Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18590g59658729750.0
AGR028C5794599371e-119
YBR060C (ORC2)6204158731e-109
Kwal_27.109415954868511e-106
CAGL0H10230g5144918191e-102
Scas_718.477304277872e-95
Scas_527.5*358234701.7
CAGL0I00660g65749701.9
AEL006W249143667.7
Kwal_55.2072986259659.2
Kwal_27.1077693252659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18590g
         (587 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces...  1150   0.0  
AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH] (766480..76...   365   e-119
YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin reco...   340   e-109
Kwal_27.10941                                                         332   e-106
CAGL0H10230g complement(1000574..1002118) similar to sp|P32833 S...   320   e-102
Scas_718.47                                                           307   2e-95
Scas_527.5*                                                            32   1.7  
CAGL0I00660g complement(48007..49980) highly similar to sp|P4694...    32   1.9  
AEL006W [2500] [Homologous to ScYBL004W - SH] complement(621384....    30   7.7  
Kwal_55.20729                                                          30   9.2  
Kwal_27.10776                                                          30   9.4  

>KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces
           cerevisiae YBR060c RRR1 origin recognition complex, 72
           kDa subunit singleton, start by similarity
          Length = 596

 Score = 1150 bits (2975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/587 (96%), Positives = 564/587 (96%)

Query: 1   MTKKECSDNXXXXXXXXXVNHQDIFISPSKVRYQSPKKLKSFDFLSPSKTVRPKSPKRSL 60
           MTKKECSDN         VNHQDIFISPSKVRYQSPKKLKSFDFLSPSKTVRPKSPKRSL
Sbjct: 1   MTKKECSDNEEEEEDIDIVNHQDIFISPSKVRYQSPKKLKSFDFLSPSKTVRPKSPKRSL 60

Query: 61  TLESVSIETEYKDEESRKHSSTDTAXXXXXXXXXXXXXXLEEDDAIDYVSDTNELIHNDD 120
           TLESVSIETEYKDEESRKHSSTDTA              LEEDDAIDYVSDTNELIHNDD
Sbjct: 61  TLESVSIETEYKDEESRKHSSTDTATPRRRQRKTTKRVKLEEDDAIDYVSDTNELIHNDD 120

Query: 121 EYEDLKIKIDSNESSPNKSPRRKLTFNAEPSPQRKTTRNTVQRNKIIDDDLAYDDIQQYK 180
           EYEDLKIKIDSNESSPNKSPRRKLTFNAEPSPQRKTTRNTVQRNKIIDDDLAYDDIQQYK
Sbjct: 121 EYEDLKIKIDSNESSPNKSPRRKLTFNAEPSPQRKTTRNTVQRNKIIDDDLAYDDIQQYK 180

Query: 181 HLKLNLNPNFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSKNSMSSA 240
           HLKLNLNPNFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSKNSMSSA
Sbjct: 181 HLKLNLNPNFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSKNSMSSA 240

Query: 241 PSISRDEYNILSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIGSKKKFL 300
           PSISRDEYNILSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIGSKKKFL
Sbjct: 241 PSISRDEYNILSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIGSKKKFL 300

Query: 301 ESFAFNFLSMKIALLQNPDIQKDDPCIPVFVMNGYTTLSKNIFLDIFKILVEGETIDDQG 360
           ESFAFNFLSMKIALLQNPDIQKDDPCIPVFVMNGYTTLSKNIFLDIFKILVEGETIDDQG
Sbjct: 301 ESFAFNFLSMKIALLQNPDIQKDDPCIPVFVMNGYTTLSKNIFLDIFKILVEGETIDDQG 360

Query: 361 QSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFRREHFQTRMSILAQIKQIC 420
           QSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFRREHFQTRMSILAQIKQIC
Sbjct: 361 QSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFRREHFQTRMSILAQIKQIC 420

Query: 421 VVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSKDSGTLFNANG 480
           VVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSKDSGTLFNANG
Sbjct: 421 VVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSKDSGTLFNANG 480

