357

Query: 252 PINEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEIPQNGYSSKLINLIIIM 307
             + +SDIWA G  +++++    PF+ T ++     ++  +Y     G+ + + +L+  +
Sbjct: 358 -TDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTA-GFPTVVRDLVKRI 415

Query: 308 LAENPSLRPNIYQVMHH 324
           L + P  R  I  +  H
Sbjct: 416 LIKAPEQRLTIEAIEKH 432

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 95/195 (48%), Gaps = 23/195 (11%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           + ++ME C   S  D +       L E ++  I+++V+  +  +H      IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH--EQRKIHRDIKAAN 146

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI- 253
           +L++++   KL DFG        VS H   + L  + +V  TP + +PE++    C  + 
Sbjct: 147 ILLNEEGMVKLGDFG--------VSGHIR-STLKRDTFVG-TPYWMAPEVV----CCEVD 192

Query: 254 --NEKSDIWALGIFLYKLLFYTTPFELTGQFAILHS--KYEIP--QNGYSSKLINLIIIM 307
             NEK+DIW+LGI  Y+LL    P        ++ +  K + P  Q  +S    + +   
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGC 252

Query: 308 LAENPSLRPNIYQVM 322
           L + P+ RP+ Y ++
Sbjct: 253 LVKTPADRPSAYNLL 267

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 92/197 (46%), Gaps = 16/197 (8%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           +  L+E  P    L  M  K    L+E         + + I  +H     +IHRDIK EN
Sbjct: 256 LYFLLEYAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLH--SKGIIHRDIKPEN 311

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQ--DIAVLTNNIYVHTTPQYRSPEMI-DLYRCL 251
           +L+DKD   K+ DFG+  +  P        +  +LT +     T +Y SPE++ D Y   
Sbjct: 312 ILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY--- 368

Query: 252 PINEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEIPQNGYSSKLINLIIIM 307
            ++ + DIWA G  +++++    PF+ T ++     ++  +Y     G+   + +L+  +
Sbjct: 369 -VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTA-GFPVVVRDLVKRI 426

Query: 308 LAENPSLRPNIYQVMHH 324
           L + P  R  I Q+  H
Sbjct: 427 LLKVPEQRLTIPQIEKH 443

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 125/287 (43%), Gaps = 54/287 (18%)

Query: 69  DAGIDSKLLKAGDIACLKRVIVPDENG---LNELRNEVETMKQLRGSPNIVQYYDSNASR 125
           ++G   K L   D   + +  +P EN     N+L  E+  MK ++   NIV +Y +    
Sbjct: 205 NSGTVVKTLHVPDSRIIAKKSIPVENSELVKNQLMRELTIMKNVKEQKNIVGFYGA---- 260

Query: 126 HPDGSPGFEILLLMELCPKKSLLDYMN--------------NKLATKLTEAEILKIMYDV 171
           +       EI++LME     SL D ++              N   +  TE  + KI Y V
Sbjct: 261 YYTAIKNHEIIILMEYMDCGSL-DKISSTYRRYCSRNKVPMNASTSWFTELSLSKISYAV 319

Query: 172 SNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG-STSMCFPIVSTHQDIAVLTNN 230
            N ++ + Y    +IHRDIK  N+L++     K+CDFG S  M   I  T          
Sbjct: 320 LNGLSYL-YQDYKIIHRDIKPSNILINSKGFVKICDFGVSKKMIDSIADT---------- 368

Query: 231 IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG---------- 280
            +V T+  Y SPE I    C   N K D+W+LG+ + +L+  T  F L G          
Sbjct: 369 -FVGTS-TYMSPERIQ-GSCY--NTKGDVWSLGLMIIELV--TGEFPLGGHNDTPEGILD 421

Query: 281 --QFAILHSKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVMHH 324
             Q  +      +P +G +S+ +++ +     ++   R ++ ++M H
Sbjct: 422 LLQRIVNEEPPSLPASGDFSADIMDFVNCCCVKDERKRSSLQELMTH 468

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 110/242 (45%), Gaps = 29/242 (11%)

Query: 43  EILEHLAEGGFANIYKVKFLELTN-EMDAGIDSKLLK--AGDIACLKRVIVPDENGLNEL 99
           +++E   +G   ++Y  + L++   + ++G+    L    GD   +K++I+  +     +
Sbjct: 499 QMIEKAGQGASGSVYLAQRLKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKELI 558

Query: 100 RNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLAT-- 157
            NE+  MK  +   NIV + ++      D      + ++ME     SL D + N + +  
Sbjct: 559 VNEILVMKDSQHK-NIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDVIENSIGSDA 611

Query: 158 ---KLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMC 214
               +TE +I  I+ +    +  +H     +IHRDIK +NVL+D     K+ DFG    C
Sbjct: 612 SESPMTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKSDNVLLDTHGRVKITDFG---FC 666

Query: 215 FPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 274
             +       A +        TP + +PE++        +EK D+W+LGI   ++L    
Sbjct: 667 AKLTDKRSKRATMVG------TPYWMAPEVVKQRE---YDEKVDVWSLGIMTIEMLEGEP 717

Query: 275 PF 276
           P+
Sbjct: 718 PY 719

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 128/310 (41%), Gaps = 46/310 (14%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNE------MDAGIDSKLLKAGDIACLKRVIVPDENGL 96
           +++E   +G   ++Y  +   +  E      ++  ID      GD   +K++++  +   
Sbjct: 547 KVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEP--HVGDKVAIKQMVLSKQPRK 604

Query: 97  NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA 156
             + NE+  MK  R   NIV + ++      D      + ++ME     SL D + N   
Sbjct: 605 ELIVNEILVMKDSRHK-NIVNFLEAYLRTDDD------LWVVMEFMEGGSLTDIIENSPT 657

Query: 157 -----TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
                + LTE +I  I+ +    +  +H     +IHRDIK +NVL+D     K+ DFG  
Sbjct: 658 NDNSHSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTRARVKITDFG-- 713

Query: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
             C  +       A +        TP + +PE++        +EK D+W+LGI   ++L 
Sbjct: 714 -FCARLTDKRSKRATMVG------TPYWMAPEVVKQRE---YDEKIDVWSLGIMTIEMLE 763

Query: 272 YTTPFELTGQFAILHSKYEIPQNG---------YSSKLINLIIIMLAENPSLRPNIYQVM 322
              P+        L   Y I  NG          S ++   + + L  +   R +  +++
Sbjct: 764 GEPPYLNEDPLKAL---YLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELL 820

Query: 323 HHVCSILKCD 332
           HH    + CD
Sbjct: 821 HHGFFNMACD 830

>Scas_458.1
          Length = 367

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 125/302 (41%), Gaps = 58/302 (19%)

Query: 80  GDIACLKRVIVP--DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILL 137
           G +  LKR+  P  D   ++   NE+   K+  G+ +I+   D    +  DGS   ++L 
Sbjct: 59  GPLFVLKRIYCPFGDIESVSAAMNEISYYKKFAGNSHIISCLDYQLHQKYDGSKQIDVLF 118

Query: 138 LMELCPKKSLLDYMN-------NKLATKLTEAEILKIMYDVSNAIAQMH----------- 179
                   S+ D +N         L T + E + +KIM  +   +  +H           
Sbjct: 119 --PFYHYGSVQDDINRHLLSSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPD 176

Query: 180 ------YLP-TPLIHRDIKIEN--------------------VLVDKDDNFKLCDFGSTS 212
                 Y    PL+  D+ +E                     +L+ +  N  + D  S  
Sbjct: 177 DMAIMSYSENAPLLLNDLPMELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCF 236

Query: 213 MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272
                +ST   +      I  H T Q+ +PE++ L     I  K DIW+LG  LY ++F 
Sbjct: 237 RTNITISTEIQLNRFQQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFG 296

Query: 273 TTPFE----LTG---QFAILHSKYEIP--QNGYSSKLINLIIIMLAENPSLRPNIYQVMH 323
            +PFE    L G   ++ I   KY IP  +  YS ++I+++   L  +PS RP++  +++
Sbjct: 297 ISPFEREEQLNGGVVKYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILN 356

Query: 324 HV 325
           ++
Sbjct: 357 NL 358

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 110/234 (47%), Gaps = 33/234 (14%)

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           +  E+  MK L   PN+++ YD   +         ++ +++E   K  L + +  +    
Sbjct: 73  IEREIIIMKLL-NHPNVLRLYDVWETSK-------DLYMVLEYVEKGELFNLLVER--GP 122

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           L E E ++    +   I+  H L   ++HRD+K EN+L+D   N KL DFG  ++     
Sbjct: 123 LPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMAAL----- 175

Query: 219 STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 276
              +D  + T+      +P Y +PE++     LP +  +SD+W+ G+ LY LL    PF 
Sbjct: 176 -ESKDKLLETS----CGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYALLTGRLPFD 227

Query: 277 ELTGQ-----FAILHSKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVMHH 324
           E  G        +   K+E+P +   SS+  +LI  +L  +P  R    +++ H
Sbjct: 228 EEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKH 281

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 27/177 (15%)

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
           NE+  MK  R + NIV + DS   +        ++ ++ME     SL D + + +   LT
Sbjct: 727 NEILVMKGSRHN-NIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 775

Query: 161 EAEILKIMYDVSNAIAQMHYLPT-PLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVS 219
           E +I  +  +    +  +H+L +  +IHRDIK +N+L+  D N KL DFG    C  I  
Sbjct: 776 EGQIAAVSRET---LRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFG---FCAQINE 829

Query: 220 THQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           T+     +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 830 TNLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 132/300 (44%), Gaps = 40/300 (13%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENG-LNELRN 101
           ++LE + +G F ++Y   +L    E     D K+ K   +A +K + +   N  ++ L  
Sbjct: 8   QLLECVGKGNFGDVYLAHYLGSNQE---PTDPKIPKNVPLA-IKCINLEHSNEPIDLLLK 63

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           E+  +  L   P I  YY +             + ++ME C   SLL+ +  +  ++LTE
Sbjct: 64  EIYFLSTLH-CPYITHYYGTFTG-------DCNLYIVMEYCSNGSLLNLL--RYYSRLTE 113

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTH 221
                I+  V +A+  +H     LIHRD+K  N+L++ D   +L D G T       ST 
Sbjct: 114 QTTCFIILQVCHALEYLH--EKRLIHRDLKAANILLNDDGEVRLADLGVTGQ-LKFNSTR 170

Query: 222 QDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 281
                L  N +V  TP + +PE+I   +    + K DIW+LGI   +LL    P      
Sbjct: 171 HGGKNL--NTFV-GTPFWMAPEII---KNQSYDGKCDIWSLGITTLELLNGKPPM---SH 221

Query: 282 FAILHSKYEIPQNGYSSKLINL---------IIIMLAENPSLRPNIYQVMHH----VCSI 328
              + +   IP+    S L N+         I   L ++P+ RP   Q++ H     CSI
Sbjct: 222 LDSMKALMRIPKLNADSILRNMDISPLGKDFIRSCLQQDPNQRPTCKQLLQHKWLKKCSI 281

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 92/201 (45%), Gaps = 32/201 (15%)

Query: 134 EILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           E+ L++E      L DY+ +K   KL E E +     +   ++  H     + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 194 NVLVDKDD-NFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHT---TPQYRSPEMI--DL 247
           N+L+DK +   K+ DFG  ++  P             N  + T   +P Y SPE++    
Sbjct: 244 NLLLDKKNRRIKIADFGMAALELP-------------NKLLKTSCGSPHYASPEIVMGRP 290

Query: 248 YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPQNGYSSKLINL 303
           Y   P    SD+W+ GI L+ LL    PF       +L      KY++P N  SS+  +L
Sbjct: 291 YHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN-LSSEARDL 345

Query: 304 IIIMLAENPSLRPNIYQVMHH 324
           I  +L  +P  R    +++ H
Sbjct: 346 ISKILVIDPEKRITTQEILKH 366

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 135/316 (42%), Gaps = 36/316 (11%)

Query: 17  AATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAG--IDS 74
            AT A I ++ +    T +  G    +  + L +G ++ ++       T++ D+      
Sbjct: 93  TATDADIKDAEIFRRQTIIRKGIKDFKFGDMLGDGSYSQVFLA-----TSKTDSSKTYAV 147

Query: 75  KLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFE 134
           K+L    +   K+V       +N  +  ++ +K + G  N+   +   A+          
Sbjct: 148 KVLNKEYLIKQKKV-----KYVNIEKTALQNLKSVTGVINLSFTFQDEAN---------- 192

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           +  L+E  P    L  +  K  T L E   +     + +AI  MH     +IHRDIK EN
Sbjct: 193 LYFLLEYAPNGDFLSLIK-KFGT-LNEECTIYYSAQIIDAIGSMH--SHGIIHRDIKPEN 248

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQD--IAVLTNNIYVHTTPQYRSPEMI-DLYRCL 251
           +L+D +   KL DFG+  +       +      +LT +     T +Y SPE++ D Y   
Sbjct: 249 ILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDNY--- 305

Query: 252 PINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIP---QNGYSSKLINLIIIML 308
             + K DIWA G  +Y+++    PF+ T ++       ++      G+ + + +L+  +L
Sbjct: 306 -TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPTIIRDLVKNIL 364

Query: 309 AENPSLRPNIYQVMHH 324
            + P  R  I Q+  H
Sbjct: 365 VKQPEKRLTIPQIKEH 380

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 110/237 (46%), Gaps = 37/237 (15%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSK--LLKAGDIACLKR-VIVPDENGLNELRNEVE 104
           L EG F    KVK L  T     G + +  + K   I  ++R  IV +     ++  E+ 
Sbjct: 50  LGEGEFG---KVK-LGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREIN 105

Query: 105 TMKQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAE 163
            +K L   PN+V+  +    S++        I +++E         Y+  K   +L E+ 
Sbjct: 106 ALKHL-THPNVVRLEEVLQNSKY--------IGIVLEYASGGEFYKYIQRK--RRLKEST 154

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
             ++   + + +  MH     L+HRD+K+EN+L+DK++N  + DFG  +   P       
Sbjct: 155 ACRLFAQLISGVTYMH--SKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLP------- 205

Query: 224 IAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
                +N Y+ T   +P Y +PE++   R   +  K+D+W+ GI LY +L    P++
Sbjct: 206 -----DNEYMKTSCGSPCYAAPELVISTRPY-VARKADVWSCGIILYAMLAGYLPWD 256

>Kwal_23.6325
          Length = 1542

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 122/267 (45%), Gaps = 37/267 (13%)

Query: 77   LKAGDIACLKRVIVPDENGLNE----LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPG 132
            L  G+I  +K + + D   + +    ++ E+  ++ L   PN+VQYY     R       
Sbjct: 1269 LDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLN-HPNVVQYYGVEVHRD------ 1321

Query: 133  FEILLLMELCPKKSLLDYMN-----NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIH 187
             ++ L ME C   SL   +      +++ T++   ++L+        +A +H   + ++H
Sbjct: 1322 -KVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLE-------GLAYLH--QSSVVH 1371

Query: 188  RDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHT---TPQYRSPEM 244
            RDIK EN+L+D +   K  DFG+        +   ++        V++   TP Y SPE 
Sbjct: 1372 RDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPES 1431

Query: 245  IDLYRCLPINEKSDIWALGIFLYKLLFYTTP-FELTGQFAILH--SKYEIPQ----NGYS 297
            I   +        DIW+LG  + +++    P F L  ++AI++  +   +PQ       S
Sbjct: 1432 ITGAKKGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELS 1490

Query: 298  SKLINLIIIMLAENPSLRPNIYQVMHH 324
             + I+ ++  L ++P+ R    +++ H
Sbjct: 1491 PQGIDFLLRCLKQDPNKRSTAMELLLH 1517

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 103/238 (43%), Gaps = 43/238 (18%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVI---VPDENGLNEL 99
           E+   L +G F  +Y V+                 K+G I  LK +    +   N L +L
Sbjct: 101 EVGRKLGKGKFGKVYCVRHK---------------KSGFICALKAIEKNEILQFNLLKQL 145

Query: 100 RNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKL 159
           + EV+    +   PNI++ Y   A  H +      + LLME      L   + N      
Sbjct: 146 KREVDIQLGM-DHPNIIKLY---AHFHDEK----RVYLLMEHSINGELYKSLKNN--GPF 195

Query: 160 TEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVS 219
            +      +Y +++A+  MH     +IHRD+K ENVL+  D+  KL DFG  S+  P  S
Sbjct: 196 NDVLASHYIYQIADALHYMH--KKRIIHRDVKPENVLIGFDNVVKLADFG-WSILNPEGS 252

Query: 220 THQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
             + +           T  Y SPEMI        +E+ D+WALG+  Y+L+    PFE
Sbjct: 253 KRKTLC---------GTIDYLSPEMITPRE---YDEQVDVWALGVLAYELVVGVPPFE 298

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 98/204 (48%), Gaps = 25/204 (12%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           +L E      LLDY+    + +  E +  K    +++A+  +H     ++HRD+KIEN++
Sbjct: 221 MLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALIYLH--ANNIVHRDLKIENIM 276

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP-INE 255
           +      K+ DFG ++    I  + + +     ++Y      + +PE++   +  P    
Sbjct: 277 ISDSSEIKIIDFGLSN----IYDSRKQLHTFCGSLY------FAAPELL---KANPYTGP 323

Query: 256 KSDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPQNGYSSKLINLIIIMLAE 310
           + D+W+ G+ L+ L+    PF+     ++LH      K E PQ+  S ++I+L+  ML  
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH-LSIEVISLLSKMLVV 381

Query: 311 NPSLRPNIYQVMHHVCSILKCDVP 334
           +P  R  + QV+ H   +   + P
Sbjct: 382 DPKRRATLKQVVEHHWMVRGFNGP 405

>Scas_675.2
          Length = 527

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 98/202 (48%), Gaps = 24/202 (11%)

Query: 82  IACLKRVIVP--DENGLNE--LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILL 137
           I  +K V +P   +NGL E  +  EV    +   +PN+++  D N ++         + +
Sbjct: 41  IIAVKYVHIPTCKKNGLTEKDISREVLLHSRCSKNPNVLRLIDCNIAKD-------YMWM 93

Query: 138 LMELCPKKSLLDYMNNKLATKLTEAEILKIMYD-VSNAIAQMHYLPTPLIHRDIKIENVL 196
           +ME+     L D +   +     ++E+ +  +  +  AI+ +H     + HRDIK EN+L
Sbjct: 94  IMEMADGGDLFDKIEPDVGV---DSEVAQFYFQQLVRAISYLHE-ECGVAHRDIKPENIL 149

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 256
           +DK+ N KL DFG +S         +    L  +     +P Y +PE+  L+        
Sbjct: 150 LDKNGNLKLADFGLSS------QYRRKDGTLRISTDQRGSPPYMAPEI--LHSRGYYAHS 201

Query: 257 SDIWALGIFLYKLLFYTTPFEL 278
           +DIW++GI L+ LL   TP+EL
Sbjct: 202 TDIWSIGILLFVLLTGETPWEL 223

>Scas_544.6
          Length = 489

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 117/252 (46%), Gaps = 51/252 (20%)

Query: 55  NIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRV---IVPDENG----LNELRNEVETMK 107
           +IY+++ L    ++ AG    ++KA  +   K +   I+P E      +N+L  E+  MK
Sbjct: 150 SIYQLQDLVRLGKIGAGNSGTVIKALHVPSSKIIAQKIIPLEKNNEIVVNQLIRELTIMK 209

Query: 108 QLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSL------------LDYMNNKL 155
            ++   NI+ +Y +  + H +     EI++LME     SL               ++ + 
Sbjct: 210 SIKPHKNIISFYAAFYTHHQNN----EIVILMEYMDCGSLDRIFSTYKRFVARGVLDPRE 265

Query: 156 ATKLTEAEIL-KIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMC 214
                ++ IL +I Y V N +  + Y    +IHRDIK  NVL++     KLCDFG +   
Sbjct: 266 KNWFNDSLILSRISYAVLNGLNYL-YENYKIIHRDIKPSNVLINSKGLVKLCDFGVSK-- 322

Query: 215 FPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 272
             ++++  D  V         T  Y SPE I  ++Y     + K D+W+LG+ + +L   
Sbjct: 323 -KLINSIADTFV--------GTSTYMSPERIQGNVY-----STKGDVWSLGLMIIEL--- 365

Query: 273 TTPFELTGQFAI 284
                +TGQF +
Sbjct: 366 -----VTGQFPL 372

>Kwal_26.7355
          Length = 1446

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 133/320 (41%), Gaps = 76/320 (23%)

Query: 46   EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP-----DENGLN--- 97
            E + +G F ++    FL L            +  G++  +K+V VP     DE  L+   
Sbjct: 1150 EMIGKGSFGSV----FLGLN-----------VTTGEMIAVKQVEVPRYGSQDETTLSVLE 1194

Query: 98   ELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFE-----ILLLMELCPKKSLLDYMN 152
             LR+EV T+K L  + NIVQY             GFE       L +E     S+   + 
Sbjct: 1195 ALRSEVATLKDLDHT-NIVQYL------------GFENKNYVYSLFLEYVAGGSVGSLI- 1240

Query: 153  NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
             +L  K  E  I  +   V   ++ +H     ++HRD+K +N+L+D D   K+ DFG   
Sbjct: 1241 -RLYGKFDENLIRFLAVQVLRGLSYLHS--KKILHRDMKADNLLLDVDGICKISDFG--- 1294

Query: 213  MCFPIVSTHQDIAVLTNNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGIFL 266
                       I+  +NNIY ++      T  + +PEM+D  +    + K DIW+LG  +
Sbjct: 1295 -----------ISKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVV 1341

Query: 267  YKLLFYTTPFE----LTGQFAILHSKYEIPQNGYSSKLIN-----LIIIMLAENPSLRPN 317
             ++     P+     +   F I   K   P    + K+I+      +      NP  RP 
Sbjct: 1342 LEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPT 1401

Query: 318  IYQVMHHVCSILKCDVPFTD 337
              +++ H   I+  +  F +
Sbjct: 1402 ADELLSHPFCIVDKEFVFKE 1421

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 94/199 (47%), Gaps = 24/199 (12%)

Query: 135 ILLLMELCPKKSLLDYMN-----NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRD 189
           +  L+E  P    L  M      N+   +   A++L       +AI  +H     ++HRD
Sbjct: 256 LYFLLEYAPNGDFLSVMKKFGSLNEECCRYYGAQML-------DAIDFIH--KNGVVHRD 306

Query: 190 IKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYR 249
           IK EN+L+D+    KL DFG+  +      +  ++  L  +     T +Y SPE+++   
Sbjct: 307 IKPENILLDEHMKVKLTDFGTAKLLDRDEKSGYNL--LKKSRSFVGTAEYVSPELLN-DN 363

Query: 250 CLPINEKSDIWALGIFLYKLLFYTTPFELTGQF----AILHSKYEIPQNGYSSKLINLII 305
           C  +N K DIWA G  LY+++    PF+ T ++     ++  +Y     G+   + +L+ 
Sbjct: 364 C--VNYKCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAF-TAGFPLVIRDLVK 420

Query: 306 IMLAENPSLRPNIYQVMHH 324
            +L ++P  R N  QV  H
Sbjct: 421 QLLVKSPEARLNASQVKSH 439

>Scas_564.7
          Length = 1210

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 94/202 (46%), Gaps = 21/202 (10%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           +L E      LLDY+    +  L E    K    +++A+  +H     ++HRD+KIEN++
Sbjct: 263 MLFEYVSGGQLLDYIIQHGS--LREHHARKFARGIASALEYIHA--NNIVHRDLKIENIM 318

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK 256
           +      K+ DFG ++    +    + +     ++Y      + +PE++  +       +
Sbjct: 319 ISTSGEIKIIDFGLSN----VFDRKKQLHTFCGSLY------FAAPELLKAHPY--TGPE 366

Query: 257 SDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGY----SSKLINLIIIMLAENP 312
            D+W+ G+ LY L+    PF+     ++LH K +  +  Y    S ++I+L+  ML  +P
Sbjct: 367 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYPNHLSIEVISLLSKMLVVDP 425

Query: 313 SLRPNIYQVMHHVCSILKCDVP 334
             R ++ QV+ H       D P
Sbjct: 426 LRRASLKQVVEHPWMTRGYDYP 447

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 96/204 (47%), Gaps = 25/204 (12%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           +L E      LLDY+       L E    K +  +++A+  +H     ++HRD+KIEN++
Sbjct: 199 MLFEYVSGGQLLDYIIQH--GSLRERHARKFVRGIASALQYLHL--NNIVHRDLKIENIM 254

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP-INE 255
           +      K+ DFG +++        + +     ++Y      + +PE++   +  P I  
Sbjct: 255 ISTSGEIKIIDFGLSNL----YDNKKQLHTFCGSLY------FAAPELL---KANPYIGP 301

Query: 256 KSDIWALGIFLYKLLFYTTPFELTGQFAILH-----SKYEIPQNGYSSKLINLIIIMLAE 310
           + DIW+ G+ +Y L+    PF+     ++LH      K E PQ+  S + I+L+  ML  
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFD-DENASVLHEKIKKGKVEYPQH-LSIECISLLSKMLVV 359

Query: 311 NPSLRPNIYQVMHHVCSILKCDVP 334
           +P  R ++ QV +H       D P
Sbjct: 360 DPLKRASLKQVCNHQWMQRGFDFP 383

>Scas_627.7
          Length = 349

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 85/164 (51%), Gaps = 22/164 (13%)