Query: 481 AKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAKSSSLNKITPGIEFSELFKTCTE 540
           AKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAKSSSLNKITPGIEFSELFKTCTE
Sbjct: 481 AKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAKSSSLNKITPGIEFSELFKTCTE 540

Query: 541 QFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYSYGDMEKM 587
           QFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYSYGDMEKM
Sbjct: 541 QFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYSYGDMEKM 587

>AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH]
           (766480..768219) [1740 bp, 579 aa]
          Length = 579

 Score =  365 bits (937), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 180/459 (39%), Positives = 287/459 (62%), Gaps = 26/459 (5%)

Query: 131 SNESSPNKSPRRKLTFNAEPSPQRKTTRNTVQRNKIIDDDLAYDDIQQYKHLKLNLNPNF 190
           +  S+P +SPRR+LTF++     RKT +           D+    +  +K     L+P F
Sbjct: 137 TARSTPLRSPRRQLTFSSPSKSPRKTRKQ----------DVLLAQVPSFK-----LDPGF 181

Query: 191 KPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSKNSMSSAPSISRDEYNI 250
            P  +PK     +  ++++  YFFDGFEG+IDQ K ++  K+S+NSM+ APS+SRDE+ +
Sbjct: 182 VPAAVPK---GYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVSRDEFRL 238

Query: 251 LSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIGSKKKFLESFAFNFLSM 310
           LS   N   H++    +    + LF Q+ FE++QGFTLLFYGIGSK++FLE+  F +LS 
Sbjct: 239 LSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLVFEYLSP 298

Query: 311 KIALLQNPDIQKDDPCIPVFVMNGYTTLS--KNIFLDIFKILVEGETIDDQGQSNYWDNR 368
           K+AL   P+   D   +P  V+NG+      ++ F  I   ++  E      ++ YW N 
Sbjct: 299 KLALSGAPE-GADVEGVPCVVINGFNPACNYRDCFQSIAAYMLPDEL--RHAETKYWHNH 355

Query: 369 IDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFRREHFQTRMSILAQIKQICVVASVDHI 428
           + LQ+ ++ +++  +PP V+M++L+HNLDGP  R++ FQ  +S LA+I+QI +VASVDHI
Sbjct: 356 VHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIRQIAIVASVDHI 415

Query: 429 QAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSKDSGTLFNANGAKYVLESL 488
            AP LW   RAQ +NFV+HD+TN+EPY +E    ++ +  ++      + + A+YVL SL
Sbjct: 416 HAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQES-VRLNRSELQAGSIDAARYVLASL 474

Query: 489 TDNSKRMYKILLQLLMGQINAKNESKPRAKSSSLNKITPGIEFSELFKTCTEQFVVSSEM 548
           T NSKR++++LL+ ++   N ++  + +  +S    I+ G+ FS  ++ C  QFV S+EM
Sbjct: 475 TANSKRLFRLLLETVVA--NMQSAKRIKLTNSRRAGISFGVPFSAFYQACAAQFVASNEM 532

Query: 549 GLRTILSEFIDHKMAVNTKNKMGKEIINVKYSYGDMEKM 587
            LR++L EF++HKMA   K+K G+EI+ V YS+G+M+K+
Sbjct: 533 SLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEMQKL 571

>YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin
           recognition complex, 72 kDa subunit, functions in
           pre-replication complex formation, which is essential
           for proper DNA replication initiation [1863 bp, 620 aa]
          Length = 620

 Score =  340 bits (873), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 177/415 (42%), Positives = 268/415 (64%), Gaps = 21/415 (5%)

Query: 183 KLNLNPNFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSKNSMSSAPS 242
           KL L+ NF PT +PK+    QTS+ +S   F D FEG+ DQ KI++T+ +S+++MS AP 
Sbjct: 209 KLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPD 268

Query: 243 ISRDEYNILSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIGSKKKFLES 302
           ++R+E++++S   N+ F +   + + +I + +F Q+ FEL QGF+LLFYG+GSK+ FLE 
Sbjct: 269 VTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEE 328