Query: 166 KIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIA 225
           + ++ +++A+  +H     +IHRD+K EN+L+  ++  KL DFG  S+  P     + + 
Sbjct: 193 RFVFQIADALNYLH--DKQIIHRDLKPENILIGFNNVIKLTDFG-WSIINPRGVKRKTLC 249

Query: 226 VLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-----ELTG 280
                     T  Y SPEMI   R    ++K D+WALG+  Y+L+  + PF     ELT 
Sbjct: 250 ---------GTIDYLSPEMI---RSREYDDKVDVWALGVLTYELIVGSPPFEEDTKELTY 297

Query: 281 QFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHH 324
           +  IL +  + P+   S  + +LI  +L  NPS R ++  VM H
Sbjct: 298 K-RILKNDIKFPET-VSHDVKDLISKLLKYNPSERISMRDVMKH 339

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 127/300 (42%), Gaps = 37/300 (12%)

Query: 35  VVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDEN 94
           V +G    +  E L +G ++++       L    D+G      K   +  L +  +  + 
Sbjct: 118 VKMGIKDFKFGEQLGDGSYSSVV------LATARDSG------KKYAVKVLSKEYLIRQK 165

Query: 95  GLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNK 154
            +  +  E   +++L G+  I + + +             +  L+E  P    L  +  K
Sbjct: 166 KVKYVTVEKLALQKLNGTKGIFKLFFTFQDEA-------SLYFLLEYAPHGDFLGLI--K 216

Query: 155 LATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMC 214
               L E         + +A+  +H +   +IHRDIK EN+L+DK+   KL DFG T+  
Sbjct: 217 KYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPENILLDKNMKVKLTDFG-TAKI 273

Query: 215 FPIVSTHQDIAVLTNNIYVHT-----TPQYRSPEMI-DLYRCLPINEKSDIWALGIFLYK 268
            P   ++        ++Y  +     T +Y SPE++ D Y     + + DIWA G  LY+
Sbjct: 274 LPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNY----TDSRCDIWAFGCILYQ 329

Query: 269 LLFYTTPFELTGQFAILHSKYEIP---QNGYSSKLINLIIIMLAENPSLRPNIYQVMHHV 325
           +L    PF+   ++       +I      G+   + +L+  +L  +P+ R  I Q+  H+
Sbjct: 330 MLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVKKLLVRDPNDRLTIKQIKAHL 389

>Kwal_47.17263
          Length = 1127

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 120/285 (42%), Gaps = 59/285 (20%)

Query: 94  NGLNELRNEVETMKQLRGS--PNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
           NG ++++ E+  MK+        +V+  D + SR        +I L++E C K  +    
Sbjct: 153 NGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSR--------KIYLVLEYCSKGEVKWCP 204

Query: 152 NNKLATK------LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKL 205
            ++L T+      LT     +I   V   +  +HY    +IHRDIK  N+L+ +    K+
Sbjct: 205 GDQLETEARGPPLLTFQRAREIFRGVVLGLEYLHY--QGIIHRDIKPANLLISESGTVKI 262

Query: 206 CDFGSTSMCFPIVSTHQDIAVLTNNIYVHT--TPQYRSPEMIDLY----RCLP------- 252
            DFG   + F    +      L       T  TP + +PE+   +    R  P       
Sbjct: 263 SDFG---VSFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDH 319

Query: 253 ---INEKSDIWALGIFLYKLLFYTTPF----------ELTGQFAILHSKYEIPQNGYSSK 299
              I+   DIWA+G+ L+ LLF   PF          ++  Q  +L +  E+  NG  SK
Sbjct: 320 GSIISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGI-SK 378

Query: 300 LIN---------LIIIMLAENPSLRPNIYQVMHH--VCSILKCDV 333
           + N         L+  +L +NP  R  I ++  H  VC   + DV
Sbjct: 379 ISNQEEYEAAKDLLGRLLTKNPFKRIKIAEIKKHPFVCWDFEHDV 423

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 77/304 (25%), Positives = 126/304 (41%), Gaps = 64/304 (21%)

Query: 46   EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNE------- 98
            E + +G F  +Y    L +T              G++  +K+V VP  +  NE       
Sbjct: 1179 EMIGKGSFGAVYLC--LNVT-------------TGEMMAVKQVEVPKYSSQNEAILSTVE 1223

Query: 99   -LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFE-----ILLLMELCPKKSLLDYMN 152
             LR+EV T+K L    NIVQY             GFE       L +E     S+   + 
Sbjct: 1224 ALRSEVSTLKDL-DHLNIVQYL------------GFENKNNIYSLFLEYVAGGSVGSLI- 1269

Query: 153  NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
             ++  +  E  I  +   V   +A +H     ++HRD+K +N+L+D+D   K+ DFG   
Sbjct: 1270 -RMYGRFDEPLIKHLTTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG--- 1323

Query: 213  MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272
                I    +DI    +++ +  T  + +PEM+D  +    + K DIW+LG  + ++   
Sbjct: 1324 ----ISRKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAG 1376

Query: 273  TTPFE----LTGQFAILHSKYEIPQNGYSSKLI-----NLIIIMLAENPSLRPNIYQVMH 323
              P+     +   F I  SK   P    +  LI     N +      NP  RP   +++ 
Sbjct: 1377 KRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLS 1436

Query: 324  HVCS 327
            H  S
Sbjct: 1437 HPFS 1440

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 104/225 (46%), Gaps = 35/225 (15%)

Query: 77   LKAGDIACLKRVIVPDENGLNE----LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPG 132
            L  GDI  +K + + D   + +    L+ E+  M+ L   PNIVQYY     R       
Sbjct: 1279 LDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NHPNIVQYYGVEVHRD------ 1331

Query: 133  FEILLLMELCPKKSLLDYMN-----NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIH 187
             ++ + ME C   SL   +      +++ T++   ++L+        +A +H   + ++H
Sbjct: 1332 -KVNIFMEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLE-------GLACLH--QSGVVH 1381

Query: 188  RDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVH-----TTPQYRSP 242
            RDIK EN+L+D++   K  DFG+  +     +  + I++  NN          TP Y +P
Sbjct: 1382 RDIKPENILLDRNGVIKYVDFGAAKLIAK--NGSKRISLDANNKSTGGKDMIGTPMYMAP 1439

Query: 243  EMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE-LTGQFAILH 286
            E +            DIW+LG  + +++    P+  L  ++AI++
Sbjct: 1440 ETVTGQGHGKFG-SDDIWSLGCVVLEMVTGRRPWANLDNEWAIMY 1483

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 72/143 (50%), Gaps = 14/143 (9%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           I +++E         Y+  K   +L E+   ++   + + +  MHY    L+HRD+K+EN
Sbjct: 125 IGIVLEFVSGGEFYKYIQRK--RRLKESSACRLFAQLISGVNYMHY--KGLVHRDLKLEN 180

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPIN 254
           +L+DK +N  + DFG  +  F      +D  ++  +     +P Y +PE++   +     
Sbjct: 181 LLLDKHENLVITDFGFVNEFF------EDNELMKTSC---GSPCYAAPELVVSTKAYEA- 230

Query: 255 EKSDIWALGIFLYKLLFYTTPFE 277
            K+D+W+ G+ LY +L    P++
Sbjct: 231 RKADVWSCGVILYAMLAGYLPWD 253

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 56/176 (31%), Positives = 85/176 (48%), Gaps = 30/176 (17%)

Query: 154  KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
            +L T +TE E   +   V++ I  +H     ++HRDIK ENV+VD     KL DFGS + 
Sbjct: 1070 ELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAAY 1127

Query: 214  CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLF 271
               + S   D+ V         T  Y +PE++  + Y   P     DIWA+G+ LY +++
Sbjct: 1128 ---VKSGPFDVFV--------GTIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIY 1172

Query: 272  YTTPFE-----LTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVM 322
               PF      L G   I  S +E+     S++ + LI  +L  + S RP I  +M
Sbjct: 1173 KENPFYNIDEILDGDLRI-QSTHEV-----SAECVALIRKILNRSVSKRPTIDDIM 1222

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 111/238 (46%), Gaps = 40/238 (16%)

Query: 77   LKAGDIACLKRVIVPDENGLNE---LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGF 133
            L+ G+I  +K + + D   + +   L  E  T+ ++   PNIVQYY     R        
Sbjct: 1054 LENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYYGVEVHRD------- 1106

Query: 134  EILLLMELCPK---KSLLDY--MNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHR 188
            ++ + ME C      SLLD+  + +++ T++   E+L+        +A +H   + ++HR
Sbjct: 1107 KVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLE-------GLAYLH--QSGVVHR 1157

Query: 189  DIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTH---------QDIAVLTNNI-YVHTTPQ 238
            DIK EN+L+D +   K  DFG+      +V +          QD  V T ++  +  TP 
Sbjct: 1158 DIKPENILLDFNGIIKYVDFGTAR---TVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPM 1214

Query: 239  YRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE-LTGQFAILH--SKYEIPQ 293
            Y +PE I            D+WALG  + ++     P+  L  ++AI++  +   IPQ
Sbjct: 1215 YMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQ 1272

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 107/238 (44%), Gaps = 30/238 (12%)

Query: 97  NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA 156
           N++  EV    +     NI++  D N S+         + + ME+     L D +   + 
Sbjct: 4   NDVSKEVIIHSRCSKHSNILKVIDCNISKD-------YLWIAMEMADGGDLFDKIEPDIG 56

Query: 157 TKLTEAEILKIMYD-VSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
               +AE+ +  +  +  AI  +H +   + HRDIK EN+L+DK+ N KL DFG  S   
Sbjct: 57  V---DAEVAQFYFQQLLRAIHHLHEV-CGIAHRDIKPENILLDKNGNLKLADFGLASQFR 112

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
               T +    L  +     +P Y +PE+I  Y      + +DIW+ GI ++ LL   TP
Sbjct: 113 RKDGTKR----LARD--QRGSPPYMAPEII--YSSEYYADTTDIWSCGILVFVLLTGETP 164

Query: 276 FELTGQFAILHSKYEIPQNGYSS---------KLINLIIIMLAENPSLRPNIYQVMHH 324
           +EL  +      ++ +  NG  S           +NL+  +L  NPS R  I Q+  H
Sbjct: 165 WELPSEDDYNFREF-LEDNGNLSFGPWAKIDFTQLNLLRKILQPNPSKRATILQLTSH 221

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 113/259 (43%), Gaps = 43/259 (16%)

Query: 78  KAGDIACLK---RVIVPDENGLNELRNEVETMKQLRGSPNIVQ----YYDSNASRHPDGS 130
           K G I  LK   +  +   N   + R EVE    LR  PN+ Q    +YD          
Sbjct: 161 KTGFICALKAMEKKEITQYNVQKQFRREVEIQASLR-HPNLTQLYGYFYDDK-------- 211

Query: 131 PGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDI 190
               + LLME      L  Y + ++     +      +  +++A+  MH     ++HRDI
Sbjct: 212 ---RVYLLMEYLVNGEL--YRHLRVNGPFNDILASYYVNQMADALNYMH--DRNVLHRDI 264

Query: 191 KIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRC 250
           K EN+L+   +  KL DFG +     I +T      L   +       Y SPE++  YR 
Sbjct: 265 KPENILIGFQNTLKLTDFGWSV----ISTTGAKRKTLCGTL------DYLSPELVK-YR- 312

Query: 251 LPINEKSDIWALGIFLYKLLFYTTPF-----ELTGQFAILHSKYEIPQNGYSSKLINLII 305
              +EK D+WALG+  Y+LL  T PF     ELT +  I+      P +  S    +LI 
Sbjct: 313 -EYDEKVDVWALGVLAYELLVGTPPFEEASKELTYK-RIVRRDLRFP-DQMSIDARDLIG 369

Query: 306 IMLAENPSLRPNIYQVMHH 324
            +L  +PS R ++  V+ H
Sbjct: 370 RLLENDPSTRISLKDVLSH 388

>Scas_616.10
          Length = 1461

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 111/252 (44%), Gaps = 49/252 (19%)

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           +  E+  MK L   PN++  Y+   ++        E+ L++E      L DY+ +K   K
Sbjct: 183 IEREIVIMK-LISHPNVMALYEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 232

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDD-NFKLCDFGSTSMCFPI 217
           L+E E +     +   ++  H     + HRD+K EN+L+DK + + K+ DFG  ++  P 
Sbjct: 233 LSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKSIKIADFGMAALELP- 289

Query: 218 VSTHQDIAVLTNNIYVHTT---PQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFY 272
                       N  + T+   P Y SPE++    Y   P    SD+W+ GI L+ LL  
Sbjct: 290 ------------NKLLQTSCGSPHYASPEIVMGKSYHGGP----SDVWSCGIILFALLTG 333

Query: 273 TTPFELTGQFAIL----HSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSI 328
             PF       +L      K+ +P    S +  +LI  +L  +PS R    ++++H    
Sbjct: 334 HLPFNDDNIKKLLLKVQAGKFRMPST-LSPEAQDLISRILVIDPSKRITTDRILNH---- 388

Query: 329 LKCDVPFTDKYE 340
                P   KYE
Sbjct: 389 -----PLILKYE 395

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 93/201 (46%), Gaps = 32/201 (15%)

Query: 134 EILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           E+ L++E      L DY+ +K   KL+E E +     +   ++  H     + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 194 NVLVDKDDN-FKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTT---PQYRSPEMI--DL 247
           N+L+DK +   K+ DFG  ++  P             N  + T+   P Y SPE++    
Sbjct: 256 NLLLDKKNKVIKIADFGMAALELP-------------NKLLETSCGSPHYASPEIVMGKP 302

Query: 248 YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAIL----HSKYEIPQNGYSSKLINL 303
           Y   P    SD+W+ GI L+ LL    PF       +L      ++++P    ++   +L
Sbjct: 303 YHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPP-YLTNDAKDL 357

Query: 304 IIIMLAENPSLRPNIYQVMHH 324
           I  +L  NP  R  I ++++H
Sbjct: 358 ITRILVTNPEKRLTINEILNH 378

>Kwal_26.7154
          Length = 1213

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 86/174 (49%), Gaps = 22/174 (12%)

Query: 154  KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
            ++ T +TE E + I   +++ I  +H     ++HRDIK ENV+VD +   K+ DFGS + 
Sbjct: 1054 EMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAY 1111

Query: 214  CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLF 271
               + S   D+ V         T  Y +PE++  + Y   P     DIWA+G+ LY +++
Sbjct: 1112 ---VKSGPFDVFV--------GTIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIY 1156

Query: 272  YTTPFELTGQFAILHSKYEI-PQNGYSSKLINLIIIMLAENPSLRPNIYQVMHH 324
               PF    +  IL +   +      S   I LI  +L  + S RP+I ++ +H
Sbjct: 1157 KENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEICNH 1208

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 89/193 (46%), Gaps = 23/193 (11%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
           +L E      LLDY+       L E    K    +++A+  +H     ++HRD+KIEN++
Sbjct: 200 MLFEYVSGGQLLDYIIQH--GSLKEHHARKFARGIASALQYLHA--NNIVHRDLKIENIM 255

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP-INE 255
           +      K+ DFG ++    I    + +     ++Y      + +PE++   +  P    
Sbjct: 256 ISSSGEIKIIDFGLSN----IFDYRKQLHTFCGSLY------FAAPELL---KAQPYTGP 302

Query: 256 KSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKL----INLIIIMLAEN 311
           + DIW+ GI LY L+    PF+     +ILH K +  +  Y S L    I+L+  M+  +
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEVISLLTRMIVVD 361

Query: 312 PSLRPNIYQVMHH 324
           P  R  +  V+ H
Sbjct: 362 PLRRATLKNVVEH 374

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 55/171 (32%), Positives = 81/171 (47%), Gaps = 22/171 (12%)

Query: 154 KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
           +L T +TE E   I   V++ I  +H     ++HRDIK EN++VD     KL DFGS + 
Sbjct: 84  ELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAY 141

Query: 214 CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLF 271
              + S   D+ V         T  Y +PE++  D Y   P     DIWA+G+ LY ++F
Sbjct: 142 ---VKSGPFDVFV--------GTIDYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIF 186

Query: 272 YTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQV 321
              PF    +  IL     I  +   S + I LI  +L  +   RP I ++
Sbjct: 187 KENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 235

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 96/232 (41%), Gaps = 28/232 (12%)

Query: 41  RCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR 100
           R E+++ +  G +  +   +F E + E    I             KR +           
Sbjct: 20  RFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSL----------- 68

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILL--LMELCPKKSLLDYMNNKLATK 158
            E++ ++  RG  NI   YD +   +PDGS     L   LME C    ++     K    
Sbjct: 69  RELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELME-CDMHQII-----KSGQA 122

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           LT+A      Y +   +  +H     ++HRD+K  N+LV+ D   K+CDFG         
Sbjct: 123 LTDAHYQSFTYQILCGLKYIH--SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE-- 178

Query: 219 STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270
           +  ++   LT  +    T  YR+PE++  Y+     +  DIW+ G  L + L
Sbjct: 179 NPEENNQFLTEYV---ATRWYRAPEIMLSYQ--GYTKAIDIWSTGCILAEFL 225

>Kwal_26.8709
          Length = 829

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 109/237 (45%), Gaps = 41/237 (17%)

Query: 48  LAEGGFANIYKVKFLELTNE-MDAGIDSKLLKAGDIACLKRVIVPDENGLNELR--NEVE 104
           L EG F  + K+ + + +N  MD      + K   I  ++R  +P +N   E++   E+ 
Sbjct: 46  LGEGEFGKV-KLGWSKTSNSSMD------VPKQVAIKLIRRDTIP-KNSEKEIKIYREIN 97

Query: 105 TMKQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAE 163
            +K L   PNIV+  +    S++        I +++E         Y+  K   +L E  
Sbjct: 98  ALKHL-NHPNIVRLEEVLQNSKY--------IGIVLEYASGGEFYKYIQKK--RRLKEGP 146

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQD 223
             ++   + + +  MH     L+HRD+K+EN+L+DK++N  + DFG  +   P       
Sbjct: 147 ACRLFAQLISGVYYMHS--KGLVHRDLKLENLLLDKNENLLITDFGFVNEFLP------- 197

Query: 224 IAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
                 N  + T   +P Y +PE++   R      K+D+W+ G+ LY +L    P++
Sbjct: 198 -----ENELMKTSCGSPCYAAPELVVTARPYEA-RKADVWSCGVILYAMLAGYLPWD 248

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 84/190 (44%), Gaps = 40/190 (21%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           EV+   ++    NI + YD            F+  ++ME C    L + + + +  + T+
Sbjct: 116 EVDIQTKIGKHKNITELYDF-----------FDSYIIMEYCSGGDLYEAIKDDMVPRKTK 164

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTH 221
             +  I+  + +A+  +H     + HRDIK EN+L+  + N KL D+G  +         
Sbjct: 165 -NVTNIINQILDAVEYVH--SRGIYHRDIKPENILIAGNWNIKLTDWGLATT-------- 213

Query: 222 QDIAVLTNNIYVHTTPQYRSPEMI----------DLYRCLPINEKSDIWALGIFLYKLLF 271
            D   +  N+    + +Y +PE+           D Y C     K DIWA+GI +  ++F
Sbjct: 214 -DKTSMERNV---GSERYMAPELFESNLDREERTDAYDCA----KVDIWAIGIVMLNIVF 265

Query: 272 YTTPFELTGQ 281
           +  PF +  Q
Sbjct: 266 HKNPFTVANQ 275

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 109/234 (46%), Gaps = 33/234 (14%)

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           +  E+  MK L   PN+++ +D   +         ++ L++E   K  L + +  +    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFDVWETNS-------DLYLVLEYAEKGELFNMLVER--GP 125

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           L E E ++    +   I+  H L   ++HRD+K EN+L+D   N K+ DFG  ++     
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSLG--VVHRDLKPENLLLDNKLNIKIADFGMAAL----- 178

Query: 219 STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 276
              +D  + T+      +P Y +PE+I     LP     SD+W+ G+ L+ LL    PF 
Sbjct: 179 -ESEDKLLETS----CGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRLPFD 230

Query: 277 ELTGQ-----FAILHSKYEIPQNGYSSKLI-NLIIIMLAENPSLRPNIYQVMHH 324
           E  G        +   ++E+P +   +K   +L+  +L  +PS R  I +++ H
Sbjct: 231 EEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284

>Scas_700.34
          Length = 864

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 109/235 (46%), Gaps = 33/235 (14%)

Query: 48  LAEGGFANIYKVKFLELTNEM---DAGIDSKLLKAGDIACLKR-VIVPDENGLNELRNEV 103
           L EG F    KVK     N +    +GID  + K   I  ++R  I  D +   ++  E+
Sbjct: 54  LGEGEFG---KVKLGWPKNSLPSSSSGID--VPKQVAIKLIRRDTISKDSSKEIKIYREI 108

Query: 104 ETMKQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEA 162
             +K L   PNIV+  +    S++        I +++E         Y+  K   +L E 
Sbjct: 109 NALKHL-THPNIVKLEEVLQNSKY--------IGIVLEYASGGEFYKYIQRK--KRLKEG 157

Query: 163 EILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQ 222
              ++   + N +  +H     L+HRD+K+EN+L+DK +N  + DFG  S  +    +H 
Sbjct: 158 PACRLFAQLINGVHYIHS--KGLVHRDLKLENLLLDKHENLIITDFGFVSEFY----SHG 211

Query: 223 DIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
           ++   +       +P Y +PE++   +     +K+DIW+ G+ LY +L    P++
Sbjct: 212 ELMKTSCG-----SPCYAAPELVVSTKPYEA-KKADIWSCGVILYAMLAGYLPWD 260

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 97/233 (41%), Gaps = 30/233 (12%)

Query: 41  RCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR 100
           R ++++ +  G +  +   +F E  +E    I             KR +           
Sbjct: 24  RFQLIKEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSL----------- 72

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
            E++ ++  RG  NI   YD +    PDG   F  L L E   +  +   +  K    LT
Sbjct: 73  RELKLLRHFRGHKNITCLYDMDIVFQPDGM--FNGLYLYEELMECDMHQIV--KSGQPLT 128

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
           +A     +Y +   +  +H     ++HRD+K  N+LV+ D   K+CDFG       +   
Sbjct: 129 DAHYQSFIYQILCGLKYIH--SADVLHRDLKPGNLLVNADCQLKICDFG-------LARG 179

Query: 221 HQDIAVLTNNI---YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270
           + +  V  N     YV  T  YR+PE++  Y+     +  D+W+ G  L +LL
Sbjct: 180 YSENPVENNQFLTEYV-ATRWYRAPEIMLSYQ--GYTKAIDVWSCGCILAELL 229

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 118/274 (43%), Gaps = 28/274 (10%)

Query: 77   LKAGDIACLKRVIVPDENGLNE----LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPG 132
            L  GDI  +K +   D   + +    +R+E+  ++ L   PN+VQYY     R       
Sbjct: 1211 LDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLN-HPNVVQYYGVEVHRD------ 1263

Query: 133  FEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVS--NAIAQMHYLPTPLIHRDI 190
              + + ME C   SL       LA    E E++  +Y +     +A +H   + + HRDI
Sbjct: 1264 -RVNIFMEYCEGGSLASL----LAHGRIEDEMVTQVYSLQMLEGLAYLH--ESGVDHRDI 1316

Query: 191  KIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRC 250
            K EN+L+D +   K  DFG+  +     S   ++        +  TP Y SPE I     
Sbjct: 1317 KPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTGY 1376

Query: 251  LPINEKSDIWALGIFLYKLLFYTTPFE-LTGQFAILH--SKYEIP----QNGYSSKLINL 303
                   DIW+LG  + +++    P+  L  Q+AI++  +  +IP    +N  S   I  
Sbjct: 1377 GKFG-SDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSKNEMSQAGIKF 1435

Query: 304  IIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTD 337
            +   L ++P+ R    +++     I    + F D
Sbjct: 1436 LSRCLIQDPNQRSTAVELLMDPWIIEIRTIAFGD 1469

>Scas_685.24
          Length = 515

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 125/291 (42%), Gaps = 59/291 (20%)

Query: 40  HRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDEN-GLNE 98
           H   + E +  G F ++Y+             ID    K   +  +K V + + N  L  
Sbjct: 20  HNYIVKECVGRGNFGDVYR------------AIDRTTNK---VVAIKVVDLENTNERLEV 64

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLD----YMNNK 154
           L  E+  + +L+ SP I+ Y     +   D S    + ++ME C   S  D    Y NN 
Sbjct: 65  LAQEIFFLAELK-SPYIINYI---TTLLEDAS----MWIVMEYCGGGSCSDLLKYYFNNG 116

Query: 155 LATKLTEAEILKIMYDVSNAIAQMHYL-PTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
           L  K       K+ Y     +  + YL     IHRDIK  N+L+ ++ + KL DFG +  
Sbjct: 117 LPEK-------KVAYITREILKGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSGQ 169

Query: 214 CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEM----IDLYRCLPINEKSDIWALGIFLYKL 269
              + ST +   ++        TP + +PE+    I+ Y     +EK DIW+LGI +++L
Sbjct: 170 ---LKSTLRRGTIV-------GTPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFEL 214

Query: 270 LFYTTPFELTGQFAILH--SKYEIP--QNGYSSKLINLIIIMLAENPSLRP 316
           L    P        +L   S+   P  Q  YS    + + + L +NP+ RP
Sbjct: 215 LKGVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERP 265

>Scas_668.22
          Length = 893

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 105/236 (44%), Gaps = 44/236 (18%)

Query: 59  VKFLELTNEMD-AGIDSKLLKAGDIACLKRVIVPDENGLNE-----------------LR 100
            K  E+ +E D + I + L+K G  A    V + +E G NE                 + 
Sbjct: 596 AKLKEICSEGDPSKIYTNLVKIGQGAS-GGVYIANEIGSNESVAIKQMNLEKQPKKELII 654

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
           NE+  MK  R  PNIV + DS      DG    ++ ++ME     SL D + + +   LT
Sbjct: 655 NEILVMKGSR-HPNIVNFIDSYLL---DG----DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
           E +I  +  +  + +  +H     ++HRDIK +N+L+    + KL DFG    C  I   
Sbjct: 704 EGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSISGDIKLTDFG---FCAQINEI 758

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           +     +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 759 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 805

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 86/185 (46%), Gaps = 22/185 (11%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           E+E MK+     N+V+ Y+      P+ +   ++ L++E C +  +     NK+  K   
Sbjct: 104 EIEVMKRCH-HENVVELYE--ILNDPEST---KVYLVLEYCSRGPVKWCPENKMEIKAVG 157

Query: 162 AEIL------KIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG----ST 211
             IL      K++ DV + +  +H     + HRDIK  N+L+  +   K+ DFG    + 
Sbjct: 158 PSILTFQQSRKVVLDVVSGLEYLH--SQGITHRDIKPSNLLISSNGTVKISDFGVAMSTA 215

Query: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
           +    I S+H+ +           TP + +PE+    +    +   DIW+LG+ +Y LLF
Sbjct: 216 TGSTNIQSSHEQLL----KSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLF 271

Query: 272 YTTPF 276
              PF
Sbjct: 272 GKLPF 276

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 118/249 (47%), Gaps = 33/249 (13%)

Query: 82  IACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMEL 141
           +  +K V+  ++  LN++  E+  +K L  + NIV+Y       H      +E+ +L+E 
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY-------HGFIRKSYELYILLEY 101

Query: 142 CPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYL-PTPLIHRDIKIENVLVDKD 200
           C   SL   ++   +T L+E E     Y V+  +  + YL    +IHRDIK  N+L+  D
Sbjct: 102 CANGSLRRLISRS-STGLSENE--SKTY-VTQTLLGLKYLHGEGVIHRDIKAANILLSAD 157

Query: 201 DNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 260
           +  KL DFG        VST  + + LT    +  T  + +PE++        +  SDIW
Sbjct: 158 NTVKLADFG--------VSTIVNSSALT----LAGTLNWMAPEILGNRGA---STLSDIW 202

Query: 261 ALGIFLYKLLFYTTPFE-LTGQ---FAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRP 316
           +LG  + ++L    P+  LT     +A+ +  Y  P + +S  L + +     +N   RP
Sbjct: 203 SLGATVVEMLTKNPPYHNLTDANIYYAVENDTYY-PPSSFSEPLKDFLSKCFVKNMYKRP 261

Query: 317 NIYQVMHHV 325
              Q++ HV
Sbjct: 262 TADQLLKHV 270

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 91/185 (49%), Gaps = 25/185 (13%)

Query: 98  ELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLAT 157
           ++  EV    +    PN+++  D N S+         + +++E+     L D +   +  
Sbjct: 61  DITKEVVLQSKCSKHPNVLRLIDCNVSKE-------YMWIILEMADGGDLFDKIEPDVGV 113

Query: 158 KLTEAEILKIMYD-VSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216
              ++++ +  +  + +AI  +H +   + HRDIK EN+L+DK+ N KL DFG  S    
Sbjct: 114 ---DSDVAQFYFQQLVSAINYLH-VECGVAHRDIKPENILLDKNGNLKLADFGLAS---- 165

Query: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMI---DLYRCLPINEKSDIWALGIFLYKLLFYT 273
                +    L  ++    +P Y +PE++   + Y      +++DIW++GI L+ LL   
Sbjct: 166 --QFRRKDGTLRVSMDQRGSPPYMAPEVLYSEEGYYA----DRTDIWSIGILLFVLLTGQ 219

Query: 274 TPFEL 278
           TP+EL
Sbjct: 220 TPWEL 224

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/310 (21%), Positives = 128/310 (41%), Gaps = 45/310 (14%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDA------GIDSKLLKAGDIACLKRVIVPDENGL 96
           +++E   +G   ++Y  +  E+  E D       G + +    GD   +K++++  +   
Sbjct: 565 KMIEKAGQGASGSVYLAERTEII-EADGPQHQRGGTEHEDPLIGDKVAIKQMVLSKQPRK 623

Query: 97  NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM----- 151
             + NE+  M   R   NIV + ++      D      + ++ME     SL D +     
Sbjct: 624 ELIVNEIMVMNDSRHE-NIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDIIENSPT 676

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
           N    + L+E +I  I+ +    +  +H     +IHRDIK +NVL+D     K+ DFG  
Sbjct: 677 NGSAYSPLSEPQIAYIVRETCKGLKFLH--DKNIIHRDIKSDNVLLDTKARVKITDFG-- 732

Query: 212 SMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 271
             C  +       A +        TP + +PE++   +    + K D+W+LGI   ++L 
Sbjct: 733 -FCAKLTDQRSKRATMVG------TPYWMAPEVV---KQKEYDAKVDVWSLGIMAIEMLE 782

Query: 272 YTTPFELTGQFAILHSKYEIPQNG---------YSSKLINLIIIMLAENPSLRPNIYQVM 322
              P+        L   Y I  NG          S ++   + + L  +   R +  +++
Sbjct: 783 GEPPYLNEDPLKAL---YLIATNGTPKLKHPQSLSLEIKRFLSVCLCVDVKYRASTEELL 839

Query: 323 HHVCSILKCD 332
           HH    + C+
Sbjct: 840 HHSFFNIACE 849

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 77/150 (51%), Gaps = 22/150 (14%)

Query: 170 DVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTN 229
           +V+ A+  +H+    +I+RD+K EN+L+D++ + K+ DFG       +  T         
Sbjct: 157 EVTLALEYLHF--HNIIYRDLKPENILLDRNGHIKITDFGFAKEVETVTWT--------- 205

Query: 230 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQF----AIL 285
              +  TP Y +PE+I      P N+  D W+LG+ +Y++L   TPF  T        IL
Sbjct: 206 ---LCGTPDYIAPEVI---ATKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKIL 259

Query: 286 HSKYEIPQNGYSSKLINLIIIMLAENPSLR 315
           H K   PQ  ++S +I+L+  +L  + + R
Sbjct: 260 HGKVVYPQF-FNSDVIDLLSKLLTADLTRR 288

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 77/163 (47%), Gaps = 24/163 (14%)

Query: 114 NIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSN 173
           NIV Y DS  S       G ++ ++ME      L D +   +   LTE +I  +  +V  
Sbjct: 623 NIVNYIDSYLS-------GLDLWVVMEYMEGGCLTDVVTYCV---LTEGQIGAVCREVLQ 672

Query: 174 AIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYV 233
            +  +H     ++HRDIK +NVL+  + + KL DFG    C  +  T     V+     V
Sbjct: 673 GLEFLH--SKGVLHRDIKSDNVLLSMNGDIKLTDFG---FCAQVNDT-----VIKRTTMV 722

Query: 234 HTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
             TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 723 -GTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 127/307 (41%), Gaps = 56/307 (18%)

Query: 46   EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNEL------ 99
            E + +G F  +Y    L L            +  G++  +K+V VP     NEL      
Sbjct: 1155 EMIGKGSFGAVY----LSLN-----------ITTGEMMAVKQVEVPKYGTQNELVKDMVE 1199

Query: 100  --RNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLAT 157
              ++EV T+K L    NIVQY  S          G    L +E     S+   +  +L  
Sbjct: 1200 ALKSEVATLKDL-DHLNIVQYLGSEIR-------GNIYSLFLEYVAGGSVGSLI--RLYG 1249

Query: 158  KLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPI 217
            +  E  I  +   V + +  +H     ++HRD+K +N+L+D+D   K+ DFG +     I
Sbjct: 1250 RFDEKLIRHLNTQVLSGLKYLH--SKGILHRDMKADNLLLDEDGICKISDFGISKKSKNI 1307

Query: 218  VSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
             S         +++ +  T  + +PEM+D  +    + K DIW+LG  + ++     P+ 
Sbjct: 1308 YS--------NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWS 1357

Query: 278  ----LTGQFAILHSKYE--IPQNG---YSSKLINLIIIMLAENPSLRPNIYQVMHHVCSI 328
                +   F I  SK    IP +     SSK  + +      +P  RP    ++ H  S 
Sbjct: 1358 NLEVVAAMFQIGKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLEH--SF 1415

Query: 329  LKCDVPF 335
             K D  F
Sbjct: 1416 SKVDPAF 1422

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 114/265 (43%), Gaps = 70/265 (26%)

Query: 46   EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP-----DENGLN--- 97
            E + +G F  +Y    L L            +  G++  +K+V VP     DE+ ++   
Sbjct: 1042 EIIGKGSFGAVY----LALN-----------VTTGEMLAVKQVTVPEFSSQDESAISMVE 1086

Query: 98   ELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFE-----ILLLMELCPKKSLLDYMN 152
             L++EV T+K L    NIVQY             GFE       L +E     S+   + 
Sbjct: 1087 ALKSEVSTLKDLNHV-NIVQYL------------GFEEKNGIYSLFLEYVAGGSVGSLI- 1132

Query: 153  NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
             ++  +  +  I  +   V   +A +H     ++HRD+K +N+L+D D   K+ DFG   
Sbjct: 1133 -RMYGRFDDQLIRHLTKQVLEGLAYLHS--KGILHRDMKADNLLLDNDGVCKISDFG--- 1186

Query: 213  MCFPIVSTHQDIAVLTNNIYVHT------TPQYRSPEMIDLYRCLPINEKSDIWALGIFL 266
                       I+  +NNIY ++      T  + +PEM+D       + K DIW+LG  +
Sbjct: 1187 -----------ISRKSNNIYSNSDMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVV 1233

Query: 267  YKLLFYTTPFELTGQFAILHSKYEI 291
             ++     P+     F ++ + ++I
Sbjct: 1234 LEMFAGKRPW---SNFEVVAAMFQI 1255

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 101/232 (43%), Gaps = 37/232 (15%)

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
           NE+  MK  +  PNIV + DS   +        ++ ++ME     SL D + + +   LT
Sbjct: 664 NEILVMKGSK-HPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
           E +I  +  +  + +  +H     ++HRDIK +N+L+  + + KL DFG    C  I   
Sbjct: 713 EGQIGAVCRETLSGLEFLHS--KGVLHRDIKSDNILLSMEGDIKLTDFG---FCAQINEL 767

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG 280
           +     +        TP + +PE++      P   K DIW+LGI + +++    P+    
Sbjct: 768 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYL--- 815

Query: 281 QFAILHSKYEIPQNG---------YSSKLINLIIIMLAENPSLRPNIYQVMH 323
               L + Y I  NG          SS L   +   L   P  R +  +++H
Sbjct: 816 NETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLH 867

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 104/249 (41%), Gaps = 34/249 (13%)

Query: 27  HLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLK 86
           H     TQ  +   R ++++ +  G +  +   +F+E   +    I             K
Sbjct: 8   HTFKVFTQDFMVDKRFQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKALLCK 67

Query: 87  RVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKS 146
           R +            E++ ++  RG  NI   YD +    PDGS  F  L L E      
Sbjct: 68  RSL-----------RELKLLRHFRGHKNITCLYDMDIVLLPDGS--FNGLDLYE-----E 109

Query: 147 LLDYMNNKL---ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203
           L+++  +++      LT+A     +Y +   +  +H     ++HRD+K  N+LV+ D   
Sbjct: 110 LMEWDMHQIIKSGQPLTDAHYQSFVYQILCGLKYIH--SADVLHRDLKPGNLLVNADCQL 167

Query: 204 KLCDFGSTSMCF--PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 261
           K+CDFG        PI    ++   LT  +    T  YR+PE++  Y+        D+W+
Sbjct: 168 KICDFGLARGYSENPI----ENDQFLTEYV---ATRWYRAPEIMLSYQ--GYTRAIDVWS 218

Query: 262 LGIFLYKLL 270
            G  L +LL
Sbjct: 219 CGCVLAELL 227

>Kwal_56.24584
          Length = 435

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 104/228 (45%), Gaps = 39/228 (17%)

Query: 69  DAGIDSKLLKAGDIACLKRVIVPDENG---LNELRNEVETMKQLRGSPNIVQYYDSNASR 125
           ++G   K L   D   + +  +P EN     ++L  E+  M+ ++   NIV ++ +  + 
Sbjct: 111 NSGTVIKTLHVPDSRIIAKKSIPVENKPLVKSQLIRELSIMQNVKPHDNIVGFFGAFYT- 169

Query: 126 HPDGSPGFEILLLMELCPKKSLLDYMNNKLA-----------TKLTEAEILKIMYDVSNA 174
               S   EI++LME     SL   M+   A           T   E  + KI Y V N 
Sbjct: 170 ---ASTSNEIVILMEYMDCSSLDKIMSTYKAFVARDMQSLTETWFPEFVLAKISYAVLNG 226

Query: 175 IAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVH 234
           ++ + Y    +IHRDIK  NVL++     K+CDFG +     ++++  D  V T+     
Sbjct: 227 LSYL-YRNYKIIHRDIKPSNVLINSKGFVKICDFGVSK---KLINSIADTFVGTST---- 278

Query: 235 TTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG 280
               Y SPE I   +Y     + K D+W+LG+ + +L+  T  F L G
Sbjct: 279 ----YMSPERIQGSVY-----STKGDVWSLGLMIIELV--TGEFPLGG 315

>Kwal_33.13846
          Length = 375

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 117/279 (41%), Gaps = 46/279 (16%)

Query: 2   SKSDTISR-PNSVAHTAATSAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVK 60
           S ++T +R  NS+   A  +  + ++ L S  T      +   IL  L  G F  ++ V+
Sbjct: 24  STAETQTRQSNSLGQQAVEAKHVQSAALHSRQTSGKYTLNDFHILRTLGTGSFGRVHLVR 83

Query: 61  FLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYD 120
               +N        K+LK   I  LK+V         E  N+   M  +   P I++ + 
Sbjct: 84  ----SNHNGRFYAMKVLKKRTIVKLKQV---------EHTNDERRMLSVVSHPFIIRMWG 130

Query: 121 SNASRHPDGSPGFEILLLMELCPKKSLL---DYMNNKLATKLTEAEILKIMYDVSNAIAQ 177
           +      D    F I+  +E     SLL       N +A K   AE       V  A+  
Sbjct: 131 T----FQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVA-KFYAAE-------VCLALEY 178

Query: 178 MHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTP 237
           +H     +I+RD+K ENVL+DK+ + K+ DFG       +  T            +  TP
Sbjct: 179 LH--AQDIIYRDLKPENVLLDKNGHVKITDFGFAKFVPDVTYT------------LCGTP 224

Query: 238 QYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
            Y +PE++      P N+  D W+ GI ++++L   TPF
Sbjct: 225 DYIAPEVVS---TKPYNKSVDWWSFGILIFEMLAGYTPF 260

>Scas_688.14
          Length = 479

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 98/236 (41%), Gaps = 36/236 (15%)

Query: 41  RCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR 100
           R ++++ +  G +  +   +F E   +    I             KR +           
Sbjct: 22  RFQLIKEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSL----------- 70

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMEL---CPKKSLLDYMNNKLAT 157
            E++ ++  RG  NI   YD +   +PDG+  F  L L E    C    ++     K + 
Sbjct: 71  RELKLLRHFRGHKNITCLYDMDIVFYPDGT--FNGLYLYEELMECDMHQII-----KSSQ 123

Query: 158 KLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPI 217
            LT+A     +Y +   +  +H     ++HRD+K  N+LV+ D   K+CDFG       +
Sbjct: 124 PLTDAHYQSFIYQILCGLKYIH--SADVLHRDLKPGNLLVNADCQLKICDFG-------L 174

Query: 218 VSTHQDIAVLTNNI---YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270
              + +  V  N     YV  T  YR+PE++  Y+     +  DIW+ G  L + L
Sbjct: 175 ARGYSENPVENNQFLTEYV-ATRWYRAPEIMLSYQ--GYTKAIDIWSTGCILAEFL 227

>Scas_493.2
          Length = 1117

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 108/237 (45%), Gaps = 39/237 (16%)

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           +  E+  MK LR + N++  YD   +          + +++E   K  L + +  K    
Sbjct: 81  IEREIIIMKLLRHA-NVLSLYDVWETNS-------NLYMILEYAEKGELFNLLVEK--GP 130

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           L E E ++    +   I+  H L   ++HRD+K EN+L+D   N K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA------- 181

Query: 219 STHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTT 274
                 A+ T +  + T   +P Y +PE++     +P +  +SD+W+ G+ L+ LL    
Sbjct: 182 ------ALETEDKLLETSCGSPHYAAPEIVS---GIPYHGFESDVWSCGVILFALLTGRL 232

Query: 275 PF-ELTGQ-----FAILHSKYEIPQNGYSSK-LINLIIIMLAENPSLRPNIYQVMHH 324
           PF E  G        +   ++E+P +   S+   +LI  +L  +P+ R    +++ H
Sbjct: 233 PFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKH 289

>CAGL0H00979g complement(94328..95527) similar to tr|Q12003
           Saccharomyces cerevisiae YPL236c, hypothetical start
          Length = 399

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 84/375 (22%), Positives = 162/375 (43%), Gaps = 84/375 (22%)

Query: 32  NTQVVVGTHRCEILEHLAEGGFANIYKVKF---LELTNEMDAGIDSKLLKAGDIACLKRV 88
           NT ++V   +  I+  L E   + +Y V+    + L +   +G D    ++ +   LKR+
Sbjct: 23  NTFLLVNGRKYSIVRLLKEDDMSFLYLVRLEDGMPLLSAAASGDDDDGYESVNTYTLKRI 82

Query: 89  IVPDEN--GLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKS 146
             P  N   +++   E++  K+ + SP +V   DS   +  DG+    I ++    P  S
Sbjct: 83  RCPIGNISNVSDAMREIDNYKRFQ-SPYVVSSVDSQVIQELDGAK--TIYIVFPHYPLGS 139

Query: 147 LLDYMNNKL--ATKLTEAEILKIM----------YDVSNAIAQMHYLPTPL-------IH 187
           L D +++++   T ++E+E ++IM          +D S+A   +  L T +       ++
Sbjct: 140 LQDSIDDRILDGTFVSESECIRIMCGIARGLLCLHDSSSAPRGVRTLTTGVDEGASDNVN 199

Query: 188 RDIKIENVLVDK----------------DDNFKLCDFGSTSMCFPIVSTHQDIA----VL 227
            D  + + L D                 D++    D  ST+   P+  +H+ ++    + 
Sbjct: 200 TDFNLSDNLGDDRDKISASYTDEAGLSMDEHLLELDSISTTSVVPVSYSHKMLSPSNIIF 259

Query: 228 TNN---------------IYVHTTPQ--------------YRSPEMIDLYRCLPINEKSD 258
           ++N               + + T  Q              Y +PE +DL     ++ K D
Sbjct: 260 SSNGLPIISELGSCSKADVEIKTAKQLNRLREWVDDNFNSYMAPEFLDLKTNSKLSTKVD 319

Query: 259 IWALGIFLYKLLFYTTPFE----LTG---QFAILHSKYEIP-QNGYSSKLINLIIIMLAE 310
           +W+ G   Y LLF   PFE    L G   ++AI   K+  P Q+ YS  ++++I   L  
Sbjct: 320 VWSFGCICYALLFGMNPFEREEQLYGASIKYAISTGKFSFPSQSRYSDSILDIIRSCLQV 379

Query: 311 NPSLRPNIYQVMHHV 325
           +PS RP++  V++++
Sbjct: 380 DPSERPSVSIVLNNL 394

>Sklu_2436.14 YDR466W, Contig c2436 31299-33653
          Length = 784

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 104/242 (42%), Gaps = 39/242 (16%)

Query: 46  EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA---CLKRVIVPDENGLNELRNE 102
           E L  G ++ +YK         +D   ++  L     A   C K+ I+  EN +  +  E
Sbjct: 14  EQLGHGSYSTVYKA--------LDKARNNSGLPQHFYAIKVCSKKHII-RENKVKYVTIE 64

Query: 103 VETMKQLR--GSPNIVQYY-----DSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
             T+  L    +P IV+ Y       N     D +PG E+L L++   +    D + +K 
Sbjct: 65  KNTLNLLAQGNNPGIVKLYYTFHDQENLYFVLDYAPGGELLHLLQ---RYGTFDEVWSK- 120

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
                       M  + + +  +H     +IHRD+K ENVL+ KD    + DFG+ S+  
Sbjct: 121 ----------HFMCQLVDVVEYIHS--KGVIHRDLKPENVLLSKDGRLMVTDFGAASVVT 168

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
               T  D +V         T +Y SPE++   +C      SDIWALG  LY+ +  + P
Sbjct: 169 -TDGTSSDNSVSERAASFVGTAEYVSPELLLNNQCF---FSSDIWALGCILYQFMQGSPP 224

Query: 276 FE 277
           F 
Sbjct: 225 FR 226

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 83/176 (47%), Gaps = 25/176 (14%)

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
           NE+  M++ + S NIV + DS  ++        ++ ++ME     SL D + + L   L+
Sbjct: 664 NEILVMRESKHS-NIVNFIDSYLAKG-------DLWIVMEYMEGGSLTDVVTHCL---LS 712

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
           E +I  +  +    +  +H     ++HRDIK +N+L+    N KL DFG    C  I   
Sbjct: 713 EGQIGAVCRETLKGLQFLHS--KGVLHRDIKSDNILLSLKGNIKLTDFG---FCAQINEN 767

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           +     +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 768 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 91/199 (45%), Gaps = 24/199 (12%)

Query: 96  LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
           ++ L++E+  +K+L    NIV YY S+         G  + + +E  P  S+   +NN  
Sbjct: 512 IDALQHEMNILKELH-HENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNN-- 561

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
                E  +      +   +A +H     +IHRDIK  N+L+D     K+ DFG +    
Sbjct: 562 YGPFDEPLVKNFTRQILIGLAYLH--KRNIIHRDIKGANILIDIKGGVKITDFGISKKLS 619

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
           P+       A L  ++Y      + +PE++   + +   EK+DIW++G  + ++     P
Sbjct: 620 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCVIVEMFTGKHP 670

Query: 276 FELTGQFAILHSKYEIPQN 294
           F     F+ + + ++I  N
Sbjct: 671 FP---DFSQMQAIFKIGTN 686

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 94/383 (24%), Positives = 156/383 (40%), Gaps = 88/383 (22%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRV--IVPDENGLNELR 100
           E+L+ L +G +  +             + +D+   + G    +K++  I   E  L    
Sbjct: 122 EVLQVLGKGSYGTVV------------SAVDNSNPEYGVRIAIKKITNIFHREVLLKRAI 169

Query: 101 NEVETMKQLRGSPNIVQYYDSN-ASRHP-DGSPGFEILLLMELCPKKSLLDYMNNKL--- 155
            E++ M   +G  NI+   D +  S  P DG           L   + L+DY   ++   
Sbjct: 170 RELKFMNYFKGHKNIINLLDLDIVSEKPYDG-----------LYCYQELIDYDLARVIHS 218

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
           + +L+E  I   +Y +   +  +H     +IHRD+K  N+L     N K+CDFG      
Sbjct: 219 SVQLSEFHIKSFLYQILCGLKYIH--SADVIHRDLKPGNILCTIHGNLKICDFGLARGVS 276

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
           P     + ++ +TN +    T  YR+PE+I  ++    ++  D+WA+G  L +  FY   
Sbjct: 277 PQFFQGRTVSHITNYV---ATRWYRAPELILSHK--NYSKAIDMWAVGCILAE--FYGRK 329

Query: 276 FELTGQFAILHSKYEI----------------------------PQ-------NGY---S 297
               GQ + LH   EI                            PQ       N Y   S
Sbjct: 330 PIFMGQDS-LHQVSEIVKVLGTPSREDVIKYGSSRAWEFFSPPKPQYKKIPWCNIYPFAS 388

Query: 298 SKLINLIIIMLAENPSLRPNIYQVMHH--VCSIL-KCDVPFTDKYELGPYDFAKYSQYHL 354
            K  NL+  +L  +P  RP + + +    V  +  + D P   K   GP+DF+ Y Q+  
Sbjct: 389 EKAFNLLDKLLDWDPDRRPTVEEAIEQPFVSEVRNENDEPVCSK---GPFDFS-YEQHFY 444

Query: 355 ---KLQQIQYQMFELYKNEKVTS 374
              KL+Q  Y   +L+K E+ T 
Sbjct: 445 SMGKLRQFLYDEVKLFKAERATG 467

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 104/234 (44%), Gaps = 33/234 (14%)

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           +  E+  MK L   PN++  YD   + +        + L++E   K  L + + +     
Sbjct: 74  IEREIVIMKLL-SHPNVLSLYDVWETNN-------NLYLILEYAEKGELFNLLVDH--GP 123