Query: 303 FAFNFLSMKIA---LLQNPDIQKDDPC--IPVFVMNGYTTLS--KNIFLDIFKILVEGET 355
           FA ++LS KIA   L    ++Q++ P   IP  ++NGY      +++F +I  +LV  E 
Sbjct: 329 FAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAEL 388

Query: 356 IDDQGQSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFRREHFQTRMSILAQ 415
              + ++ YW N + LQ+ ++  ++K +P  +K+IL++HNLDGPS R+  FQT +S L+ 
Sbjct: 389 T--RSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSV 446

Query: 416 IKQICVVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSKDSGTL 475
           I+QI +VAS DHI AP LWD+ +AQ++NFV+HDI+NFEP  VE+   D  +   K S T 
Sbjct: 447 IRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQD-VMKMGK-SDTS 504

Query: 476 FNANGAKYVLESLTDNSKRMYKILLQLL---MGQINAKNESKPRAKSSSLNKITPGIEFS 532
             A GAKYVL+SLT NSK+MYK+L++     MG ++A    K   + +       G+E  
Sbjct: 505 SGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRT-------GVELK 557

Query: 533 ELFKTCTEQFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYSYGDMEKM 587
                C   F+ S+E+ LR++L EFI+HKMA  TKN  G EII V Y+Y ++EK+
Sbjct: 558 LFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKL 612

>Kwal_27.10941
          Length = 595

 Score =  332 bits (851), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 174/486 (35%), Positives = 299/486 (61%), Gaps = 32/486 (6%)

Query: 124 DLKIKIDSNESSPNKS--PR--RKLTFNAEPSPQRK-TTRNT--VQRNKIIDDDL--AYD 174
           D KI   S  +SP++S  P+  RKLT   EP P+ +  T N+  ++ + +          
Sbjct: 113 DPKITTPSVNASPSRSISPQGPRKLT-KLEPVPESEFVTANSSPIKSSHVFSSPAKSPSK 171

Query: 175 DIQQYKHLKLNLNPNFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSK 234
            + +    K+ L+ +F PT +P  + + +   E+   YFFDGFEG+IDQ K L+  ++S 
Sbjct: 172 PVLKQSPFKIQLDRHFVPTPIPH-EGDYKPPQEKHLTYFFDGFEGYIDQKKPLRAHQKST 230

Query: 235 NSMSSAPSISRDEYNILSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIG 294
           N+M+ AP ++R+E+++LS    D  H+ + +A+ ++   +F Q+ FEL QGF+LLFYG+G
Sbjct: 231 NTMAMAPQVTREEFSLLSNTLIDSLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVG 290

Query: 295 SKKKFLESFAFNFLSMKIALL-----------QNPDIQKDDPCIPVFVMNGY--TTLSKN 341
           SK+ FLE F   +LS ++AL            +  D + +   +P  V+NGY  T   ++
Sbjct: 291 SKRSFLEEFVLQYLSPQLALSDALNFGTAEDSEAIDEESEIDGVPCVVINGYNPTCNYRD 350

Query: 342 IFLDIFKILVEGETIDDQGQSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSF 401
            F  I +I+++ E    + ++ YW N ++LQ++++ + ++  PP +K+I+L+HNLDGP  
Sbjct: 351 AFHSISQIMMQEEL--SKSETKYWGNHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMV 408

Query: 402 RREHFQTRMSILAQIKQICVVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQ 461
           R++ FQ  +S L++++QI ++AS D++ AP LWDH RAQ+FNF++HDITN++ Y VE+  
Sbjct: 409 RKDPFQNMLSSLSRVRQIALIASTDNLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSF 468

Query: 462 TDNAIDFSKDSGTLFNANGAKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAKSSS 521
           +D  +   + +GT   A GA+YVLESLT NSKRMYK+L++  +  ++++ ++    + S 
Sbjct: 469 SD-IMQLGRSAGTT-GAEGARYVLESLTSNSKRMYKLLIETQLSNMDSQGKAVANKRGSH 526