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           L E E +     +   I+  H L   ++HRD+K EN+L+D   N K+ DFG  ++     
Sbjct: 124 LPEREAINCFRQIIIGISYCHALG--IVHRDLKPENLLLDSFYNIKIADFGMAAL----- 176

Query: 219 STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTTPF- 276
               D  +L  +     +P Y +PE++     LP     SD+W+ G+ L+ LL    PF 
Sbjct: 177 --QTDADLLETSC---GSPHYAAPEIVS---GLPYEGFASDVWSCGVILFALLTGRLPFD 228

Query: 277 ELTGQ-----FAILHSKYEIPQNGYSSK-LINLIIIMLAENPSLRPNIYQVMHH 324
           E  G        +   ++E+P +   S+   +LI  +L  +P  R  I  ++ H
Sbjct: 229 EENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSH 282

>Kwal_23.5576
          Length = 504

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 99/233 (42%), Gaps = 30/233 (12%)

Query: 41  RCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR 100
           R ++++ +  G +  +   +F+E   E +  I             KR +           
Sbjct: 22  RFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTNVFSKTLLCKRSL----------- 70

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
            E++ ++  RG  NI   YD +    P+ +  F  L L E   +  +   +  K    LT
Sbjct: 71  RELKLLRHFRGHKNITCLYDMDIVFSPNNT--FNGLYLYEELMECDIHQII--KSGQPLT 126

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
           +A     +Y +  A+  +H     ++HRD+K  N+LV+ D   K+CDFG       +   
Sbjct: 127 DAHYQSFIYQLLCALKYIH--SADVLHRDLKPGNLLVNADCQLKVCDFG-------LARG 177

Query: 221 HQDIAVLTNNI---YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270
           + +  V  N     YV  T  YR+PE++  Y+     +  DIW+ G  L +LL
Sbjct: 178 YSENPVENNQFLTEYV-ATRWYRAPEIMLSYQ--GYTKAIDIWSCGCILAELL 227

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 75/147 (51%), Gaps = 17/147 (11%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMY-DVSNAIAQMHYLPTPLIHRDIKIE 193
           + + MEL     L D +   +     ++E+ +  Y  +  AI+ +H     + HRDIK E
Sbjct: 91  LWIAMELAEGGDLFDKIEPDIGV---DSEVAQFYYKQLIKAISYLHD-TCGVAHRDIKPE 146

Query: 194 NVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCL 251
           N+L+DKD N KL DFG  S+        +D +   +     + P Y +PE+I  D Y   
Sbjct: 147 NILLDKDGNLKLADFGLASLF-----KRKDGSKRISRDQRGSLP-YMAPEIIYCDGYYA- 199

Query: 252 PINEKSDIWALGIFLYKLLFYTTPFEL 278
              + +DIW++G+ L+ LL   TP+EL
Sbjct: 200 ---DMTDIWSIGVLLFVLLTGETPWEL 223

>Scas_548.6
          Length = 1382

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 82/183 (44%), Gaps = 30/183 (16%)

Query: 154  KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
            +  T +TE E   I   + + I  +H     ++HRDIK ENV+VD     K+ DFGS + 
Sbjct: 1223 EFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAAY 1280

Query: 214  CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLF 271
               + S   D+ V         T  Y +PE++  + Y   P     DIWA+GI LY ++F
Sbjct: 1281 ---VKSGPFDVFV--------GTIDYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVF 1325

Query: 272  YTTPFE-----LTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVC 326
               PF      L G+    +S      N  S   I LI  +L  +   RP I ++ +   
Sbjct: 1326 KENPFYNIDEILEGELKFNNS------NDISEDCIELIKKILIRSVPKRPLIEEIFNDKW 1379

Query: 327  SIL 329
             IL
Sbjct: 1380 LIL 1382

>Kwal_26.7861
          Length = 955

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 80/176 (45%), Gaps = 25/176 (14%)

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
           NE+  MK  + + NIV + DS   R        ++ ++ME     SL D + + +   LT
Sbjct: 711 NEILVMKASKHA-NIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 759

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
           E +I  +  +    +  +H     +IHRDIK +NVL+      KL DFG    C  I   
Sbjct: 760 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNVLLSMSGEIKLTDFG---FCAQINEI 814

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           +     +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 815 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 861

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 115/251 (45%), Gaps = 32/251 (12%)

Query: 78  KAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILL 137
           K      +K V   D++ L ++ +E++ +K L    NIV+Y+     +H        + +
Sbjct: 43  KTAQEVAIKEVNYQDDDELVDIMSEIDLLKNL-NHINIVKYHGFIQKQH-------NLYI 94

Query: 138 LMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLV 197
           ++E C K SL + ++      ++E E    +    N +  +H     +IHRDIK  N+L+
Sbjct: 95  ILEYCAKGSLKNLISRN--RPMSEHEAKPYVRQTLNGLNYLH--EQGVIHRDIKAANILL 150

Query: 198 DKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKS 257
           D ++  KL DFG        VST  +   +T    +  +  + +PE+I       +   S
Sbjct: 151 DSENVVKLADFG--------VSTKVNNTAMT----LAGSLNWMAPEIIGNRGASTL---S 195

Query: 258 DIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPS 313
           DIW+LG  + +LL    PF    ++   +AI +  Y  P +  SS   + +    A+N  
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSY-FPPSSLSSGAKDFLQQCFAKNMY 254

Query: 314 LRPNIYQVMHH 324
            RP   Q++ H
Sbjct: 255 KRPTAVQLLQH 265

>KLLA0C16577g complement(1451181..1452695) some similarities with
           sp|P06784 Saccharomyces cerevisiae YDL159w STE7
           ser/thr/tyr protein kinase of MAP kinase kinase family,
           hypothetical start
          Length = 504

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 99/217 (45%), Gaps = 35/217 (16%)

Query: 69  DAGIDSKLLKAGDIACLKRVIVPDENG---LNELRNEVETMKQLRGSPNIVQYYDSNASR 125
           ++G   K L   D   + +  +P EN     N+L  E+  MK +    NIV +Y   A  
Sbjct: 176 NSGTVVKTLHVPDSRIIAKKTIPVENKEVLKNQLVRELTIMKNVSAHDNIVGFY--GAFY 233

Query: 126 HPDGSPGFEILLLMELCPKKSLLDYM----------NNKLATKLT---EAEILKIMYDVS 172
           +P  S   EI++LME     SL   +          N  ++ K +   E  + +I + V 
Sbjct: 234 NP--STTNEIVILMEYMDCGSLDKILSVYRSDCHRKNVSISCKTSWFNEMPLSRISFCVL 291

Query: 173 NAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIY 232
           N +  + Y    +IHRDIK  N+L++   + K+CDFG ++    ++++  D  V      
Sbjct: 292 NGLIYL-YDCYKIIHRDIKPSNILINSKGDVKICDFGVSTT---LINSLADTFV------ 341

Query: 233 VHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 269
              T  Y SPE I   R      K D+W+LG+ + +L
Sbjct: 342 --GTSTYMSPERIQGGR---YTTKGDVWSLGLMIIEL 373

>Scas_640.14*
          Length = 728

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 109/236 (46%), Gaps = 36/236 (15%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP--DENGLNELRNEVET 105
           L EG F    KVK    T    +G  ++  K   I  ++R  +    E  +   R E+ +
Sbjct: 44  LGEGEFG---KVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFR-EINS 99

Query: 106 MKQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEI 164
           +K L   PNIV+  +    S++        I +++E         Y+  K   +L EA  
Sbjct: 100 LKHL-THPNIVRLEEVLQNSKY--------IGIVLEYASGGEFYKYVQRK--RRLKEATA 148

Query: 165 LKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDI 224
            ++   + + ++ MH     ++HRD+K+EN+L+DK +N  + DFG  +  +       D 
Sbjct: 149 CRLFAQLISGVSYMH--SKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYA------DN 200

Query: 225 AVLTNNIYVHTTPQYRSPEMI---DLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
            ++  +     +P Y +PE++   + Y+      K+DIW+ GI LY +L    P++
Sbjct: 201 ELMKTSC---GSPCYAAPELVITTEPYKA----RKADIWSCGIILYGMLAGYLPWD 249

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 104/237 (43%), Gaps = 39/237 (16%)

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           +  E+  MK L   PN+++ YD   +         ++ L++E   K  L + +  +    
Sbjct: 78  IEREIIIMKLL-NHPNVLRLYDVWET-------NTDLYLVLEYAEKGELFNLLVER--GP 127

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
           L E E ++    +   ++  H L   ++HRD+K EN+L+D   N K+ DFG         
Sbjct: 128 LPEHEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA------- 178

Query: 219 STHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINE-KSDIWALGIFLYKLLFYTT 274
                 A+ T    + T   +P Y +PE++     +P     SD+W+ G+ L+ LL    
Sbjct: 179 ------ALETEGKLLETSCGSPHYAAPEIVS---GIPYQGFASDVWSCGVILFALLTGRL 229

Query: 275 PF-ELTGQFAIL-----HSKYEIPQNG-YSSKLINLIIIMLAENPSLRPNIYQVMHH 324
           PF E  G    L       ++E+P +   S +  +LI  +L  +P  R     ++ H
Sbjct: 230 PFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 82/176 (46%), Gaps = 25/176 (14%)

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLT 160
           NE+  MK  + + NIV + DS   R        ++ ++ME     SL D + + +   LT
Sbjct: 742 NEILVMKGSKHN-NIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 790

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST 220
           E +I  +  +    +  +H     +IHRDIK +N+L+  + + KL DFG    C  I   
Sbjct: 791 EGQIGAVSRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFG---FCAQINEV 845

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           +     +        TP + +PE++      P   K DIW+LGI + +++    P+
Sbjct: 846 NLKRTTMVG------TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 84/190 (44%), Gaps = 38/190 (20%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           EV+   ++    NIVQ YD            F+  ++ME C    L + + + L  K T+
Sbjct: 126 EVDIQTKIGFHENIVQLYDF-----------FDSYIIMEYCSGGDLYEAIKDDLVPKKTK 174

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDK--DDNFKLCDFGSTSMCFPIVS 219
            EI  I+  + +AI  +H     + HRDIK EN+L+    D   KL D+G  +       
Sbjct: 175 -EITHILTQILDAIEFVH--NKQIYHRDIKPENILITSLIDWKIKLTDWGLATT------ 225

Query: 220 THQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE--------KSDIWALGIFLYKLLF 271
              D      N+    + +Y  PE+ +    L I+E        K D+W++GI    ++F
Sbjct: 226 ---DEKSYDRNV---GSERYMPPELFE--SNLDIDERKEPYDCSKVDLWSIGIVFLNVVF 277

Query: 272 YTTPFELTGQ 281
           Y  PF +  Q
Sbjct: 278 YKNPFRIADQ 287

>YHR030C (SLT2) [2317] chr8 complement(168882..170336)
           Serine/threonine protein kinase of MAP kinase family
           involved in the cell wall integrity (low-osmolarity)
           pathway and in G2 phase cell-cycle checkpoint control
           [1455 bp, 484 aa]
          Length = 484

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 96/234 (41%), Gaps = 32/234 (13%)

Query: 41  RCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR 100
           R ++++ +  G +  +   +F E   +    I             KR +           
Sbjct: 22  RFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSL----------- 70

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILL--LMELCPKKSLLDYMNNKLATK 158
            E++ ++  RG  NI   YD +   +PDGS     L   LME C    ++     K    
Sbjct: 71  RELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELME-CDMHQII-----KSGQP 124

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF--P 216
           LT+A      Y +   +  +H     ++HRD+K  N+LV+ D   K+CDFG        P
Sbjct: 125 LTDAHYQSFTYQILCGLKYIH--SADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENP 182

Query: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270
           + ++      LT  +    T  YR+PE++  Y+     +  D+W+ G  L + L
Sbjct: 183 VENSQ----FLTEYV---ATRWYRAPEIMLSYQ--GYTKAIDVWSAGCILAEFL 227

>Scas_711.25
          Length = 1515

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 112/264 (42%), Gaps = 59/264 (22%)

Query: 46   EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNE------- 98
            E + +G F  +Y    L +T              G++  +K+V VP  +  +E       
Sbjct: 1218 EMIGKGSFGAVYLC--LNVT-------------TGEMMAVKQVEVPKYSSQDEAIISTVE 1262

Query: 99   -LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFE-----ILLLMELCPKKSLLDYMN 152
             LR+EV T+K L    NIVQY             GFE       L +E     S+   + 
Sbjct: 1263 ALRSEVSTLKDL-DHLNIVQYL------------GFENKDNIYSLFLEYVAGGSVGSLI- 1308

Query: 153  NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
             ++  +  E  I  +   V   +A +H     ++HRD+K +N+L+D+D   K+ DFG   
Sbjct: 1309 -RMYGRFDEPLIRHLNTQVLRGLAYLHS--RGILHRDMKADNLLLDQDGVCKISDFG--- 1362

Query: 213  MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272
                I    +DI    +++ +  T  + +PEM+D  +    + K DIW+LG  + ++   
Sbjct: 1363 ----ISRKSKDI-YSNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAG 1415

Query: 273  TTPFE----LTGQFAILHSKYEIP 292
              P+     +   F I  SK   P
Sbjct: 1416 KRPWSNYEVVAAMFKIGKSKSAPP 1439

>Scas_477.5
          Length = 703

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 92/199 (46%), Gaps = 25/199 (12%)

Query: 96  LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
           ++ L++E+  +K+L    NIV YY S+        P   I L  E  P  S+   +NN  
Sbjct: 485 VDALQHEMNLLKELH-HENIVTYYGSSQE-----GPNLNIFL--EYVPGGSVSSMLNN-- 534

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
                E+ I+  +  V   +A +H     +IHRDIK  N+L+D     K+ DFG +    
Sbjct: 535 YGPFEESLIVNFIRQVLIGVAYLH--NKNIIHRDIKGANILIDTKGCVKITDFGISKKLS 592

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
           P+ S     A L  ++Y      + +PE++   +     EK+DIW+ G  + ++     P
Sbjct: 593 PL-SKQDKRASLQGSVY------WMAPEVV---KQTATTEKADIWSTGCVVIEMFTGKHP 642

Query: 276 FELTGQFAILHSKYEIPQN 294
           F     F+ + + ++I  N
Sbjct: 643 FP---DFSQMQTIFKIGTN 658

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 91/199 (45%), Gaps = 24/199 (12%)

Query: 96  LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
           ++ L++E+  +K+L    NIV YY S+         G  + + +E  P  S+   +NN  
Sbjct: 510 IDALQHEMNLLKELH-HENIVTYYGSS-------QEGGNLNIFLEYVPGGSVSSMLNN-- 559

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
                E  I      +   +A +H     +IHRDIK  NVL+D     K+ DFG +    
Sbjct: 560 YGPFEEPLIKNFTRQILIGLAYLHR--KNIIHRDIKGANVLIDIKGCVKITDFGISKKLS 617

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
           P+       A L  ++Y      + +PE++   + +   EK+DIW++G  + ++     P
Sbjct: 618 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCLVVEMFTGKHP 668

Query: 276 FELTGQFAILHSKYEIPQN 294
           F     F+ + + ++I  N
Sbjct: 669 FP---DFSQMQAIFKIGTN 684

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 111/270 (41%), Gaps = 71/270 (26%)

Query: 46   EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP-----DENGLN--- 97
            E + +G F  +Y             G++   +  G++  +K+V VP     DE  +N   
Sbjct: 1128 EMIGKGSFGAVY------------LGLN---VTTGEMMAVKQVEVPKFGSQDETTVNNAE 1172

Query: 98   ELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFE-----ILLLMELCPKKSLLDYMN 152
             L +EV T+K L    NIVQY             GFE       L +E     S+   + 
Sbjct: 1173 ALISEVSTLKDL-DHLNIVQYL------------GFENKNCIYSLFLEYVAGGSVGSLI- 1218

Query: 153  NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
             +L     E  I  +   V   +A +H     ++HRD+K +N+L+D D   K+ DFG   
Sbjct: 1219 -RLYGHFDEQLIRFLTTQVLEGLAYLHL--RGILHRDMKADNLLLDNDGVCKISDFG--- 1272

Query: 213  MCFPIVSTHQDIAVLTNNIY------VHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 266
                       I+  +NNIY      +  T  + +PEM+D  +    + K DIW+LG  +
Sbjct: 1273 -----------ISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVV 1319

Query: 267  YKLLFYTTPFE----LTGQFAILHSKYEIP 292
             ++     P+     +   F I  SK   P
Sbjct: 1320 LEMFAGKRPWSNLEVVAAMFQIGKSKSAPP 1349

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 100/238 (42%), Gaps = 47/238 (19%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNE 102
           +IL  L  G F  ++ V+    +N        K+LK   +  LK+V         E  N+
Sbjct: 146 QILRTLGTGSFGRVHLVR----SNHNGRFYAMKVLKKNTVVKLKQV---------EHTND 192

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLL---DYMNNKLATKL 159
              M  +   P I++ + +      D    F I+  +E     SLL       N +A K 
Sbjct: 193 ERNMLSIVSHPFIIRMWGT----FQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVA-KF 247

Query: 160 TEAEI-LKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
             AE+ L + Y  S  I          I+RD+K EN+L+DK+ + KL DFG       + 
Sbjct: 248 YAAEVCLALEYLHSKGI----------IYRDLKPENILLDKNGHIKLTDFGFAKYVPDVT 297

Query: 219 STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
            T            +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF
Sbjct: 298 YT------------LCGTPDYIAPEVVS---TKPYNKSVDWWSFGVLIYEMLAGYTPF 340

>Scas_584.11
          Length = 1074

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (43%), Gaps = 47/194 (24%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           EV+ + ++    NIV   D            F+  ++ME C    L + + + L  K T+
Sbjct: 108 EVDILTKVGKHKNIVSLVDY-----------FDSYIIMEYCSGGDLYEAIKDDLVPKKTK 156

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDK-DDNFKLCDFGSTSMCFPIVST 220
             I  I   + +AI  +H     + HRDIK EN+L+   D   KL D+G       + +T
Sbjct: 157 T-ITHIFSQIMDAIEFVH--GKSIYHRDIKPENILITGIDWTIKLTDWG-------LATT 206

Query: 221 HQ---DIAVLTNNIYVHTTPQYRSPEMID----------LYRCLPINEKSDIWALGIFLY 267
           H+   D +V         + +Y +PE+ +           Y+C    +K D+WA+GI   
Sbjct: 207 HETSFDRSV--------GSERYMAPELFESNLDIEERKEAYKC----DKVDLWAMGIVFL 254

Query: 268 KLLFYTTPFELTGQ 281
            ++F   PF +  Q
Sbjct: 255 NIVFQKNPFSVANQ 268

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 115/267 (43%), Gaps = 50/267 (18%)

Query: 47  HLAEGGFANIY-----------KVKFLEL--TNEMDAGIDSKLLKAGDIACLKRVIVPDE 93
            +  G F ++Y            VK +EL  T  M +  D K   + + A +K++  P +
Sbjct: 420 RIGSGSFGSVYLGMNAHTGELMAVKQVELEPTTVMASSDDKKSHPSSN-AVVKKLTDPPQ 478

Query: 94  NGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNN 153
           +G      ++  +K+L    NIV YY S+         G  + + +E  P  S+   +N+
Sbjct: 479 DGGRASSTKMNLLKELH-HENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNS 530

Query: 154 ------KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCD 207
                  L    T   ++ + Y        +H     +IHRDIK  N+L+D   + K+ D
Sbjct: 531 YGPFEEPLVKNFTRQTLVGLTY--------LHR--KNIIHRDIKGANLLIDIKGSVKITD 580

Query: 208 FGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 267
           FG +    P+       A L  ++Y      + +PE++   + +   EK+DIW++G  + 
Sbjct: 581 FGISKKLSPLNKKQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCVVV 631

Query: 268 KLLFYTTPFELTGQFAILHSKYEIPQN 294
           ++     PF     F+ + + ++I  N
Sbjct: 632 EMFTGKHPFP---DFSQMQAIFKIGTN 655

>YKL161C (YKL161C) [3109] chr11 complement(149391..150692)
           Serine/threonine protein kinase with similarity to MAP
           kinases [1302 bp, 433 aa]
          Length = 433

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 90/180 (50%), Gaps = 21/180 (11%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILL--LMELCPKKSLLDYMNNKLATKL 159
           E++ ++ LRG PNIV  +D++   +P+G+     L   LME C    ++     +   +L
Sbjct: 72  ELKLLRHLRGHPNIVWLFDTDIVFYPNGALNGVYLYEELME-CDLSQII-----RSEQRL 125

Query: 160 TEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVS 219
            +A     +Y +  A+  +H     ++H D+K +N+LV+ D   K+C+FG +       S
Sbjct: 126 EDAHFQSFIYQILCALKYIH--SANVLHCDLKPKNLLVNSDCQLKICNFGLS------CS 177

Query: 220 THQDIAVLTNNI--YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
             ++  V    I  Y+ T+  Y++PE++  Y+     +  DIW+ G  L +LL     FE
Sbjct: 178 YSENHKVNDGFIKGYI-TSIWYKAPEILLNYQ--ECTKAVDIWSTGCILAELLGRKPMFE 234

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 104/251 (41%), Gaps = 34/251 (13%)

Query: 98  ELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLAT 157
           +L  EV    +  G  ++V+  D N SR         + + MEL     L D +   +  
Sbjct: 61  DLTREVVLQTRCAGHRHVVRVLDCNVSRE-------YLWIAMELADGGDLFDKIEPDVGV 113

Query: 158 KLTEAEILKIMYD-VSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216
              ++E+ +  Y  +  A+  +H     + HRDIK EN+L+D+  N K+ DFG  +    
Sbjct: 114 ---DSEVARFYYQQLVRALTHLHE-ACGVAHRDIKPENMLLDRAGNLKVADFGLATR--- 166

Query: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMID--LYRCLPINEKSDIWALGIFLYKLLFYTT 274
                     L  +     T  Y +PE++    Y      + +DIW+ G+ ++ LL   T
Sbjct: 167 -FRRRDGTRRLARD--RRGTLPYLAPEVVGERAYH----ADTADIWSAGVLVFVLLTGET 219

Query: 275 PFEL----TGQFAILHSKYEIPQNGYSSKL----INLIIIMLAENPSLRPNIYQVMHHVC 326
           P+       G F    +      +G   K+    +NL+  ML + P+ R  + Q+  H  
Sbjct: 220 PWSEPSVDDGMFRAFVADGGNLSDGPWGKIGLVELNLLRKMLQQRPAARATLAQLRQH-- 277

Query: 327 SILKCDVPFTD 337
              K  V F D
Sbjct: 278 PWFKAPVVFAD 288

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 109/276 (39%), Gaps = 58/276 (21%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           + L ME C        +  +    + E +      +V+ A+  +H L    I+RD+K EN
Sbjct: 569 LYLCMEYCMGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLG--FIYRDLKPEN 626

Query: 195 VLVDKDDNFKLCDFGSTSMC----FPIV-----STHQDIAVLTNNIYVHT---TPQYRSP 242
           +L+ +  +  L DF  +        P+V     ST  D  + ++    ++   T +Y +P
Sbjct: 627 ILLHQSGHIMLSDFDLSIQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAP 686

Query: 243 EMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE---LTGQFA-ILHSKYEIPQNGYSS 298
           E+I   R        D W LGI +Y++LF  TPF+       F  IL ++   P N   S
Sbjct: 687 EVI---RGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEIS 743

Query: 299 KLI-NLIIIMLAENPSLRPNIYQVMHHVCSILKCDV---PFTDKYELG------------ 342
           +   +LI  +L +N S R          C +   DV   PF  K +              
Sbjct: 744 RTCKDLIKKLLTKNESKRLG--------CKMGAADVKKHPFFKKVQWSLLRNQEPPLIPV 795

Query: 343 ----PYDFAKYSQ---------YHLKLQQIQYQMFE 365
                YDFAK S           H  L + +  MFE
Sbjct: 796 LSEDGYDFAKLSSNKKRQTSQDSHKHLDEQEKNMFE 831

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 111/254 (43%), Gaps = 44/254 (17%)

Query: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143
            LKR +  +E  L  L +E+  +++L   PNIV++ D   SR        +  ++ +L  
Sbjct: 87  LLKRALKGNE--LQMLYDELSILQKL-DHPNIVKFKDWFESRE-------KFYIVTQLAT 136

Query: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL-VDKDDN 202
              L D +  K   K TE + +KI+  +  A+  MH     ++HRD+K ENVL +D  D 
Sbjct: 137 GGELFDRILKK--GKFTETDAVKIVVQMLTAVEYMH--SQNVVHRDLKPENVLYLDPSDE 192

Query: 203 FKLC--DFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 260
            +L   DFG   +   + S  Q I     ++       Y +PE++         +  DIW
Sbjct: 193 SQLVISDFG---IAKQLSSESQLIHRAAGSM------GYVAPEVLTTSGH---GKPCDIW 240

Query: 261 ALGIFLYKLLFYTTPF--ELTGQF----------AILHSKYEIPQNGYSSKLINLIIIML 308
           +LG+  Y LL   +PF  E T  F             HS Y    N  S +    I+  L
Sbjct: 241 SLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPY---WNNISKEAKQFILRAL 297

Query: 309 AENPSLRPNIYQVM 322
              P+ RP   +++
Sbjct: 298 TLTPARRPTAAELL 311

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 80/168 (47%), Gaps = 22/168 (13%)

Query: 154  KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
            +L T +TE E   +   V++ +  +H     ++HRDIK ENV+VD     K+ DFGS + 
Sbjct: 1100 ELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGSAAY 1157

Query: 214  CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLF 271
                      +     +++V T   Y +PE++  D Y   P     D+WA+G+ LY +++
Sbjct: 1158 ----------VKRGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAVGVLLYTIIY 1202

Query: 272  YTTPFELTGQFAILHSKYEI-PQNGYSSKLINLIIIMLAENPSLRPNI 318
               PF    +  IL     I P    S + + LI  +L  + + RP +
Sbjct: 1203 KENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTV 1248

>Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement
          Length = 521

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 95/236 (40%), Gaps = 36/236 (15%)

Query: 41  RCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR 100
           R ++++ +  G +  +   +F E   E    I             KR +           
Sbjct: 22  RFQLIKEIGHGAYGIVCSARFTEAVEETTVAIKKVTNVFSKTLLCKRSL----------- 70

Query: 101 NEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMEL---CPKKSLLDYMNNKLAT 157
            E++ ++  RG  NI   YD +     DGS  F  L L E    C    ++     K   
Sbjct: 71  RELKLLRHFRGHKNITCLYDMDIVFGIDGS--FNGLYLYEELMECDMHQII-----KSGQ 123

Query: 158 KLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPI 217
            L++A     +Y +   +  +H     ++HRD+K  N+LV+ D   K+CDFG       +
Sbjct: 124 PLSDAHYQSFIYQILCGLKYIH--SADVLHRDLKPGNLLVNADCQLKICDFG-------L 174

Query: 218 VSTHQDIAVLTNNI---YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270
              + +  V  N     YV  T  YR+PE++  Y+        D+W+ G  L +LL
Sbjct: 175 ARGYSENPVENNQFLTEYV-ATRWYRAPEIMLSYQ--GYTRAIDVWSCGCILAELL 227

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 60/125 (48%), Gaps = 19/125 (15%)

Query: 154  KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
            +  T +TE E   I   V   I  +H     ++HRDIK ENV+VD     K+ DFGS + 
Sbjct: 1197 EFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY 1254

Query: 214  CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLF 271
               + S   D+ V         T  Y +PE++  + Y   P     DIWA+GI LY ++F
Sbjct: 1255 ---VKSGPFDVFV--------GTIDYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVF 1299

Query: 272  YTTPF 276
               PF
Sbjct: 1300 KENPF 1304

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 107/240 (44%), Gaps = 43/240 (17%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKR-VIVPDENGLNELRNEVETM 106
           L EG F  +        +N  ++  D    K   I  +KR  I  D     ++  E+  +
Sbjct: 47  LGEGEFGKVKLGWPKNFSNSSNSTFD--FPKQVAIKLIKRDSISNDYRKEVKIYREINAL 104

Query: 107 KQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEIL 165
           K L   PNIV+  +    SR+        I +++E         Y+  K   +L E    
Sbjct: 105 KHL-SHPNIVKLEEVLQNSRY--------IGIVLEYACGGEFYKYIQKK--RRLKEMNAC 153

Query: 166 KIMYDVSNAIAQMHYLPTP-LIHRDIKIENVLVDKDDNFKLCDFGSTS-MCFPIVSTHQD 223
           ++    S  I+ +HY+ +  L+HRD+K+EN+L+DK++N  + DFG  +  C         
Sbjct: 154 RLF---SQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFC--------- 201

Query: 224 IAVLTNNIYVHT---TPQYRSPEMI---DLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
               + N  + T   +P Y +PE++   + Y       K+DIW+ G+ LY +L    P++
Sbjct: 202 ----SRNELMKTSCGSPCYAAPELVISAEPYEA----RKADIWSCGVILYAILAGYLPWD 253

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 61/124 (49%), Gaps = 17/124 (13%)

Query: 154  KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
            +  + +TE E   I   + + I  +H     ++HRDIK ENV+VD     KL DFGS + 
Sbjct: 1047 EFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAY 1104

Query: 214  CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKS-DIWALGIFLYKLLFY 272
               + S   D+ V         T  Y +PE++      P   KS DIWA+GI LY L++ 
Sbjct: 1105 ---VKSGPFDVFV--------GTIDYAAPEVLG---GNPYEGKSQDIWAIGILLYTLIYK 1150

Query: 273  TTPF 276
              PF
Sbjct: 1151 ENPF 1154

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 73/160 (45%), Gaps = 30/160 (18%)

Query: 133 FEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKI 192
           F+  ++ME C    L + +      K T++ I  I+  + +AI  +H     + HRDIK 
Sbjct: 154 FDSYIIMEYCSGGDLYEAIKADAVPKKTKS-ITHIITQIMDAIEYVH--NKGIYHRDIKP 210

Query: 193 ENVLVDK-DDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDL---- 247
           EN+L+   D   KL D+G       + +T  D   +  N+    + +Y SPE+ D     
Sbjct: 211 ENILISGIDWTIKLTDWG-------LATT--DKTSMDRNV---GSERYMSPELFDSNLDI 258

Query: 248 ------YRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 281
                 Y C     K D+WA+GI    ++F+  PF +  Q
Sbjct: 259 KERKEPYDCA----KVDLWAMGIVFLNIVFHKNPFSIANQ 294

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 73/165 (44%), Gaps = 23/165 (13%)

Query: 115 IVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNN--KLATKLTEAEILKIMYDVS 172
           IVQYY               I + ME    KSL     N  K   +++E  I KI   V 
Sbjct: 273 IVQYYGMFTDEQSS-----SIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVL 327

Query: 173 NAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIY 232
             ++ +H     +IHRDIK +N+L+++    KLCDFG +             AV +  + 
Sbjct: 328 RGLSYLH--ERKVIHRDIKPQNILLNEKGEIKLCDFGVSGE-----------AVNSLAMT 374

Query: 233 VHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
              T  Y +PE I   +  P +   D+W+LG+ L ++     PFE
Sbjct: 375 FTGTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 75/165 (45%), Gaps = 25/165 (15%)

Query: 134 EILLLMELCPKKSLL----DYMNN--KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIH 187
           +I L++E C +  +     D M +  K  + L+  E  +I+  V   +  +HY    +IH
Sbjct: 218 KIYLVLEYCSRGEVKWCPPDCMESDAKGPSLLSFQETREILRGVVLGLEYLHY--QGIIH 275

Query: 188 RDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHT--TPQYRSPEMI 245
           RDIK  N+L+  D   K+ DFG  S+     ++      L       T  TP + +PEM 
Sbjct: 276 RDIKPANLLISGDGTVKISDFG-VSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMC 334

Query: 246 --------------DLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
                         +L+R   I+   DIWA+G+ LY LLF   PF
Sbjct: 335 LGEDAFTRYNLTKENLFRGSCISFMIDIWAVGVTLYCLLFGMLPF 379

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 112/251 (44%), Gaps = 32/251 (12%)

Query: 42  CEILEHLAEGGFANIY---KVKFLELTNEMDAG--IDSKLLKAGDIACLKRV--IVPDEN 94
           C+ ++ L E  + +++   +++ L +  E   G     KL     I  LK +  +  D+ 
Sbjct: 216 CKDVDELEEEMWTHVHLKDQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTITTLTTDQE 275

Query: 95  GLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNK 154
              ++  E++  K  + S  IV+YY               I + ME    +SL     + 
Sbjct: 276 SQKQIFRELQFNKSCK-SDYIVRYYGMFTDEEHS-----SIYIAMEYMGGRSLDAIYKHL 329

Query: 155 L--ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212
           L    ++ E  + KI   V   ++ +H     +IHRDIK +N+L+++    KLCDFG + 
Sbjct: 330 LKHGGRVGEKVLGKIAESVLRGLSYLHQ--RKIIHRDIKPQNILLNEAGQVKLCDFGVSG 387

Query: 213 MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272
                ++T       T   Y      Y +PE I   +  P +  SD+W+LG+ L ++   
Sbjct: 388 EAVNSLAT-----TFTGTSY------YMAPERI---QGQPYSVTSDVWSLGLTLLEVAQA 433

Query: 273 TTPFELTGQFA 283
             PF+ +G+FA
Sbjct: 434 HFPFD-SGKFA 443

>Kwal_56.24091
          Length = 381

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 88/196 (44%), Gaps = 25/196 (12%)

Query: 82  IACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMEL 141
           +  +K+  +   N   + R EVE    L+  PN+ + Y      H +      + LLME 
Sbjct: 151 LKAMKKSEIVQYNVQKQFRREVEIQSSLK-HPNLTRLY---GYFHDEK----RVYLLMEY 202

Query: 142 CPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDD 201
                L  ++ +       +      ++ +++A+  MH     ++HRDIK EN+L+   +
Sbjct: 203 LVNGELYKHLRSH--GPFNDITASHFVHQMADALNYMH--SKNILHRDIKPENILLGFQN 258

Query: 202 NFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 261
             KL DFG +      VS   +    T    +  T  Y SPE+I   +    + K D+WA
Sbjct: 259 TLKLTDFGWS------VSNVGNSKRKT----LCGTMDYLSPELI---KSREYDNKVDVWA 305

Query: 262 LGIFLYKLLFYTTPFE 277
           LG+  Y+LL  + PFE
Sbjct: 306 LGVLTYELLVGSPPFE 321

>Scas_653.25
          Length = 666

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 109/231 (47%), Gaps = 26/231 (11%)

Query: 60  KFLELTNEMDAGIDSKLLKAGDIACLKRVIV----PDENGLNELRNEVETMKQLRGS--- 112
           K+  +T ++ +G +  +++  + +  KR  +    P+ NG    + +   +K+   S   
Sbjct: 267 KYGHVTQKLGSGANGCVVQLQNHSNDKRFAMKTFKPNPNGETTKQYQKRCIKEFILSSHL 326

Query: 113 --PNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK--LTEAEILKIM 168
             PNI++  D   +      P  +I  +ME CP     D+ N  ++    LT  E     
Sbjct: 327 SHPNIIETLDIFYN------PSGQISEIMEWCPH----DFFNIVMSRTHLLTRRETFCYF 376

Query: 169 YDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLT 228
             + N +  +H L   + HRD+K++N ++  +   KL DFGS ++     ST +   ++ 
Sbjct: 377 KQLCNGVRYLHTLG--IAHRDLKLDNCVITYNGILKLIDFGSATIFQLNKSTEEKPELIP 434

Query: 229 NNIYVHTTPQYRSPEMIDLYRCLPINEK-SDIWALGIFLYKLLFYTTPFEL 278
           +   V + P Y +PE++ L + +P +   +D+W+LGI    ++    P+ +
Sbjct: 435 SRGIVGSDP-YLAPEVL-LSKEIPYDASLADVWSLGIIFCAIMLKRFPWRI 483

>Scas_651.18
          Length = 371

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 98/240 (40%), Gaps = 51/240 (21%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNE 102
           +IL  L  G F  ++ ++    +N        K+LK   I  LK+V         E  N+
Sbjct: 60  QILRTLGTGSFGRVHLIR----SNHNGRFYALKVLKKHTIVKLKQV---------EHTND 106

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGFE-ILLLMELCPKKSLLDYMNNKL-----A 156
              M  +   P +V+ + +           FE + ++M+      L   +          
Sbjct: 107 ERLMLSVVSHPFLVRMWGTFQD--------FEQVFMIMDYIEGGELFSLLRKSQRFPNPV 158

Query: 157 TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216
            K   AE       V  A+  +H +   +I+RD+K EN+L+DK+ + K+ DFG       
Sbjct: 159 AKFYAAE-------VCLALEYLHSMD--IIYRDLKPENILLDKNGHIKITDFGFAKYVPD 209

Query: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           I  T            +  TP Y +PE++      P N+  D W+ GI +Y++L   TPF
Sbjct: 210 ITYT------------LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPF 254

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 75/172 (43%), Gaps = 30/172 (17%)

Query: 154  KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
            +  T +TE E   +   V + +  +H     ++HRDIK EN++VD     K+ DFGS + 
Sbjct: 1177 EFKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAY 1234

Query: 214  CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDL--YRCLPINEKSDIWALGIFLYKLLF 271
               + S   D+ V         T  Y +PE++    Y   P     DIWA+GI LY ++F
Sbjct: 1235 ---VKSGPFDVFV--------GTIDYAAPEVLGGSPYEGKP----QDIWAIGILLYTIVF 1279

Query: 272  YTTPFE-----LTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNI 318
               PF      L G+     S+        S +   LI  +L  N   RP I
Sbjct: 1280 KENPFYNIDEILEGELKFNSSEL------VSEQCTTLIAKILNRNVQKRPTI 1325

>Kwal_23.5668
          Length = 1689

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 92/195 (47%), Gaps = 19/195 (9%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           + + ME C  ++L D ++ +      E E  ++  ++ +A++ +H     +IHRD+K  N
Sbjct: 812 LFIQMEYCENRTLFDLIHTENLCAQKE-EYWRLFREILDALSYIH--SQGIIHRDLKPMN 868

Query: 195 VLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI- 253
           + +D+  N K+ DFG        V    D+  + ++I   +T    S     LY    + 
Sbjct: 869 IFIDESRNIKIGDFGLAKNVHKSV----DLLRMDSHISTASTEDLTSAIGTALYVATEVL 924

Query: 254 ------NEKSDIWALGIFLYKLLF-YTTPFELTGQF-AILHSKYEIPQNGYSSKLI---N 302
                 NEK D+++LGI  +++++ + T  E       I  S  + P +  SSKL     
Sbjct: 925 TGSGNYNEKIDMYSLGIIFFEMVYSFNTGMERVNDIKKIRTSAIDFPSDFDSSKLAVEKK 984

Query: 303 LIIIMLAENPSLRPN 317
           +I  +L  +P+ RPN
Sbjct: 985 IITQLLDHDPNRRPN 999

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 126/301 (41%), Gaps = 48/301 (15%)

Query: 35  VVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDA---GIDSKLLKAGDIACLKRVIVP 91
           + VG    E +  L +G    +Y VK  + TN + A      S+++K   I   KR++  
Sbjct: 490 ITVGPQSFEKIRLLGQGDVGKVYLVK-EKRTNRLYALKIFSKSEMIKRKKI---KRILAE 545

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
            E            +      P +V  Y S  S          + L ME C        +
Sbjct: 546 QE------------ILATSNHPFVVTLYHSFQSED-------YLYLCMEYCMGGEFFRAL 586

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG-- 209
             + +  ++E +      +V+ A+  +H L    I+RD+K EN+L+ +  +  L DF   
Sbjct: 587 QTRKSKCISEEDAKFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDLS 644

Query: 210 --STSMCFPIV-----STHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDI 259
             +     P+V     ST  D  + ++    ++   T +Y +PE+I   R        D 
Sbjct: 645 IQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDW 701

Query: 260 WALGIFLYKLLFYTTPF--ELTGQ-FA-ILHSKYEIPQNGYSSK-LINLIIIMLAENPSL 314
           W LGI +Y++LF  TPF  E T + F+ IL      P N   S+   +LI  +L +N S 
Sbjct: 702 WTLGILIYEMLFGFTPFKGENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIKNESK 761

Query: 315 R 315
           R
Sbjct: 762 R 762

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 97/240 (40%), Gaps = 51/240 (21%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNE 102
           +IL  L  G F  ++ ++    +N        K LK   +  LK+V         E  N+
Sbjct: 153 QILRTLGTGSFGRVHLIR----SNHNGRFYALKALKKHTVVKLKQV---------EHTND 199

Query: 103 VETMKQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL-----A 156
              M  +   P I++ + +   S+H        + ++M+      L   +          
Sbjct: 200 ERRMLSIVSHPFIIRMWGTFQDSQH--------VFMVMDYIEGGELFSLLRKSQRFPNPV 251

Query: 157 TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216
            K   AE       V  A+  +H     +I+RD+K EN+L+DK+ + K+ DFG       
Sbjct: 252 AKFYAAE-------VCLALEYLH--SKEIIYRDLKPENILLDKNGHIKITDFGFAKYVPD 302

Query: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           +  T            +  TP Y +PE++      P N+  D W+ GI +Y++L   TPF
Sbjct: 303 VTYT------------LCGTPDYIAPEVVS---TKPYNKSVDWWSFGILIYEMLAGYTPF 347

>Scas_720.94
          Length = 1683

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 106/235 (45%), Gaps = 41/235 (17%)

Query: 77   LKAGDIACLKRVIVPDENGLNE---LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGF 133
            L  G+I  +K + + D   + +   L  E  T+ ++   PNIVQYY     R        
Sbjct: 1381 LDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNHPNIVQYYGVEVHRD------- 1433

Query: 134  EILLLMELCPK---KSLLDY--MNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHR 188
            ++ + ME C      SLL++  + +++ T++   E+L+        +A +H     ++HR
Sbjct: 1434 KVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLE-------GLAYLH--QAGVVHR 1484

Query: 189  DIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLT---------------NNIY- 232
            DIK EN+L+D +   K  DFG+        +   +I   +               N+++ 
Sbjct: 1485 DIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHD 1544

Query: 233  VHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELTGQFAILH 286
            +  TP Y +PE I  Y+        DIW+ G  + +++    P+  L  ++AI++
Sbjct: 1545 MLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANLDNEWAIIY 1599

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 76/179 (42%), Gaps = 23/179 (12%)

Query: 99  LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK 158
           + NE   +++L    NI Q  D     + D       + ++E C    L D++       
Sbjct: 55  VHNEYAILRRLGTHRNICQLLDF----YEDAD---TYVFVLEYCAYGDLYDFIKAIRERP 107

Query: 159 LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
                    ++ + +AI+  H     + HRDIK ENVL+D     KL DFG +     I 
Sbjct: 108 TMRINFHSFLFQLCSAISYCH--SKDVSHRDIKPENVLMDDRGQVKLTDFGLSQ----IG 161

Query: 219 STHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
           S  +D        Y   T +Y +PE     R       +D W+LGI ++ L+F + PFE
Sbjct: 162 SVSKD--------YCIGTEKYLAPET--FLREYHNTFATDYWSLGITIFCLMFGSCPFE 210

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 119/249 (47%), Gaps = 41/249 (16%)

Query: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83
           P+SHL    T V            + +G F+ +Y+V F + TN+  A    K +K     
Sbjct: 436 PDSHLFEKFTNV----------HSIGKGQFSTVYQVTFAQ-TNKKYA---IKAIKPNKYN 481

Query: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143
            LKR+++ +   LNE+ N++ TM Q  G   I+ Y  S   ++          ++ ELC 
Sbjct: 482 SLKRILL-EIKILNEVTNQI-TMDQ-EGKEYIIDYISSWKFQN-------SYYIMTELCE 531

Query: 144 KKSLLDYMNNKLATK---LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKD 200
             +L  ++  ++  K   L +  I KI+ ++S A+  +H     ++H D+K  NV++  +
Sbjct: 532 NGNLDGFLQEQVIAKKKRLEDWRIWKIIVELSLALRFIHD-SCHIVHLDLKPANVMITFE 590

Query: 201 DNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIW 260
            N KL DFG        ++TH  + +   +       +Y +PE+I    C   + K+DI+
Sbjct: 591 GNLKLGDFG--------MATH--LPLEDKSFENEGDREYIAPEIIS--DCT-YDYKADIF 637

Query: 261 ALGIFLYKL 269
           +LG+ + ++
Sbjct: 638 SLGLMIVEI 646

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 115/246 (46%), Gaps = 35/246 (14%)

Query: 85  LKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPK 144
           +K++   DE+ LNE   E++ +K LR   NIV+Y       H       E+ +++E C +
Sbjct: 38  IKQIEFEDESELNEHMLEIDLLKNLR-HQNIVEYRGFIQKAH-------ELYIILEYCAR 89

Query: 145 KSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYL-PTPLIHRDIKIENVLVDKDDNF 203
            SL D + +     L E + +     V+  +  + YL    +IHRDIK  N+L+ ++   
Sbjct: 90  GSLRDILKHG---PLLEDDTVNY---VTQTLYGLQYLHEQGVIHRDIKAANLLLTEEGIV 143

Query: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
           KL DFG        VST  +   +T       +P + +PE++       +   SDIW+LG
Sbjct: 144 KLADFG--------VSTRINRMAMT----YAGSPNWMAPEVMTGQGASTV---SDIWSLG 188

Query: 264 IFLYKLLFYTTPFE----LTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIY 319
             + +LL    PF      +  +AI++ +Y IP    S++  + +     +N   R    
Sbjct: 189 ATVVELLTGNPPFHNLVNESACYAIVNEEY-IPPLTLSAECKDFLSRCFQKNMFKRATAQ 247

Query: 320 QVMHHV 325
           +++ H+
Sbjct: 248 ELLAHI 253

>AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326)
           [1086 bp, 361 aa]
          Length = 361

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/350 (22%), Positives = 134/350 (38%), Gaps = 71/350 (20%)

Query: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83
           P  +L + + ++ V   R  +   L++ G   IYKV+ L+                G+  
Sbjct: 13  PLWNLWANDVRITVNGKRYLVTGLLSDKGLTMIYKVRSLQREQR------------GNF- 59

Query: 84  CLKRVIVPDENG--LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMEL 141
           C+K V  P      + E   E++  +    SP I    DS       GS    + ++++ 
Sbjct: 60  CIKAVHCPFGRAEHVAEAMREIDNYQAFH-SPYITSLLDSQIVPLEQGSK--LVYMVLQY 116

Query: 142 CPKKSLLDYMNNKL--ATKLTEAEILKIMYDVSNAIAQMH------------------YL 181
            P  SL   ++  L     L E  +L +M +V  A+  +H                  +L
Sbjct: 117 FPTGSLQQLIDTTLVEGVPLPEPRVLALMVEVCRAVRAVHQPGDEGVESGSATQSEDTHL 176

Query: 182 PTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF-----PIVSTHQDIAVLTNNIYV--- 233
               +  D+ +E        +F LCD   +++       PI+S   D++    + Y    
Sbjct: 177 LADALEMDV-LEASTSSPRRSFVLCDLRPSAVMLTPQGMPIIS---DLSACVRSGYALAN 232

Query: 234 -------------HTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTG 280
                        H +P Y +PE+  L     I   +DIW+LG   Y L++  +PFE   
Sbjct: 233 ATRLARMRAVLDTHGSPMYLAPELCALEPNACILPPADIWSLGCICYALMYGISPFEREE 292

Query: 281 QF-------AILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVM 322
           Q        A     +  P N  YS +L++++   LA  P  RP I  +M
Sbjct: 293 QLHGTPLRQARASGLFSFPDNPVYSLQLLDIVRQCLAVKPDARPTIDSLM 342

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 94/219 (42%), Gaps = 43/219 (19%)

Query: 86  KRVIVPDENGL---NELRNEVETMKQLRGSPNIVQYYDSN--ASRHPDGSPGFEILLLME 140
           K+ IV ++N      ++  E+  M+ +    NIV++Y ++  +S   +GS    IL+   
Sbjct: 132 KKTIVIEQNNAIVKQQIYRELTIMRSVAEHRNIVEFYGAHNLSSDSINGSNDVVILMEYM 191

Query: 141 LCPKKSLLDYMNNKLATKLTEAE---------------ILKIMYDVSNAIAQMHYLPTPL 185
            C     +      L  +   A                I +I Y V N ++ + Y    +
Sbjct: 192 NCGSLDTITRTYKSLQRRGILAANRSYPVQEWFSKPVIISRIAYSVLNGLSYL-YENYKI 250

Query: 186 IHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNI---YVHTTPQYRSP 242
           IHRDIK  NVL++     KLCDFG +               L N+I   +V T+  Y SP
Sbjct: 251 IHRDIKPSNVLINSKGRIKLCDFGVSRK-------------LNNSIADTFVGTST-YMSP 296

Query: 243 EMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 281
           E I   +      K D+W+LG+ L +LL  T  F L G 
Sbjct: 297 ERIQGNK---YTTKGDVWSLGLMLIELL--TGEFPLGGH 330

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 107/263 (40%), Gaps = 54/263 (20%)

Query: 20  SAMIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKA 79
           ++ +P   L+S     +   H  +I+  L  G F  ++ V+   + N     I  K+LK 
Sbjct: 51  TSQLPQKSLVSKGKYTL---HDFQIMRTLGTGSFGRVHLVR--SVHNGRYYAI--KVLKK 103

Query: 80  GDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLM 139
             +  +K+V         E  N+   M +L   P +++ + +             I ++M
Sbjct: 104 QQVVKMKQV---------EHTNDERRMLKLVEHPFLIRMWGTFQDAR-------NIFMVM 147

Query: 140 ELCPKKSLLDYMNNKL-----ATKLTEAEILKIMYDVSNAIAQMHYLPTP-LIHRDIKIE 193
           +      L   +           K   AE+          I  + YL    +I+RD+K E
Sbjct: 148 DYIEGGELFSLLRKSQRFPNPVAKFYAAEV----------ILALEYLHAHNIIYRDLKPE 197

Query: 194 NVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPI 253
           N+L+D++ + K+ DFG                V T    +  TP Y +PE+I      P 
Sbjct: 198 NILLDRNGHIKITDFGFAK------------EVQTVTWTLCGTPDYIAPEVIT---TKPY 242