Query: 522 LNKITPGIEFSELFKTCTEQFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYSY 581
                 GIEF + +  C   F+ S+E+ LR++L EFI+HKMA  ++++ G E + + Y +
Sbjct: 527 AF----GIEFKQFYHMCAADFIASNEVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVH 582

Query: 582 GDMEKM 587
            +M+ +
Sbjct: 583 SEMQAL 588

>CAGL0H10230g complement(1000574..1002118) similar to sp|P32833
           Saccharomyces cerevisiae YBR060c RRR1 origin recognition
           complex, hypothetical start
          Length = 514

 Score =  320 bits (819), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/491 (37%), Positives = 292/491 (59%), Gaps = 38/491 (7%)

Query: 116 IHNDDEYEDLKIKIDSNESSPNKSPR--RKLTFNAE---PSPQRKTTRNTVQRNKIIDDD 170
           + +  EYE  ++  D       ++PR  RK+  + E    SP +K   N +  N+    D
Sbjct: 36  VESAGEYETPELTSDEENLVQLQTPRKRRKVNLSKEHDFTSPLKKVIMNNL--NEYKKSD 93

Query: 171 LAYDDIQQYKHLKLNLNPNFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTD 230
           LA          KL L+ +F  T++P+  + ++    ++   F D FEG+ +Q + ++  
Sbjct: 94  LAD---------KLKLSRDFVNTQVPRPADVEKLKANRAVTSFTDTFEGYFEQKRSVRGV 144

Query: 231 KRSKNSMSSAPSISRDEYNILSQLSNDIFHRSSTKAVQK----IHETLFQQFTFELLQGF 286
           K SKNS++ AP ++R+E+ ++S    +IFHR+  K ++     I + L+ Q+ FE++QGF
Sbjct: 145 KVSKNSITMAPHVTREEFGLIS----NIFHRNLHKNLRDHLYIIQKKLYPQYWFEVIQGF 200

Query: 287 TLLFYGIGSKKKFLESFAFNFLSMKIALLQNPDIQKDDP------CIPVFVMNGY--TTL 338
           +LLFYGIGSKK FLE F F +LS K+AL Q  ++   +        IPV V+NGY  T  
Sbjct: 201 SLLFYGIGSKKVFLEDFVFKYLSPKLALSQAIEVPTYNGKKSKFEGIPVVVVNGYNPTCN 260

Query: 339 SKNIFLDIFKILVEGETIDDQGQSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDG 398
            +++F DI  +L   E    Q +S +W N + + + +L  Y+K +P  +K+I+ IHN+DG
Sbjct: 261 YRDVFKDILSLLTPAELT--QSESKFWGNHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDG 318

Query: 399 PSFRREHFQTRMSILAQIKQICVVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVE 458
           P+ RR    T +S L+ I+Q+ +VAS DHI APFLWD+ RAQ++NFV+HD+TN+ PY  E
Sbjct: 319 PNIRRGDSPTILSFLSLIRQVAIVASADHIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAE 378

Query: 459 TVQTDNAIDFSKDSGTLFNANGAKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAK 518
           +   D  +   K   +   A GAKYVL+SLT NSK+MYK+L++  +  +   + +K   K
Sbjct: 379 SSFQD-VMRLGKSENST-GAEGAKYVLQSLTLNSKKMYKLLIETQLQHMEKVSTTKSTGK 436

Query: 519 --SSSLNKITPGIEFSELFKTCTEQFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIIN 576
             +S    ++ G+EF +L   C   F+ S+EM LR++L+EFI+HKMA  +KN +G E + 
Sbjct: 437 VAASKRGTMSMGVEFKQLVHLCAADFIASNEMALRSMLTEFIEHKMASVSKNTVGTEFVW 496

Query: 577 VKYSYGDMEKM 587
           V Y+Y +M+++
Sbjct: 497 VPYTYAEMKRL 507

>Scas_718.47
          Length = 730

 Score =  307 bits (787), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 174/427 (40%), Positives = 267/427 (62%), Gaps = 27/427 (6%)