Query: 254 NEKSDIWALGIFLYKLLFYTTPF 276
           N+  D W+LG+ +Y++L   TPF
Sbjct: 243 NKSVDWWSLGVLIYEMLAGYTPF 265

>Kwal_27.10004
          Length = 735

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 68/159 (42%), Gaps = 34/159 (21%)

Query: 137 LLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
            +ME C +  L   ++     K    E  +    V   I  +H     ++HRDIK ENVL
Sbjct: 361 FVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIH--SQGVVHRDIKPENVL 418

Query: 197 VDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTT----PQYRSPEMI------- 245
           + K+   K+ DFG +         ++D   LT+ + +  T    P Y +PE++       
Sbjct: 419 ISKEGIAKMTDFGISDWG------NEDPDDLTSPVRLFDTYVGSPPYSAPEVVAFKDEDS 472

Query: 246 --------DLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
                   D Y       K D WALG+ L+ L++  TPF
Sbjct: 473 TYQDRKPYDAY-------KMDCWALGVLLFTLVYQCTPF 504

>Scas_629.16
          Length = 918

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 124/301 (41%), Gaps = 48/301 (15%)

Query: 35  VVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDA---GIDSKLLKAGDIACLKRVIVP 91
           + VG    E ++ L +G    +Y V+  + TN + A      S+++K   I   KR++  
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVR-EKKTNRLYALKIFSKSEMIKRKKI---KRILAE 567

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
            E            +      P +V  Y S  S          +   ME C        +
Sbjct: 568 QE------------ILATSNHPFVVTLYHSFQSED-------YLYFCMEYCMGGEFFRAL 608

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
             +    ++E +      +V+ A+  +H L    I+RD+K EN+L+ K  +  L DF  +
Sbjct: 609 QTRRTKCISEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLS 666

Query: 212 SMC----FPIV-----STHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDI 259
                   P++     ST  D  + ++    ++   T +Y +PE+I   R        D 
Sbjct: 667 VQAKDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDW 723

Query: 260 WALGIFLYKLLFYTTPFELTGQ---FA-ILHSKYEIPQNG-YSSKLINLIIIMLAENPSL 314
           W LGI +Y++LF  TPF+ +     F+ IL +    P N   S    +LI  +L +N + 
Sbjct: 724 WTLGILIYEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKNEAK 783

Query: 315 R 315
           R
Sbjct: 784 R 784

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 50/92 (54%), Gaps = 15/92 (16%)

Query: 185 LIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEM 244
           +I+RD+K EN+L+D++ + K+ DFG                V+T    +  TP Y +PE+
Sbjct: 181 IIYRDLKPENILLDRNGHIKITDFGFAK------------EVITVTWTLCGTPDYIAPEV 228

Query: 245 IDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           I      P N+  D W+LGI ++++L   TPF
Sbjct: 229 I---TTKPYNKSVDWWSLGILIFEMLAGYTPF 257

>Sklu_2073.3 YER129W, Contig c2073 2194-5742
          Length = 1182

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 78/176 (44%), Gaps = 29/176 (16%)

Query: 134 EILLLMELCPKKSLLDYMNNKLATK------LTEAEILKIMYDVSNAIAQMHYLPTPLIH 187
           +I L++E C K  +     ++L TK      LT     +++  V   +  +HY    +IH
Sbjct: 199 KIYLVLEYCSKGEIKWCPGDQLETKARGPPLLTFQRAREVLRGVVLGLEYLHY--QGIIH 256

Query: 188 RDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYV---HTTPQYRSPEM 244
           RDIK  N+LV +    K+ DFG +       ST +D     + + +     TP + +PE+
Sbjct: 257 RDIKPANLLVSETGTVKISDFGVSLA----ASTTEDGNGFIDELELAKTAGTPAFFAPEI 312

Query: 245 IDLY--------------RCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILH 286
              +              + L I+   DIWALG+ L+ LLF   PF    +  + H
Sbjct: 313 CLGHDALEKFNPDKKATKKGLCISFMIDIWALGVTLHCLLFGQLPFISEFELELFH 368

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 84/335 (25%), Positives = 137/335 (40%), Gaps = 85/335 (25%)

Query: 44  ILEHLAEGGFANIYKVKFLELTNEMDAGI-DSKLLKAGDIACLKRVIVPDENGLNELRNE 102
           +LE +  G F ++ KV       E D  +   K ++ G +   +R          +L +E
Sbjct: 12  LLEEIGRGSFGSVRKV-----VREADNKVMVRKEVRYGHMNAKER---------QQLISE 57

Query: 103 VETMKQLRGSPNIVQY--YDSNASRHPDGSPGFEILLLMELCPKKSL---LDYMNNKLAT 157
              + QL+   NIV++  +D +A  +        + L ME C K  L   + Y  ++   
Sbjct: 58  CAILSQLK-HDNIVEFFHWDHDAKSNT-------LFLYMEYCSKGDLSQMIRYYKHQ-RK 108

Query: 158 KLTEAEILKIMYDVSNAIAQMHY-------------LPTPL-------IHRDIKIENV-L 196
            + E  + +IM  +  A+ + HY             +  PL       IHRD+K  N+ L
Sbjct: 109 YVPEEYVWRIMVQILMALFKCHYGRDLSKLQTIYDAMEEPLKSKGYVVIHRDLKPGNIFL 168

Query: 197 VDKDDNF--------------KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSP 242
              DD F              KL DFG         S    I   T  +    TP Y SP
Sbjct: 169 TGYDDEFNQNASDVDYSKVIIKLGDFGLAK------SLQASIEFATTYV---GTPYYMSP 219

Query: 243 EMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF------ELTGQFAILHSKYEIPQNGY 296
           E++   R  P +  SDIW+LG  LY+L     PF      EL G+  +    +E   + Y
Sbjct: 220 EVL---RDQPYSPLSDIWSLGCILYELCSLHVPFQAKTYTELQGK--VKAGYFEPLPHFY 274

Query: 297 SSKLINLIIIMLAENPSLRPNIYQVMHHV-CSILK 330
           S  L ++I   +  + + RP+ + +++ + C I +
Sbjct: 275 SKNLQDIITRCIQVDFTKRPSTWSLLNDIQCRICR 309

>Sklu_2104.1 YBR160W, Contig c2104 694-1593
          Length = 299

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 97/227 (42%), Gaps = 48/227 (21%)

Query: 45  LEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP--DENGLNELRNE 102
           LE + EG +  +YK   L   N               I  LK++ +   DE   +    E
Sbjct: 10  LEKVGEGTYGVVYKALDLRHGNR--------------IVALKKIRLESEDEGVPSTAIRE 55

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLL-----MELCPKKSLLDYMNNKLAT 157
           +  +K+LR   NIV+ YD   S        FE L L     ME  PK+  L    NK+  
Sbjct: 56  ISLLKELRDD-NIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMESVPKEQPL---GNKI-- 109

Query: 158 KLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG-STSMCFP 216
                 I K M  +   IA  H     ++HRD+K +N+L+++D N KL DFG + +   P
Sbjct: 110 ------IKKFMMQLCKGIAYCH--AHRILHRDLKPQNLLINRDGNLKLGDFGLARAFGVP 161

Query: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
           + +   +I  L           YR+PE+  L      +   DIW++G
Sbjct: 162 LRAYTHEIVTL----------WYRAPEV--LLGGKQYSTGVDIWSIG 196

>Scas_683.12
          Length = 356

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 87/193 (45%), Gaps = 43/193 (22%)

Query: 99  LRNEVETMKQL-RGSPNIVQ----YYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN- 152
           + NE E MK L R  PNI      Y D+N             +L++E C    L D+++ 
Sbjct: 44  MANEFEIMKILGRSHPNICSMLDFYQDTNY-----------YVLVLEYCEYGDLYDFLSV 92

Query: 153 -----NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCD 207
                +++     + +  K++  +S+AI   H L   + HRDIK EN+L+ K+ + KL D
Sbjct: 93  AKRQGDQIHPSTIQLDFAKVLRQISSAIMYSHSLG--IAHRDIKPENILLTKEGDIKLAD 150

Query: 208 FGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDL---YRCLPINEKSDIWALGI 264
           +G         S  ++  + T+N        YR+PE  D    Y    I    D W+LG+
Sbjct: 151 WGHAIR----DSFSKESHIGTDN--------YRAPETFDCTIEYDTFKI----DYWSLGV 194

Query: 265 FLYKLLFYTTPFE 277
               L+F   PF+
Sbjct: 195 TSLYLIFGQAPFK 207

>Kwal_55.20326
          Length = 750

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 93/201 (46%), Gaps = 24/201 (11%)

Query: 96  LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
           ++ L++E+  +K+L+   NIV YY S+         G  + + +E  P  S+   +N+  
Sbjct: 531 VDALQHEMGLLKELQ-HENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLNS-- 580

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
                E  I      +   ++ +H     +IHRDIK  N+L+D     K+ DFG +    
Sbjct: 581 YGPFEEPLIRNFTRQILIGLSYLHR--KDIIHRDIKGANILIDIKGCVKITDFGISKKLS 638

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
           P+       A L  ++Y      + +PE++   + +   +K+DIW++G  + ++     P
Sbjct: 639 PLNQQQNKRASLQGSVY------WMAPEVV---KQVVTTKKADIWSVGCVIIEMFTGKHP 689

Query: 276 FELTGQFAILHSKYEIPQNGY 296
           F     F+ + + ++I  N +
Sbjct: 690 FP---DFSQMQAIFKIGTNTF 707

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 75/147 (51%), Gaps = 15/147 (10%)

Query: 132 GFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIK 191
           G   LL+ME  P     D+ N  ++  +T+ E+      + + +  +H +   L HRD+K
Sbjct: 379 GDTYLLVMEYAP----YDFFNLVMSNLMTQDEVNCYFKQLCHGVNYLHSMG--LAHRDLK 432

Query: 192 IENVLVDKDDNFKLCDFGSTSMC-FPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRC 250
           ++N +V KD   KL DFGS  +  +P    ++D  V ++ I V + P Y +PE++     
Sbjct: 433 LDNCVVTKDGILKLIDFGSAVVFQYP----YEDTIVKSHGI-VGSDP-YLAPELLKQTSY 486

Query: 251 LPINEKSDIWALGIFLYKLLFYTTPFE 277
            P    +D+W++ I  Y ++    P++
Sbjct: 487 DP--RVADVWSIAIIFYCMVLKRFPWK 511

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 89/199 (44%), Gaps = 24/199 (12%)

Query: 96  LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
           ++ L++E+  +K+L    NIV YY ++         G  + + +E  P  S+   +NN  
Sbjct: 498 VDALQHEMNLLKELH-HENIVTYYGAS-------QEGGNLNIFLEYVPGGSVSSMLNN-- 547

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
                E+ I      +   +A +H     +IHRDIK  N+L+D     K+ DFG +    
Sbjct: 548 YGPFEESLITNFTRQILIGVAYLH--KKNIIHRDIKGANILIDIKGCVKITDFGISKKLS 605

Query: 216 PIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTP 275
           P+       A L  +++      + SPE++   +      K+DIW+ G  + ++     P
Sbjct: 606 PLNKKQNKRASLQGSVF------WMSPEVV---KQTATTAKADIWSTGCVVIEMFTGKHP 656

Query: 276 FELTGQFAILHSKYEIPQN 294
           F     F+ + + ++I  N
Sbjct: 657 FP---DFSQMQAIFKIGTN 672

>Scas_643.20
          Length = 1082

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 61/125 (48%), Gaps = 19/125 (15%)

Query: 154  KLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSM 213
            +L   +TE E   I   V + +  +H     ++HRDIK ENV+VD   + KL D+GS + 
Sbjct: 923  ELKKNMTEYEEKLIFKQVVSGLKHLH--DQGIVHRDIKDENVIVDSKGHVKLIDYGSAAY 980

Query: 214  CFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLF 271
                 S   D+ V         T  Y +PE++   +Y   P     DIWA+GI LY ++F
Sbjct: 981  T---KSGPFDVFV--------GTIDYAAPEVLGGSVYDGKP----QDIWAIGILLYTIIF 1025

Query: 272  YTTPF 276
               PF
Sbjct: 1026 KENPF 1030

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 112/245 (45%), Gaps = 43/245 (17%)

Query: 48  LAEGGFANI----YKVKFLELTN-EMDAG---IDSKLLKAGDIACLKR-VIVPDENGLNE 98
           L EG F  +     K  + +  N E +AG   +  K+ K   I  +KR  I  D +   +
Sbjct: 54  LGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFITKDPSKETK 113

Query: 99  LRNEVETMKQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLAT 157
           +  E+  +K L   PNIV+  +    S++        I +++E         ++  K   
Sbjct: 114 IYREINALKHL-SHPNIVKLEEVLQNSKY--------IGIVLEYAAGGEFYKFIQRK--R 162

Query: 158 KLTEAEILKIMYDVSNAIAQMHYLPTP-LIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216
           +L E    ++    S  I+ +HY+ +  L+HRD+K+EN+L+D ++N  + DFG  +    
Sbjct: 163 RLKENHACRLF---SQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVN---- 215

Query: 217 IVSTHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPIN-EKSDIWALGIFLYKLLFY 272
                     L  N  + T   +P Y +PE++   R  P +  K+D W+ GI L+ +L  
Sbjct: 216 --------EFLRQNGMMKTSCGSPCYAAPELVVSNR--PYDARKADTWSCGIILFAMLAG 265

Query: 273 TTPFE 277
             P++
Sbjct: 266 YLPWD 270

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 15/92 (16%)

Query: 185 LIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEM 244
           +I+RD+K EN+L+DK+ + KL DFG       +  T            +  TP Y +PE+
Sbjct: 195 IIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTYT------------LCGTPDYIAPEV 242

Query: 245 IDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           +      P N+  D W+ GI +Y++L   TPF
Sbjct: 243 VS---TKPYNKSVDWWSFGILIYEMLAGYTPF 271

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 41/191 (21%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           EV+   ++    NI + YD            F+  ++ME C    L + +      + T 
Sbjct: 107 EVDIQSKIGKHKNITELYDY-----------FDSYIIMEYCSGGDLYEAIKADTIPRKTR 155

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLV-DKDDNFKLCDFGSTSMCFPIVST 220
            ++  I+  + +A+  +H     + HRDIK EN+L+ D +   KL D+G  +        
Sbjct: 156 -QLTHIISQILDAVEFVH--SKGIYHRDIKPENILIADSNWTVKLTDWGLATT------- 205

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDL----------YRCLPINEKSDIWALGIFLYKLL 270
             D   +  N+    + +Y +PE+ +           Y C     K DIWA+GI L  ++
Sbjct: 206 --DQTSMDRNV---GSERYMAPELFESNLDYDERNEPYEC----SKVDIWAIGIVLLNIV 256

Query: 271 FYTTPFELTGQ 281
           F+  PF +  Q
Sbjct: 257 FHKNPFSVANQ 267

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 75/166 (45%), Gaps = 43/166 (25%)

Query: 128 DGSPGFEILLLMELCPKKSLLDYMN--NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPL 185
           D +PG E+L         SLL  M   N + T+   A+++       +A+  +H     +
Sbjct: 93  DFAPGGELL---------SLLHKMGTFNDIWTRHFTAQLI-------DALEFIH--SHGI 134

Query: 186 IHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVST--------------HQDIAVLTNNI 231
           IHRD+K ENVL+D+D    + DFG+ +   P +S               +Q+ A      
Sbjct: 135 IHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCASFVG-- 192

Query: 232 YVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
               T +Y SPE++   +C      SDIWALG  +Y+ +    PF 
Sbjct: 193 ----TAEYVSPELLLYNQC---GYGSDIWALGCMIYQFVQGQPPFR 231

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 15/92 (16%)

Query: 185 LIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEM 244
           +I+RD+K EN+L+DK+ + K+ DFG       +  T            +  TP Y +PE+
Sbjct: 206 IIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYT------------LCGTPDYIAPEV 253

Query: 245 IDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           +      P N+  D W+ GI +Y++L   TPF
Sbjct: 254 VS---TKPYNKSIDWWSFGILIYEMLAGYTPF 282

>YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specific
           protein kinase of the MAP family required for completion
           of sporulation [1167 bp, 388 aa]
          Length = 388

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 121/296 (40%), Gaps = 59/296 (19%)

Query: 16  TAATSAMIPNSHLLSPNTQVVVGTHRC------EILEHLAEGGFANIYKVKFLELTNEMD 69
           T  T A+   S+L +P  + +    R       EI++ L +G +  +  VKF   +    
Sbjct: 6   TDNTRAINVASNLGAPQQRTIFAKERISIPGYYEIIQFLGKGAYGTVCSVKFKGRS---- 61

Query: 70  AGIDSKLLKAGDIACLKRV--IVPDENGLNELRNEVETMKQLRGSPNIVQYYDSN--ASR 125
                    A  IA +K++  I   E  L     E++ M   +G  NIV   D     S 
Sbjct: 62  --------PAARIA-VKKISNIFNKEILLKRAIRELKFMNFFKGHKNIVNLIDLEIVTSS 112

Query: 126 HPDGSPGFEILLLMELCPKKSLLDYMNNKL---ATKLTEAEILKIMYDVSNAIAQMHYLP 182
             DG           L   + L+DY   K+   + +L+E  I   +Y +   +  +H   
Sbjct: 113 PYDG-----------LYCYQELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYIH--S 159

Query: 183 TPLIHRDIKIENVLVDKDDNFKLCDFG-------STSMCFPIVSTHQDIAVLTNNIYVHT 235
             +IHRD+K  N+L   +   K+CDFG           C   V  H     +TN +    
Sbjct: 160 ADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQPH-----ITNYV---A 211

Query: 236 TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEI 291
           T  YR+PE+  L    P ++  DIWA+G  L +  FY       G+ + +H  +EI
Sbjct: 212 TRWYRAPEL--LLSNQPYSKSVDIWAVGCILAE--FYARKPVFMGRDS-MHQIFEI 262

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 112/262 (42%), Gaps = 60/262 (22%)

Query: 85  LKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPK 144
           LK+ +  ++  L  L +E+  ++ L+  PNIV++ D   S+        +  ++ +L   
Sbjct: 77  LKKALKGNDVQLQMLYDELSILQMLK-HPNIVEFKDWFESKD-------KFYIVTQLAVG 128

Query: 145 KSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL-VDKDDNF 203
             L D +  K   K TE + + I   + +A+  MH     ++HRD+K ENVL +DK D+ 
Sbjct: 129 GELFDRILAK--GKFTERDAVSITMQILSAVDYMH--SKNVVHRDLKPENVLYIDKSDDS 184

Query: 204 KL--CDFG-------STSMCFPIVSTHQDIA--VLTNNIYVHTTPQYRSPEMIDLYRCLP 252
           +L   DFG       +  + F    +   +A  VLTNN   H  P            C  
Sbjct: 185 QLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVLTNN--GHGKP------------C-- 228

Query: 253 INEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGY------------SSKL 300
                DIW++G+ +Y LL   + F        L    E  QN Y            S + 
Sbjct: 229 -----DIWSIGVIVYTLLCGYSAFVAETVDGFLE---ECTQNKYPVTFHKPYWDNISDEA 280

Query: 301 INLIIIMLAENPSLRPNIYQVM 322
            N I+  L  +P+ RP   ++M
Sbjct: 281 KNFILRALTLDPAERPTAAELM 302

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 109/233 (46%), Gaps = 36/233 (15%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR--NEVET 105
           L EG F    KVK       +D   DS+ +    I  ++R  VP +N   E++   E+  
Sbjct: 51  LGEGEFG---KVKLGWSKARLDG--DSRNVA---IKLIRRDTVP-KNSEKEIKIYRELNA 101

Query: 106 MKQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEI 164
           +K L   PNIV+  +    S++        I ++++         Y+  K   +L E   
Sbjct: 102 LKLL-SHPNIVRLEEVLQNSKY--------IGIVLQYASGGEFYKYIQKK--RRLKEPPA 150

Query: 165 LKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDI 224
            ++   + + +  +HY    L HRD+K+EN+L+D+ +N  + DFG       +   H++ 
Sbjct: 151 CRLFAQLISGVHYIHY--KGLAHRDLKLENLLLDEHENLIITDFGF------VNEFHKND 202

Query: 225 AVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
            + T+      +P Y +PE++   +     +K+D+W+ G+ LY +L    P++
Sbjct: 203 LMRTSC----GSPCYAAPELVVSSKPYSA-QKADVWSCGVILYAMLAGYLPWD 250

>Scas_720.103
          Length = 804

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 111/273 (40%), Gaps = 37/273 (13%)

Query: 75  KLLKAGDIACLKRVIVPDENGLNELR--NEVETMKQLRGSPNIVQYYDSNASRHPDGSPG 132
           KLL  GD+  +  V     NGL  ++  N+ + +K+ +    I +      S HP     
Sbjct: 409 KLLGQGDVGKVFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPFIVTL 468

Query: 133 FE-------ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPL 185
           +        + L ME C        +  + +  + E +      +V  A+  +H L    
Sbjct: 469 YHSFQTEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLLG--F 526

Query: 186 IHRDIKIENVLVDKDDNFKLCDFGSTSMCF----PIVSTHQDIAVLTNNIYVHT------ 235
           I+RD+K EN+L+ K  +  L DF  +        PI      +    +N+ V T      
Sbjct: 527 IYRDLKPENILLHKSGHIMLSDFDLSVHAKDSKNPIFMKDGILPTTNSNLIVDTKICSEG 586

Query: 236 --------TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE---LTGQFA- 283
                   T +Y +PE+I   R        D W LGI ++++LF  TPF+       FA 
Sbjct: 587 FRTNSFVGTEEYIAPEVI---RGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFAN 643

Query: 284 ILHSKYEIP-QNGYSSKLINLIIIMLAENPSLR 315
           IL   +E P  N  +    NLI  +L +N + R
Sbjct: 644 ILSKDFEFPNSNDITRNCKNLIKKLLTKNETKR 676

>Kwal_33.14192
          Length = 577

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 71/149 (47%), Gaps = 19/149 (12%)

Query: 132 GFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIK 191
           G   L++ME CP     D+ N  ++  +++ EI      + N +  +H +   L HRD+K
Sbjct: 292 GTNFLVVMEYCP----YDFFNLVMSDLMSKNEISCYFKQICNGVDYLHRMG--LAHRDLK 345

Query: 192 IENVLVDKDDNFKLCDFGSTSMC-FPIVSTHQDIAVLTNNIYVHTTPQYRSPEMID--LY 248
           ++N +V K    KL DFGS  +  +P      +  +L     V + P Y +PE++    Y
Sbjct: 346 LDNCVVTKQGILKLIDFGSAVVFQYPY-----EKEILRAKGIVGSDP-YLAPELLSHPSY 399

Query: 249 RCLPINEKSDIWALGIFLYKLLFYTTPFE 277
              P+    D+W++ I  Y +     P++
Sbjct: 400 DPRPV----DVWSIAIMFYCITLKRFPWK 424

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 95/239 (39%), Gaps = 49/239 (20%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNE 102
           +IL  L  G F  ++ ++    +N        K LK   I  LK+V         E  N+
Sbjct: 89  QILRTLGTGSFGRVHLIR----SNHNGRFYALKTLKKHTIVKLKQV---------EHTND 135

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL-----AT 157
              M  +   P I++ + +            ++ ++M+      L   +           
Sbjct: 136 ERRMLSIVSHPFIIRMWGTFQDSQ-------QVFMVMDYIEGGELFSLLRKSQRFPNPVA 188

Query: 158 KLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPI 217
           K   AE       V  A+  +H     +I+RD+K EN+L+DK+ + K+ DFG       +
Sbjct: 189 KFYAAE-------VCLALEYLH--SKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV 239

Query: 218 VSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
             T            +  TP Y +PE++      P N+  D W+ G+ +Y++L   TPF
Sbjct: 240 TYT------------LCGTPDYIAPEVVS---TKPYNKSVDWWSFGVLIYEMLAGYTPF 283

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 72/351 (20%), Positives = 144/351 (41%), Gaps = 69/351 (19%)

Query: 25   NSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIAC 84
            N +L+S  + +   + R +    +  G F  +Y            + +D   L  G+I  
Sbjct: 1249 NKYLVSLASSISNVSMRWQKRNFIGGGTFGRVY------------SAVD---LDNGEILA 1293

Query: 85   LKRVIVPDENGLNE---LRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMEL 141
            +K + + D   + +   L  E  ++ ++   PNIV YY     R        ++ + ME 
Sbjct: 1294 VKEINIQDSKSMQKIFPLIKEEMSVLEILNHPNIVSYYGVEVHRD-------KVNIFMEY 1346

Query: 142  CPKKSLLDYMN-----NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL 196
            C   SL   +      +++ T++   ++L+        +A +H   + ++HRD+K EN+L
Sbjct: 1347 CEGGSLAALLEHGRIEDEMVTQVYTLQLLE-------GLAYLH--ESGIVHRDVKPENIL 1397

Query: 197  VDKDDNFKLCDFG-------------STSMCFPIVSTHQDIAVLTNNIYVHT-------- 235
            +D +   K  DFG             S +        H+D+  ++++  V          
Sbjct: 1398 LDFNGVIKYVDFGAAKKIANNGTRLASMNKIENADGEHEDVTHVSDSKAVKNNENALLDM 1457

Query: 236  --TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF-ELTGQFAILH--SKYE 290
              TP Y +PE I            D+W+LG  + +++    P+  L  ++AI++  +   
Sbjct: 1458 MGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPWANLDNEWAIMYHVAAGH 1517

Query: 291  IPQ----NGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTD 337
             PQ    +  SS  +  +   L +NPS R +  +++     +   ++ F D
Sbjct: 1518 TPQFPTKDEVSSAGMKFLERCLIQNPSKRASAVELLMDPWIVQIREIAFGD 1568

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 119/293 (40%), Gaps = 52/293 (17%)

Query: 46  EHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDI-ACLKRVIVPDENGLNELRNEVE 104
           E L  G ++ +YK             +D    +   I  C K+ I+  EN +  +  E  
Sbjct: 14  ERLGHGSYSTVYK------------AVDRSTGQLFAIKVCSKKHII-SENKVKYVTIEKN 60

Query: 105 TMKQLRGS--PNIVQ-YYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           T+  L     P I++ YY  + S +        +  +++  P   LL  +  +   +  E
Sbjct: 61  TLNLLAHGNHPGIIKLYYTFHDSEN--------LYFVLDFAPGGELLQLLQTQ--GRFNE 110

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTH 221
           A     M  + +A+  +H     ++HRD+K EN+L+  +    + DFG       + S  
Sbjct: 111 AWTKHFMCQLIDALEYIH--GCKVVHRDLKPENLLLSSEGKLMITDFG-------VASNL 161

Query: 222 QDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQ 281
                L++      T +Y SPE++   +    N  SDIWA+G  LY+    T PF    +
Sbjct: 162 AATDNLSSTSSFVGTAEYVSPELLLQNKS---NFCSDIWAVGCMLYQFTQGTPPFRGENE 218

Query: 282 FAIL--------HSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHHVC 326
            A          H  Y + Q+     + +L+  +L  +P  R  + Q+ +H  
Sbjct: 219 LAAFEKIVNLDYHWIYMVSQH-----ITDLVSKILVLDPDSRYTLPQIKNHAW 266

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 64/145 (44%), Gaps = 20/145 (13%)

Query: 137 LLMELCP---KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           L ME  P   +  +L Y  N L   L   ++    Y ++  +  +H L   + HRDIK  
Sbjct: 105 LAMECLPEMLQNEILRYKKNNLELPLKHVKLYA--YQIARGMLYLHALG--ICHRDIKPS 160

Query: 194 NVLVDKDDN-FKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP 252
           NVLVD      K+CDFGS      + S    I+ + +         YR+PE+I    C  
Sbjct: 161 NVLVDPQTGILKICDFGSAKK---LESNQPSISYICSRY-------YRAPELI--VGCTQ 208

Query: 253 INEKSDIWALGIFLYKLLFYTTPFE 277
              K DIW LG  L ++L     F+
Sbjct: 209 YTTKIDIWGLGCVLGEMLLGKAVFQ 233

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 102/230 (44%), Gaps = 37/230 (16%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPD-ENGLNELRNEVETM 106
           +  G F ++YK K            D+ L    ++  +K V + + E  +  L  E+  +
Sbjct: 11  IGRGNFGDVYKAK------------DTWL---NEVVAVKVVNLENSEEEVELLAQEIFFL 55

Query: 107 KQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILK 166
            +L+ SP +  Y    A+   D S    + + ME C   S+ D +     + L E +   
Sbjct: 56  AELK-SPYVTNYI---ATVVEDVS----MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRF 107

Query: 167 IMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAV 226
           I  ++   ++ +H      IHRDIK  N+L+  +   KL DFG +       S  +D  V
Sbjct: 108 ITREILKGLSYLH--SQRKIHRDIKAANILLTDEGKVKLSDFGVSGKLLS--SFRRDTFV 163

Query: 227 LTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
                    TP + +PE++  +     +E++DIW+LGI + ++L  + P 
Sbjct: 164 --------GTPYWMAPEIV-AHDSEGYDERADIWSLGITVIEMLRGSPPL 204

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 105/243 (43%), Gaps = 37/243 (15%)

Query: 60  KFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR--NEVETMKQLR------- 110
           KF ++T E  +    +LL  GD+  +  +   D N +  L+  N+ E +K+ +       
Sbjct: 313 KFQDITVEPQSFEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTE 372

Query: 111 -------GSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAE 163
                    P IV  Y S  ++         + L ME C        +  + +  + E +
Sbjct: 373 QEILATSDHPFIVTLYHSFQTKD-------YLYLCMEYCMGGEFFRALQTRKSKCIAEED 425

Query: 164 ILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG----STSMCFPIV- 218
                 +V  A+  +H L    I+RD+K EN+L+ +  +  L DF     +T    P + 
Sbjct: 426 AKFYASEVVAALEYLHLLG--FIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMK 483

Query: 219 -STHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 274
            ST+ D  + ++    ++   T +Y +PE+I   R        D W LGI +Y++LF  T
Sbjct: 484 DSTYLDTKICSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGILIYEMLFGCT 540

Query: 275 PFE 277
           PF+
Sbjct: 541 PFK 543

>KLLA0F01507g 144356..145774 some similarities with sp|P47042
           Saccharomyces cerevisiae YJL057c IKS1 singleton,
           hypothetical start
          Length = 472

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 139/352 (39%), Gaps = 100/352 (28%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMK 107
           L  G  A +YKVK + L NE+           G  A  K  I  D + L     EV+ + 
Sbjct: 70  LGNGSRAVVYKVKHMLLENEL-----------GTFALKKICIGDDMHWLYRCLKEVKLLN 118

Query: 108 QL-RGSPNIVQYYDSNASRHP---------DGSP-GFEI-------LLLMELCP------ 143
           +L   S +++ Y      R P         DGS    +I        +L + C       
Sbjct: 119 RLTEESSHLITYNHVWLERCPVESLILTQNDGSSVNMDIPTTMPYMFILQQFCRGGNLED 178

Query: 144 -------------------KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTP 184
                              +K LL++  +++   LT  +I+ I  D++  + Q+H L   
Sbjct: 179 TIQYQVFNRISGNESRLERRKKLLNHKKSRIG--LTTRQIVSIANDIATGLKQLHSLR-- 234

Query: 185 LIHRDIKIENVLVDKD------DNFKLC---DFGSTSMCFPIVSTHQDIAVLTNNIYVHT 235
           +IHRD+K  N L+ ++      D F  C   DFG +          Q    L +      
Sbjct: 235 IIHRDLKPSNCLLLEEFDRSDTDKFPKCVIGDFGES----------QLYGQLRDATGSTG 284

Query: 236 TPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNG 295
           T ++ +PE   L +    + KSDI+A G+ LY ++    PF      AI   K+EI +  
Sbjct: 285 TVEFVAPE---LTKGAQFSFKSDIYAFGMILYFVIMGQLPFNSKDMSAI---KHEINELS 338

Query: 296 YSSK-----------------LINLIIIMLAENPSLRPNIYQVMHHVCSILK 330
           +S +                 L NL+  ML   PSLRP+  Q+ + +  I+K
Sbjct: 339 FSPEAMSKLHDSLDLAPIDPSLYNLVCEMLNHTPSLRPDSSQIEYQLNIIMK 390

>ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -
           SH] (398519..399607) [1089 bp, 362 aa]
          Length = 362

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 65/145 (44%), Gaps = 20/145 (13%)

Query: 137 LLMELCP---KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           L ME  P   +  +L Y  NKL   L   ++    Y ++  +  +H L   + HRDIK  
Sbjct: 103 LAMECLPETLQHEILRYTQNKLELPLKHIKMYT--YQIARGMLYLHALG--ICHRDIKPS 158

Query: 194 NVLVD-KDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP 252
           N+LVD K    K+CDFGS      +      I+ + +         YR+PE+I    C  
Sbjct: 159 NILVDPKSGVLKICDFGSAKK---LEQNQPSISYICSRF-------YRAPELI--VGCTQ 206

Query: 253 INEKSDIWALGIFLYKLLFYTTPFE 277
              + DIW LG  + ++L     F+
Sbjct: 207 YTTQIDIWGLGCVIGEMLIGKAVFQ 231

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 15/110 (13%)

Query: 168 MYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVL 227
           +Y ++NA+  MH     +IHRDIK EN+L+  ++  KL DFG  S+  P  +  + +   
Sbjct: 208 IYQIANALDYMH--KKNIIHRDIKPENILIGFNNVIKLTDFG-WSIINPPENRRKTVC-- 262

Query: 228 TNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
                   T  Y SPEM++       +   D WALG+  ++LL    PFE
Sbjct: 263 -------GTIDYLSPEMVE---SREYDHTIDAWALGVLAFELLTGAPPFE 302

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 81/167 (48%), Gaps = 19/167 (11%)

Query: 166 KIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF-KLCDFGS---TSMCFPIVSTH 221
           KI+ D++  +  +H      IHRDIK  N+L+D+++   KL DFGS   T    P    +
Sbjct: 238 KILEDMTKGLEYLH--SQGCIHRDIKPSNILLDEEEKVAKLSDFGSCIFTPQSLPFSDAN 295

Query: 222 QDIAVLTNNIYVHTTPQYRSPEMIDLYRC----LPINEKSDIWALGIFLYKLLFYTTPFE 277
            +         +  TP + +PE+  L       +    K DIW+LG+ LY LL+   PF 
Sbjct: 296 FEDCFQRELNKIVGTPAFIAPELCHLGNSKRDFVTDGFKLDIWSLGVTLYCLLYNELPFF 355

Query: 278 LTGQFAILHSKYEIPQNGYSSKL----INLIII--MLAENPSLRPNI 318
              +F   H   E+     SSK+    +N ++I  +L ++ +LR +I
Sbjct: 356 GENEFETYHKIIEV---SLSSKINGNTLNDLVIKRLLEKDVTLRISI 399

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 92/200 (46%), Gaps = 25/200 (12%)

Query: 96  LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
           ++ L++E+  +K+L+   NIV YY S+         G  + + +E  P  S+   ++N  
Sbjct: 456 IDALQHEMSLLKELQ-HENIVTYYGSSQE-------GGNLNIFLEYVPGGSVSSMLSN-- 505

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
                E  I+     +   +A +H     +IHRDIK  N+L+D     K+ DFG +    
Sbjct: 506 YGPFEEPLIVNFTRQILIGVAYLHR--KNIIHRDIKGANILIDIKGCVKITDFGISKKLS 563

Query: 216 PIVSTHQDIAV-LTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTT 274
           P+   +QD    L  ++Y      + SPE++   +      K+DIW+ G  + ++     
Sbjct: 564 PLNQENQDKRTSLQGSVY------WMSPEVV---KQTATTSKADIWSTGCVVIEMFTGKH 614

Query: 275 PFELTGQFAILHSKYEIPQN 294
           P+     F+ + + ++I  N
Sbjct: 615 PYP---DFSQMQALFKIGTN 631

>CAGL0I05390g complement(508677..510041) similar to sp|Q12505
           Saccharomyces cerevisiae YPL026c SKS1 suppressor kinase
           of SNF3 or tr|Q03785 Saccharomyces cerevisiae YDR247w,
           start by similarity
          Length = 454

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 97/223 (43%), Gaps = 39/223 (17%)

Query: 147 LLDYMNNKLATKLTEAEILK--------IMYDVSNAIAQMHYLPTPLIHRDIKIENVLVD 198
           ++DY  N L T + + +           +   +  A+   H +   + H DIK EN+L+D
Sbjct: 136 VMDYYENDLFTSIVDKQYFANDGLLVKDVFLKICTALQYCHSMG--VYHCDIKPENILLD 193

Query: 199 KDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEK-- 256
             DN  LCDFG  +          D   L  N+ V +   Y +PE I LY   P+  +  
Sbjct: 194 ASDNVYLCDFGLAT----------DSKYLAPNVCVGSF-YYMAPERI-LYSSAPLETETA 241

Query: 257 ------SDIWALGIFLYKLLFYTTPF-------ELTGQFAILHSKYEIPQNGYSSKLINL 303
                 SDIW+LGI L  L+    P+       + T QF I ++K        S +L+++
Sbjct: 242 VLPTATSDIWSLGIILINLVCMRNPWLKAHQGEDATFQFFIENNKILQKILPISDELLDV 301

Query: 304 IIIMLAENPSLRPNIYQVMHHVCSILKC--DVPFTDKYELGPY 344
           +  +L   P  R  +  +M  + SI K   D P +   E+ P+
Sbjct: 302 LGDILCLEPCRRIALDVLMAKIRSIKKLTPDGPLSQIPEIEPH 344

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 107/226 (47%), Gaps = 33/226 (14%)

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEA 162
           ++ +K L+   NIV+Y+    S H       E+ +L+E C + SL D +  +    L+EA
Sbjct: 65  IDLLKNLK-HENIVKYHGFIQSSH-------ELYILLEYCIRGSLRDLIKKE---ALSEA 113

Query: 163 EILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQ 222
           +    +      +  +H     +IHRDIK  N+L+ ++   KL DFG        VST  
Sbjct: 114 KAKTYVRQTLRGLQYLH--DQGVIHRDIKAANLLLTENGVVKLADFG--------VSTRV 163

Query: 223 DIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF----EL 278
           +   +T       +P + +PE++ L +    +  SDIW+LG  + +LL    PF      
Sbjct: 164 NNMAMTYA----GSPNWMAPEVM-LGK--GASTVSDIWSLGATVVELLTGNPPFYNLVNE 216

Query: 279 TGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQVMHH 324
              +AI++  Y  P++  S++    + +   +N   RP  +Q++ H
Sbjct: 217 AACYAIVNDVYYPPEH-LSAECKAFMELCFQKNMFKRPQAHQLLQH 261

>Scas_689.25*
          Length = 409

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 17/107 (15%)

Query: 170 DVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTN 229
           +V  A+  +H L   +I+RD+K EN+L+D++ + K+ DFG       +  T         
Sbjct: 205 EVCLALDYLHSLD--IIYRDLKPENLLLDRNGHIKVTDFGFAKYVPDVTYT--------- 253

Query: 230 NIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
              +  TP Y +PE+I      P N+  D W+ GI +Y++L   TPF
Sbjct: 254 ---LCGTPDYIAPEVIS---AKPYNKSVDWWSFGILIYEMLSGHTPF 294

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 90/206 (43%), Gaps = 25/206 (12%)

Query: 75  KLLKAGDIACLKRVIVPDENGL-NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGF 133
           KL     I  LK +   + +G   ++  E++  K  + S  IV+YY   A          
Sbjct: 197 KLRNGSKIFALKTIATIENDGSEKQIFRELQFNKSCK-SDFIVRYYGMFACEETS----- 250

Query: 134 EILLLMELCPKKSLLDYMNNKL--ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIK 191
            I + ME    +SL     + L    ++ E  + KI   V   +  +H     +IHRDIK
Sbjct: 251 TIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGLFYLH--ERKIIHRDIK 308

Query: 192 IENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCL 251
            +N+L ++    KLCDFG +      ++T       T   Y      Y +PE I   +  
Sbjct: 309 PQNILFNEIGQIKLCDFGVSGEAVNSLAT-----TFTGTSY------YMAPERI---QGQ 354

Query: 252 PINEKSDIWALGIFLYKLLFYTTPFE 277
           P +  SD+W+LG+ L ++    +PF+
Sbjct: 355 PYSVTSDVWSLGLTLLEVAQGHSPFD 380

>Kwal_56.24059
          Length = 353

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 16/106 (15%)

Query: 172 SNAIAQMHYLPT-PLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNN 230
           +  I  + YL +  +I+RD+K EN+L+D++ + K+ DFG         +   D    T  
Sbjct: 148 AEVILALEYLHSHDIIYRDLKPENILLDRNGHIKITDFG--------FAKEVDTVTWT-- 197

Query: 231 IYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
             +  TP Y +PE+I      P N+  D W+LGI ++++L   TPF
Sbjct: 198 --LCGTPDYIAPEVI---ATKPYNKSVDWWSLGILIFEMLAGYTPF 238

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 89/202 (44%), Gaps = 48/202 (23%)

Query: 166 KIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIA 225
           +I+  V   +  +HY    +IHRDIK  N+L+ +    K+ DFG   +     S++ D +
Sbjct: 263 EILRGVVLGLEYLHY--QGIIHRDIKPANLLLSETGIVKISDFG---VSLAASSSNVDGS 317

Query: 226 VLTNN----IYVHTTPQYRSPEMI--------------DLYRCLPINEKSDIWALGIFLY 267
             T +         TP + +PE+               +L++   I+ K DIWALG+ LY
Sbjct: 318 DETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCISFKIDIWALGVTLY 377

Query: 268 KLLF----YTTPFELTGQFAILHSKYEIPQNGYSSKLIN-----------------LIII 306
            L+F    + + FEL     I++   + P+  YS  L N                 L+  
Sbjct: 378 CLVFGMLPFVSSFELELFEKIVNDPVKFPK--YSDMLKNNQVLQMTEEAEYEAAKDLLTR 435

Query: 307 MLAENPSLRPNIYQVMHH--VC 326
           +L +NP  R NI ++  H  VC
Sbjct: 436 LLEKNPIKRINIEEIKRHPFVC 457

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 134/344 (38%), Gaps = 88/344 (25%)

Query: 98  ELRNEVETMKQL--RGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL 155
           ++R E+  MK+        +++  D   SR        +I L++E C K  +     ++L
Sbjct: 161 KIRREIAIMKKCDHEHVVKLIEVLDDMKSR--------KIYLVLEYCSKGEVKWCPGDQL 212

Query: 156 ATK------LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG 209
                    LT     +I+  V   +  +HY    +IHRDIK  N+L+ + D  K+ DFG
Sbjct: 213 EAAARGPPLLTFQRTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSEHDIVKISDFG 270

Query: 210 ----STSMCFPIVSTHQDI---AVLTNN-------IYVHTTPQYRSPEMI---DLYRCLP 252
               S++   P   +        VL               TP + +PE+    D Y  L 
Sbjct: 271 VSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKLN 330

Query: 253 INEKS------------DIWALGIFLYKLLFYTTPF----ELTGQFAILHSKYEIPQ--- 293
           I+ +S            DIWALG+ LY LLF   PF    E+     I++   E P+   
Sbjct: 331 IDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRLEF 390

Query: 294 ---NGYSS--------KLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELG 342
              NG S            +L+  +L +NP  R NI  +  H         PF       
Sbjct: 391 MQSNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIVDIKAH---------PFV------ 435

Query: 343 PYDF---AKYSQYHLKLQQIQYQMF-----ELYKNEKVTSGDVD 378
            +DF      S   + ++Q + Q F     E YK   V+  +VD
Sbjct: 436 CWDFDHVDGLSGQRISMRQAEKQKFLRHQDEEYKQISVSHDEVD 479

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 99/223 (44%), Gaps = 38/223 (17%)

Query: 45  LEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP--DENGLNELRNE 102
           LE + EG +  +YK             +D +  K   +  LK++ +   DE   +    E
Sbjct: 11  LEKVGEGTYGVVYK------------ALDLRPGKGQRVVALKKIRLESEDEGVPSTAIRE 58

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEA 162
           +  +K+L+   NIV+ YD     H D    + +L  ++L  K+    YM +    +    
Sbjct: 59  ISLLKELKDD-NIVRLYDIV---HSDAHKLYLVLEFLDLDLKR----YMESIPKDQPLGV 110

Query: 163 EILK-IMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG-STSMCFPIVST 220
            I+K  M  +   IA  H     ++HRD+K +N+L+DK+ N KL DFG + +   P+ + 
Sbjct: 111 NIIKKFMVQLCKGIAYCH--AHRILHRDLKPQNLLIDKEGNLKLGDFGLARAFGVPLRAY 168

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
             +I  L           YR+PE+  L      +   D W++G
Sbjct: 169 THEIVTL----------WYRAPEV--LLGGKQYSTGVDTWSIG 199

>YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine protein
            kinase of unknown function [3306 bp, 1101 aa]
          Length = 1101

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 77/170 (45%), Gaps = 30/170 (17%)

Query: 159  LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIV 218
            + E E   +   V  +I  +H     ++HRDIK ENV+VD     KL DFGS +    I 
Sbjct: 947  MVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVKLIDFGSAAY---IK 1001

Query: 219  STHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
            S   D+ V         T  Y +PE++    Y+  P     DIWALG+ LY +++   P+
Sbjct: 1002 SGPFDVFV--------GTMDYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYKENPY 1049

Query: 277  E-----LTGQFAILHSKYEIPQNGYSSKLINLIIIMLAENPSLRPNIYQV 321
                  L G+     S++       S + I+LI  +L      RP I ++
Sbjct: 1050 YNIDEILEGELRFDKSEH------VSEECISLIKRILTREVDKRPTIDEI 1093

>Scas_660.20
          Length = 957

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 8/93 (8%)

Query: 185 LIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEM 244
           +IHRD+K ENVL+D+D    + DFG+    +   + + D A  +++ +V T  +Y SPE+
Sbjct: 134 VIHRDLKPENVLLDRDGKLMITDFGA---AYTTTAGNND-ANKSSSSFVGTA-EYVSPEL 188

Query: 245 IDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
           +   +C   +  SD+WALG  +++ +  + PF 
Sbjct: 189 LLHNQC---SFSSDVWALGCMIFQFVTGSPPFR 218

>Kwal_23.6458
          Length = 868

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 104/258 (40%), Gaps = 41/258 (15%)

Query: 34  QVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSK--LLKAGDIACLKRVIVP 91
           +V+VG    E ++ L +G    +Y VK  +        I SK  ++K   I   KR++  
Sbjct: 456 EVIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKI---KRILAE 512

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
            E            +      P IV  Y S  S          + L ME C        +
Sbjct: 513 QE------------ILATSNHPFIVTLYHSFQSED-------YLYLCMEYCMGGEFFRAL 553

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGST 211
             +    + E +      +V  AI  +H +    I+RD+K EN+L+ K  +  L DF  +
Sbjct: 554 QTRKTKCIDEDDARFYSSEVVAAIEYLHLMG--FIYRDLKPENILLHKSGHIMLSDFDLS 611

Query: 212 SMCF----PIV-----STHQDIAVLTNNIYVHT---TPQYRSPEMIDLYRCLPINEKSDI 259
                   P+V     S+  D  + ++    ++   T +Y +PE+I   R        D 
Sbjct: 612 VQAKDTKNPVVKGSAQSSLLDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDW 668

Query: 260 WALGIFLYKLLFYTTPFE 277
           W LGI +Y++LF  TP++
Sbjct: 669 WTLGILIYEMLFGFTPYK 686

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 99/226 (43%), Gaps = 36/226 (15%)

Query: 48  LAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELR--NEVET 105
           L EG F    KVK     +  D        K   I  ++R  +P +N   E++   E+  
Sbjct: 62  LGEGEFG---KVKLGWSKSNSDES------KNVAIKLIRRDTIP-KNSEKEVKIYREINA 111

Query: 106 MKQLRGSPNIVQYYDS-NASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEI 164
           +K L   PNIV   +    S++        I +++          Y+  K   +L E   
Sbjct: 112 LKHL-AHPNIVTLEEVLQNSKY--------IGIVLHYASGGEFYKYIQKK--RRLKEPAA 160

Query: 165 LKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDI 224
            ++   + + +  MH+    L HRD+K+EN+L+D+ +N  + DFG  +      S+  D+
Sbjct: 161 CRLFAQLISGVHYMHH--KGLAHRDLKLENLLLDEHENLIITDFGFVNE----FSSRNDL 214

Query: 225 AVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270
              +       +P Y +PE++   +      K+D+W+ G+ LY +L
Sbjct: 215 MKTSCG-----SPCYAAPELVVTTKAYEA-RKADVWSCGVILYAML 254

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 109/247 (44%), Gaps = 38/247 (15%)

Query: 43  EILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKA------GDIACLKRVIVPDENGL 96
           +++E   +G    +Y  K ++L  E D     + LK+      G+   +K++ + ++   
Sbjct: 361 QLVEKAGQGASGAVYLSKRIKLPQENDP----RFLKSHCHRVVGERVAIKQIRLSEQPKK 416

Query: 97  NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN---- 152
             + NE+  M   R   NIV + ++            E+ ++ME      L D ++    
Sbjct: 417 QLIMNELLVMNDSR-QENIVNFLEAYIIDDE------ELWVIMEYMEGGCLTDILDAVAR 469

Query: 153 ---NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG 209
               + ++ L E ++  I+ +    +  +H     +IHRDIK +N+L++     K+ DFG
Sbjct: 470 SNTGEHSSPLNENQMAYIVKETCQGLKFLH--NKKIIHRDIKSDNILLNSQGLVKITDFG 527

Query: 210 STSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 269
               C  +       A +        TP + +PE+++       +EK D+W+LGI L ++
Sbjct: 528 ---FCVELTEKRSKRATMVG------TPYWMAPEIVNQK---GYDEKVDVWSLGIMLIEM 575

Query: 270 LFYTTPF 276
           +    P+
Sbjct: 576 IEGEPPY 582

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 122/266 (45%), Gaps = 49/266 (18%)

Query: 85  LKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPK 144
           +K+ +  ++  L  L +E++ +++L   PNIV + D   S+        +  ++ +L   
Sbjct: 69  IKKALKGNKVQLEALYDELDILQRLH-HPNIVAFKDWFESKD-------KFYIITQLAKG 120

Query: 145 KSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVL-VDKDDN- 202
             L D +  K   K TE + ++I+ ++ +A+  MH     ++HRD+K EN+L +DK D  
Sbjct: 121 GELFDRILKK--GKFTEEDAVRILVEILSAVKYMH--SQNIVHRDLKPENLLYIDKSDES 176

Query: 203 -FKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI--DLYRCLPINEKSDI 259
              + DFG   +   + S  + +     ++       Y +PE++  D +      +  DI
Sbjct: 177 PLVVADFG---IAKRLKSDEELLYKPAGSL------GYVAPEVLTQDGH-----GKPCDI 222

Query: 260 WALGIFLYKLLFYTTPFEL-----------TGQFAI-LHSKYEIPQNGYSSKLINLIIIM 307
           W++G+  Y LL   + F             TG++ +  H  Y    +  S+K    I+  
Sbjct: 223 WSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPY---WDSVSNKAKQFILKA 279

Query: 308 LAENPSLRPNIYQVMHH---VCSILK 330
           L  +PS RP   +++     +C+ LK
Sbjct: 280 LNLDPSKRPTAAELLEDPWIICTELK 305

>Kwal_55.20189
          Length = 812

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 80/191 (41%), Gaps = 41/191 (21%)

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTE 161
           EV+   ++    NI + YD            F+  ++ME C    L + +   L  K T+
Sbjct: 107 EVDIHTKVGKHKNITELYDF-----------FDSFIVMEYCSGGDLYEAIKADLIPKRTK 155

Query: 162 AEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDD-NFKLCDFGSTSMCFPIVST 220
             I  I   +  AI  +H     + HRD+K EN+L++  D   KL D+G  +       T
Sbjct: 156 V-ITHIASQIMEAIEFVHQ--KGIYHRDLKPENILIEGSDWTIKLTDWGLATT----EPT 208

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDL----------YRCLPINEKSDIWALGIFLYKLL 270
             D +V         + +Y +PE+ +           Y C     K D+WA+GI L  ++
Sbjct: 209 SLDRSV--------GSERYMAPELFEENLDRDERSEPYDC----SKVDLWAIGIVLLNIV 256

Query: 271 FYTTPFELTGQ 281
           F   PF +  Q
Sbjct: 257 FQKNPFSVANQ 267

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 77/169 (45%), Gaps = 33/169 (19%)

Query: 115 IVQYY-----DSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL--ATKLTEAEILKI 167
           IV+YY     D N+S          I + ME    KSL     N L    +++E  + KI
Sbjct: 257 IVRYYGMFNDDRNSS----------IYIAMEYMGGKSLDAIYKNLLRRGGRISEKVLGKI 306

Query: 168 MYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVL 227
              V   ++ +H     +IHRDIK +N+L+++    KLCDFG +      ++T       
Sbjct: 307 AESVLRGLSYLH--ERRIIHRDIKPQNILLNEIGQVKLCDFGVSGEAVNSLAT-----TF 359

Query: 228 TNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           T   Y      Y +PE I   +  P +  SD+W+LG+ L ++     PF
Sbjct: 360 TGTSY------YMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGHFPF 399

>Kwal_55.22001
          Length = 363

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 66/145 (45%), Gaps = 20/145 (13%)

Query: 137 LLMELCPKKSLLD---YMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           L ME  P+   L+   Y +NKL   L   ++    Y ++  +  +H L   + HRDIK  
Sbjct: 104 LAMECLPETLQLEIHRYASNKLELPLKHTKLYT--YQIARGMLYLHALG--ICHRDIKPS 159

Query: 194 NVLVDKDDN-FKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP 252
           NVLVD +    K+CDFGS      +      I+ + +         YR+PE+I    C  
Sbjct: 160 NVLVDPNTGVLKICDFGSAKK---LEQNQPSISYICSRF-------YRAPELI--VGCTQ 207

Query: 253 INEKSDIWALGIFLYKLLFYTTPFE 277
              + DIW LG  + ++L     F+
Sbjct: 208 YTTQIDIWGLGCVMGEMLIGKAVFQ 232

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 96/196 (48%), Gaps = 19/196 (9%)

Query: 80  GDIACLKRVIVPDENGLNELRN--EVETMKQLRGSPNIVQYYDSNASRHPDGSPGF-EIL 136
           G+I  +K+ IVP +  L  LR   E++ +++ +   NI+  +D    + P+    F E+ 
Sbjct: 36  GEIVAIKK-IVPFDKPLFALRTLREIKILRRFQHE-NIISIFDI---QKPESFEKFNEVY 90

Query: 137 LLMELCPKKSLLDYMNNKLATK-LTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENV 195
           ++ EL         ++  +AT+ LT+  I   +Y    AI  +H   + +IHRD+K  N+
Sbjct: 91  IIQELMQTD-----LHRVIATQTLTDDHIQYFIYQTLRAIKTLH--GSNVIHRDLKPSNI 143

Query: 196 LVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINE 255
           L++ + + K+CDFG   +     +   ++  +    YV  T  YR+PE+  +      + 
Sbjct: 144 LINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYV-ATRWYRAPEV--MLTNAKYSR 200

Query: 256 KSDIWALGIFLYKLLF 271
             DIW+ G  L +L  
Sbjct: 201 AMDIWSCGCILGELFL 216

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 111/265 (41%), Gaps = 50/265 (18%)

Query: 92  DENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM 151
           DE+   ++  E+E +   + SP IV +Y    +   +G+    + + ME     SL    
Sbjct: 454 DESKFRQILMELEVLHNCQ-SPYIVDFY---GAFFIEGA----VYMCMEYMDGGSLDKTY 505

Query: 152 NNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDN-FKLCDFGS 210
           +++    + E ++ +I   V   + ++  +   +IHRD+K  N+L        KLCDFG 
Sbjct: 506 DDEQIGGIDEPQLARITSSVIQGLKELKDVHN-IIHRDVKPTNILCSASQGTIKLCDFG- 563

Query: 211 TSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI-------DLYRCLPINEKSDIWALG 263
                  VS +   ++   NI   +   Y +PE I         Y       +SDIW+LG
Sbjct: 564 -------VSGNLVASLAKTNIGCQS---YMAPERIKSLNPDKSTYSV-----QSDIWSLG 608

Query: 264 IFLYKLLFYTTPF---ELTGQFAILHSKYE-----IPQNGYSSKLINLIIIMLAENPSLR 315
           + + ++     P+        F+ L +  +     +P+  +S+   N + + L + P  R
Sbjct: 609 LSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFSADAQNFVSMCLQKIPERR 668

Query: 316 PNIYQVMHHVCSILKCDVPFTDKYE 340
           P    ++ H         P+  KYE
Sbjct: 669 PTYAALLEH---------PWLKKYE 684

>Scas_640.16
          Length = 505

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 90/210 (42%), Gaps = 50/210 (23%)

Query: 115 IVQYY----DSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL--ATKLTEAEILKIM 168
           IV+YY    D N+S          I + ME    KSL     N L    +++E  + KI 
Sbjct: 269 IVRYYGMFNDVNSS---------SIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKIS 319

Query: 169 YDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLT 228
             V   ++ +H     +IHRDIK +N+L ++    KLCDFG +      ++T       T
Sbjct: 320 ESVLRGLSYLH--EQKVIHRDIKPQNILFNEKGQVKLCDFGVSGEAVNSLAT-----TFT 372

Query: 229 NNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF---ELTGQFAIL 285
              +      Y +PE I   +  P +   DIW+LG+ + ++     PF   ++T   A  
Sbjct: 373 GTSF------YMAPERI---QGQPYSVTCDIWSLGLTILEVAQGRFPFGSDKITATIAP- 422

Query: 286 HSKYEIPQNGYSSKLINLIIIMLAENPSLR 315
                          I L++++L  NP L+
Sbjct: 423 ---------------IELLVLILTFNPELK 437

>Scas_667.18
          Length = 437

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 90/202 (44%), Gaps = 33/202 (16%)

Query: 102 EVETMKQLRGSPNIVQYYD---SNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKL--- 155
           E++ M   +G  NIV   D    N +   DG           L   + L+DY   K+   
Sbjct: 128 ELKFMNFFQGHKNIVNLIDLEIINENSPYDG-----------LYCYQELIDYDLAKVIHS 176

Query: 156 ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCF 215
           + KLTE  I   MY + + +  +H     +IHRD+K  N+L   + N K+CDFG      
Sbjct: 177 SIKLTEFHIQYFMYQILSGLKYIH--SADVIHRDLKPGNILCTLNGNLKICDFGLARGIN 234

Query: 216 P-IVSTHQDIAV-----LTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 269
           P   + + ++A      +TN +    T  YR+PE+I  ++     +  D+W++G  L + 
Sbjct: 235 PKFYNDNGNLASPKLHDITNYV---ATRWYRAPELILSHKMY--TKAIDLWSVGCILAE- 288

Query: 270 LFYTTPFELTGQFAILHSKYEI 291
            FY       G    LH  YEI
Sbjct: 289 -FYGRRPIFMGH-DTLHQVYEI 308

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 15/92 (16%)

Query: 185 LIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEM 244
           +I+RD+K EN+L+D++ + K+ DFG       +  T            +  TP Y +PE+
Sbjct: 155 IIYRDLKPENILLDRNGHIKITDFGFAKEVDTVTWT------------LCGTPDYIAPEV 202

Query: 245 IDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
           I      P N+  D W+LGI ++++L   TPF
Sbjct: 203 IT---TKPYNKSIDWWSLGILIFEMLAGYTPF 231

>Scas_703.5
          Length = 749

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 117/288 (40%), Gaps = 50/288 (17%)

Query: 38  GTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGLN 97
           G +  E+L  L +G F  +Y+VK            D+K + A  +   K ++  +E    
Sbjct: 340 GPNDFEVLRLLGKGTFGQVYQVK----------KKDTKRIYAMKVLSKKVIVKKNEVAHT 389

Query: 98  ELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLAT 157
                +      + SP IV    S  +         ++ L+ +      L  ++  +   
Sbjct: 390 IGERNILVTTATKASPFIVGLKFSFQTPT-------DLYLVTDFMSGGELFWHLQKE--G 440

Query: 158 KLTEAEILKIMYDVSNAIAQMHYL-PTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216
           + TE    +  + ++  +  + YL    +++RD+K EN+L+D + N  LCDFG +     
Sbjct: 441 RFTEE---RAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSK---- 493

Query: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276
                 D+   TN      T +Y +PE+  L       +  D W+LG+ ++++    +PF
Sbjct: 494 -----ADLKDRTNTFC--GTTEYLAPEL--LLDEAGYTKMVDFWSLGVLIFEMCCGWSPF 544

Query: 277 ELTGQFA---------ILHSKYEIPQNGYSSKLINLIIIMLAENPSLR 315
                FA         I   K + P++  S +  + +  +L  NP  R
Sbjct: 545 -----FAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 587

>YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent
           protein kinase essential for completion of START and for
           mitosis, associates with Cks1p and cyclins [897 bp, 298
           aa]
          Length = 298

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 99/223 (44%), Gaps = 38/223 (17%)

Query: 45  LEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVP--DENGLNELRNE 102
           LE + EG +  +YK             +D +  +   +  LK++ +   DE   +    E
Sbjct: 11  LEKVGEGTYGVVYK------------ALDLRPGQGQRVVALKKIRLESEDEGVPSTAIRE 58

Query: 103 VETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEA 162
           +  +K+L+   NIV+ YD     H D    + +   ++L  K+    YM      +   A
Sbjct: 59  ISLLKELKDD-NIVRLYDIV---HSDAHKLYLVFEFLDLDLKR----YMEGIPKDQPLGA 110

Query: 163 EILK-IMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG-STSMCFPIVST 220
           +I+K  M  +   IA  H     ++HRD+K +N+L++KD N KL DFG + +   P+ + 
Sbjct: 111 DIVKKFMMQLCKGIAYCH--SHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAY 168

Query: 221 HQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
             +I  L           YR+PE+  L      +   D W++G
Sbjct: 169 THEIVTL----------WYRAPEV--LLGGKQYSTGVDTWSIG 199

>Scas_602.11
          Length = 1186

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 122/299 (40%), Gaps = 81/299 (27%)

Query: 99  LRNEVETMKQL--RGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA 156
           ++ E+  MK+L  +    +++  D   SR        +I L++E C +  +     + L 
Sbjct: 228 IKREIAIMKKLHHKHVVKLIEVLDDLKSR--------KIYLVLEYCAQGEIKWCPKDCLE 279

Query: 157 TKLTEAEIL------KIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG- 209
           T+     +L      +I+  V   +  +HY    +IHRDIK  N+LVD++   K+ DFG 
Sbjct: 280 TEAKGPPLLSFQSAREIIRGVILGLEYLHY--QGIIHRDIKPANLLVDEEGTVKISDFGV 337

Query: 210 ---------STSMCFPIV---------STHQDIAVLTNN----------IYVHTTPQYRS 241
                    ST+    ++         S+ + +    NN               TP + +
Sbjct: 338 SLASRSSGNSTANSSSVLGGTPRNLSRSSTESMNTTNNNDDESIDEVELAKTAGTPAFFA 397

Query: 242 PEMI--------------DLYRCLPINEKSDIWALGIFLYKLLFYTTPF----------E 277
           PE+               ++++   I+   DIWALGI  Y LLF   PF          +
Sbjct: 398 PEICLGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPFISDFELELFEK 457

Query: 278 LTGQFAILHSKYEIPQNGYSS--------KLINLIIIMLAENPSLRPNIYQVMHH--VC 326
           + G+     S  E+  N  S+           N++  +L +NPS R +I ++ +H  +C
Sbjct: 458 IVGEPLTFPSYEELQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKRCSILELKYHPFIC 516

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 91/201 (45%), Gaps = 28/201 (13%)

Query: 135 ILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIEN 194
           + L ME C        +  +    ++E +      +V+ A+  +H +    I+RD+K EN
Sbjct: 452 LYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLMG--FIYRDLKPEN 509

Query: 195 VLVDKDDNFKLCDF---------------GSTSMCFPIVSTHQDIAVLTNNIYVHTTPQY 239
           +L+ +  +  L DF               G+ S    +V T         N +V T  +Y
Sbjct: 510 ILLHQSGHIMLSDFDLSVQAKDTKNPQVKGNASHS--LVDTKICSDGFRTNSFVGTE-EY 566

Query: 240 RSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFEL--TGQ-FA-ILHSKYEIPQNG 295
            +PE+I   R        D W LGI +Y++LF  TPF+   T Q F+ IL ++  IP N 
Sbjct: 567 IAPEVI---RGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEVVIPNNN 623

Query: 296 YSSKLI-NLIIIMLAENPSLR 315
            +S+   +LI  +L +N + R
Sbjct: 624 ETSRACKDLIRKLLIKNENKR 644

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 91/200 (45%), Gaps = 38/200 (19%)

Query: 96  LNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYM-NNK 154
           L++L  E + + QL   PNI++ + +    H D S    I    EL P   L  Y+    
Sbjct: 199 LSKLDKEAKILMQLN-HPNIIKVFKT----HTDKSNNLYIF--QELIPGGDLFSYLAKGD 251

Query: 155 LATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFK---LCDFGST 211
               +++ E L  +Y + +A+  +H     ++HRD+K++N+L+   + F    L DFG  
Sbjct: 252 CLMPISQTEALVFVYQILHALKYLH--TKGIVHRDLKLDNILLCTPEPFTKIVLADFGIA 309

Query: 212 SMCFPIVSTHQDIAVLTNNIY-VHTTPQYRSPEMI---------DLYRCLPINE-----K 256
                     + +  + + ++ V  TP+Y +PE+            +R   + +     K
Sbjct: 310 ----------RTVTTMKSRMFTVVGTPEYCAPEVGFKANRKAYHSFFRAATLEQQGYDSK 359

Query: 257 SDIWALGIFLYKLLFYTTPF 276
            D+W+LG+  + +L   +PF
Sbjct: 360 CDLWSLGVITHIMLTGISPF 379

>AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH]
            complement(196774..201870) [5097 bp, 1698 aa]
          Length = 1698

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 94/202 (46%), Gaps = 15/202 (7%)

Query: 131  PGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDI 190
            P   + + ME C  ++L D ++N+  ++  + E  ++   +  A++ +H     +IHRD+
Sbjct: 819  PKSTLFIQMEYCENRTLYDLIHNENLSQQRD-EYWRLFRQILEALSYIH--SQGIIHRDL 875

Query: 191  KIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVH------TTPQYRSPEM 244
            K  N+ +D+  N K+ DFG            +      +N+          T  Y + E+
Sbjct: 876  KPMNIFIDESRNIKIGDFGLAKNVHKSADILRIEGAFGSNVSADDLTSAIGTALYVASEV 935

Query: 245  IDLYRCLPINEKSDIWALGIFLYKLLF-YTTPFELTGQFAILHSK-YEIPQNGYSSKL-- 300
              L      NEK D+++LGI  +++++ + T  E       L S   E+P N  SSK   
Sbjct: 936  --LTGNGNYNEKIDMYSLGIIFFEMVYHFDTLMERATDLRKLRSSAVELPANFDSSKRNE 993

Query: 301  INLIIIMLAENPSLRPNIYQVM 322
              +I ++L  +P+ RP   +++
Sbjct: 994  KKIIRLLLDHDPAKRPTAAKLL 1015

>Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement
          Length = 363

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 20/145 (13%)

Query: 137 LLMELCPKKSLLD---YMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           L ME  P+   L+   Y +NKL   L   ++    Y ++  +  +H L   + HRD+K  
Sbjct: 104 LAMECLPETLQLEIHRYSSNKLELPLKHIKLYS--YQIARGMLYLHALG--ICHRDVKPS 159

Query: 194 NVLVDKDDN-FKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP 252
           N+LVD +    K+CDFGS      +  +   I+ + +         YR+PE+I    C  
Sbjct: 160 NILVDPNTGVLKICDFGSAKK---LEQSQPSISYICSRF-------YRAPELI--VGCTQ 207

Query: 253 INEKSDIWALGIFLYKLLFYTTPFE 277
              + DIW LG  + ++L     F+
Sbjct: 208 YTTQIDIWGLGCVMGEMLIGKAVFQ 232

>ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH]
           (810941..811828) [888 bp, 295 aa]
          Length = 295

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 101/224 (45%), Gaps = 42/224 (18%)

Query: 45  LEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGD-IACLKRVIVP--DENGLNELRN 101
           LE + EG +  +YK             +D   L+ G  I  LK++ +   DE   +    
Sbjct: 10  LEKVGEGTYGVVYK------------AVD---LRHGQRIVALKKIRLESEDEGVPSTAIR 54

Query: 102 EVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLATK-LT 160
           E+  +K+L+   NIV+ YD     H D    + +   +EL  K+    YM +    + L 
Sbjct: 55  EISLLKELKDD-NIVRLYDIV---HSDAHKLYLVFEFLELDLKR----YMESVPKDQPLG 106

Query: 161 EAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFG-STSMCFPIVS 219
           +  I K M  +   IA  H     +IHRD+K +N+L++++ N KL DFG + +   P+ +
Sbjct: 107 DKIIKKFMMQLCKGIAYCH--AHRIIHRDLKPQNLLINRNGNLKLGDFGLARAFGVPLRA 164

Query: 220 THQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263
              +I  L           YR+PE+  L      +   D+W++G
Sbjct: 165 YTHEIVTL----------WYRAPEV--LLGGKQYSTGVDVWSIG 196

>YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of the
           GSK3 subfamily of protein kinases, positive regulator of
           meiosis and spore formation [1128 bp, 375 aa]
          Length = 375

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 79/171 (46%), Gaps = 25/171 (14%)

Query: 113 PNIV--QYYDSNASRHPDGSPGFEILLLMELCPKKSLLD---YMNNKLATKLTEAEILKI 167
           PNIV  QY+ ++ S  P  +  ++  L ME  P+   ++   Y+ NKL   L    +   
Sbjct: 90  PNIVKLQYFFTHLS--PQDNKVYQ-HLAMECLPETLQIEINRYVTNKLEMPLKHIRLYT- 145

Query: 168 MYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDN-FKLCDFGSTSMCFPIVSTHQDIAV 226
            Y ++  +  +H L   + HRDIK  NVLVD +    K+CDFGS      +      I+ 
Sbjct: 146 -YQIARGMLYLHGLG--VCHRDIKPSNVLVDPETGVLKICDFGSAK---KLEHNQPSISY 199

Query: 227 LTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPFE 277
           + +         YR+PE+I    C     + DIW LG  + ++L     F+
Sbjct: 200 ICSRF-------YRAPELI--IGCTQYTTQIDIWGLGCVMGEMLIGKAIFQ 241

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 76/167 (45%), Gaps = 22/167 (13%)

Query: 128 DGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEIL------KIMYDVSNAIAQMHYL 181
           D +   +I L++E C K  +     + + TK     +L      +I   V   +  +H+ 
Sbjct: 197 DDAKSRKIYLVLEYCSKGEIKWCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHF- 255

Query: 182 PTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRS 241
              +IHRDIK  N+L+ +D   K+ DFG  S+ F   S+   +  L        TP + +
Sbjct: 256 -QGIIHRDIKPANLLLSEDGIVKISDFG-VSLAFSSDSSTDSLNEL-ELAKTAGTPAFFA 312

Query: 242 PEM------IDLYRCLP------INEKSDIWALGIFLYKLLFYTTPF 276
           PE+      I  +   P      I+  +DIWA+GI L+ LLF   PF
Sbjct: 313 PEICLVEDTIKKFDLDPNSKEPIISFPTDIWAMGITLHCLLFGMLPF 359

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 13/146 (8%)

Query: 132 GFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIK 191
           G   L++ME CP     D+ N  ++ ++T+ E+      +   +  +H     L HRD+K
Sbjct: 335 GELFLVVMEYCP----YDFFNLVMSNQMTKHEVWCYFKQICRGVDYLHS--QGLAHRDLK 388

Query: 192 IENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCL 251
           ++N +V  D   KL DFGS      I+  +   + L     +  +  Y +PE++      
Sbjct: 389 LDNCVVTADGILKLIDFGSA-----IIFRYNFNSKLEPAKGIVGSDPYLAPELLTQLYYD 443

Query: 252 PINEKSDIWALGIFLYKLLFYTTPFE 277
           P    +D+W++ +  Y +     P++
Sbjct: 444 P--SAADVWSIAVMFYCMSLRRFPWK 467

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 67/144 (46%), Gaps = 18/144 (12%)

Query: 135 ILLLMELCPKKSLLDYMNNKL--ATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKI 192
           I + ME    KSL       L    +++E  + KI   V   ++ +H     +IHRDIK 
Sbjct: 254 IYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLSYLH--EKKVIHRDIKP 311

Query: 193 ENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP 252
           +N+L+++D   KLCDFG +      ++T       T   Y      Y +PE I   +  P
Sbjct: 312 QNILLNEDGQVKLCDFGVSGEAVNSLAT-----TFTGTSY------YMAPERI---QGQP 357

Query: 253 INEKSDIWALGIFLYKLLFYTTPF 276
            +   D+W+LG+ + ++     PF
Sbjct: 358 YSVTCDVWSLGLTILEVAQGHFPF 381

>Scas_713.7
          Length = 983

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 88/199 (44%), Gaps = 26/199 (13%)

Query: 78  KAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILL 137
           K   I  +K V   +++ L E+  E++ +K L    NIV+Y       H        + +
Sbjct: 47  KTLQIVAIKEVNYDNDDELIEIMTEIDLLKNLN-HVNIVKY-------HGFIQKSSNLYI 98

Query: 138 LMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLV 197
           ++E C K SL + +       + E +    +    N +  +H     +IHRDIK  N+L+
Sbjct: 99  ILEFCSKGSLKNLLTG-YKDGIPELDAKVYIRQTLNGLVYLH--EQGVIHRDIKAANLLL 155

Query: 198 DKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKS 257
           D +D  KL DFG        VST      +T    +  +  + SPE+I       +   S
Sbjct: 156 DSNDVVKLADFG--------VSTKVSNTAMT----LAGSLHWMSPEIIGNRGASTL---S 200

Query: 258 DIWALGIFLYKLLFYTTPF 276
           DIW+LG  + +L+    PF
Sbjct: 201 DIWSLGATVVELVTGNPPF 219

>Scas_635.1
          Length = 378

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 67/145 (46%), Gaps = 20/145 (13%)

Query: 137 LLMELCPKKSLLD---YMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIE 193
           L ME  P+   ++   Y +NK+   L   ++    Y ++  +  +H L   + HRDIK  
Sbjct: 117 LAMECLPETLQIEISRYAHNKMELALKHVKLYS--YQIARGMLYLHALG--ICHRDIKPS 172

Query: 194 NVLVDKDDN-FKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLP 252
           N+LVD +    K+CDFGS           + + +   +I    +  YR+PE+I    C  
Sbjct: 173 NILVDPNTGVLKICDFGSA----------KRLEINQPSISYICSRFYRAPELI--LGCTQ 220

Query: 253 INEKSDIWALGIFLYKLLFYTTPFE 277
              + DIW LG  + ++L     F+
Sbjct: 221 YTTQVDIWGLGCVIGEMLLGKAIFQ 245

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,028,841
Number of extensions: 1115419
Number of successful extensions: 3765
Number of sequences better than 10.0: 615
Number of HSP's gapped: 3420
Number of HSP's successfully gapped: 633
Length of query: 801
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 691
Effective length of database: 12,788,129
Effective search space: 8836597139
Effective search space used: 8836597139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)