Query: 183 KLNLNPNFKPTKLPKSDNND---QTSDEQSQIYFFDGFEGFIDQ-TKILK-TDKRSKNSM 237
           KL LN  F PT++PK+D  +   + S+ +S   FFD FEG+ DQ +  LK T K SKN+M
Sbjct: 300 KLVLNREFVPTQVPKTDKYEKRLEASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTM 359

Query: 238 SSAPSISRDEYNILSQLSNDIFHRSSTKAVQKIHETLFQQFTFELLQGFTLLFYGIGSKK 297
           S  PS+S+DE+ + + + N  + +     +Q +   +F Q+ FE+ QGF+LLFYGIGSK+
Sbjct: 360 SMGPSVSKDEFAMFTNVFNKHYLKEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKR 419

Query: 298 KFLESFAFNFLSMKIALLQNPDIQKDDPC------------IPVFVMNGY--TTLSKNIF 343
            FLE  A  ++S K+   +   +QK+               IP  ++NGY  T   + IF
Sbjct: 420 NFLEDLAIKYISPKLTFGKRIALQKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIF 479

Query: 344 LDIFKILV-EGETIDDQGQSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFR 402
            DI  I+  +G T   + ++ +W N   LQ+ ++ +++  +P  +K+IL+IHNLDGP+ R
Sbjct: 480 QDITDIMFPDGLT---RNETKFWGNLAILQVQKMIEFYSTQPKDIKLILVIHNLDGPALR 536

Query: 403 REHFQTRMSILAQIKQICVVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQT 462
           +E FQT  S LAQIKQI ++ASVDHI AP L+D+ +AQ++NFV+HD+TN+E   VE+   
Sbjct: 537 KEIFQTIFSSLAQIKQIVLIASVDHIYAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQ 596

Query: 463 DNAIDFSKDSGTLFNANGAKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAKSSSL 522
           D  ++  K S +   A GAKYVLESLT N+K+MYK+LL L +  ++  + SK ++ SS  
Sbjct: 597 DK-MNLGKSS-SSSGAEGAKYVLESLTLNAKKMYKLLLDLQLNNMDLASGSKNKSASSVS 654

Query: 523 NK--ITPGIEFSELFKTCTEQFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYS 580
            +  ++ G+EF      C  +F+ S+E+ LRT+L+EFI+HKM + +++  G E + V Y 
Sbjct: 655 KRGGLSTGVEFKSFVTMCASEFIASNEISLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYR 714

Query: 581 YGDMEKM 587
           Y +MEK+
Sbjct: 715 YSEMEKI 721

>Scas_527.5*
          Length = 358

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 92/234 (39%), Gaps = 44/234 (18%)

Query: 288 LLFYGIGSKKKFLESFAFNFLSMKIALLQNPDIQKDDPCIPVF-----VMNGYTTLSKNI 342
           +L  G+     FL+S  F  L+   +        K   C  VF     +   Y   + N 
Sbjct: 12  VLLMGLRRYAHFLQSSCFIILTSTSSFFHR--CGKSSICKVVFHNMQPLDTLYLESTSNP 69

Query: 343 FLDIFKILVEGETIDDQGQSNYWDNRIDLQ-------------------------MDRLS 377
           +L+ F  L++   ++  GQ NY++   D +                         +  + 
Sbjct: 70  YLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYMNAITNLAMIM 129

Query: 378 KYFKKRPPTVKMILLIHNLDGPSFRREHFQ--TRMSILAQIKQICVVASVDHIQAPF--- 432
           +Y  K  P + + +LIH +DG S   E F+   +  I+ +  +  +   +D +Q  F   
Sbjct: 130 EYAYKVNPAINVEVLIHKVDGLS---EDFKADAQREIMQRTGEELLELGLDGVQVSFYLT 186

Query: 433 -LWDHFRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSK-DSGTLFNANGAKYV 484
            ++DH   ++F+ +   +     Y+   +  DN I  SK D   LF+ N   YV
Sbjct: 187 SIFDHSIYEAFSRIIQKLIPEISYLENML--DNLIQHSKIDKAFLFDINSKIYV 238

>CAGL0I00660g complement(48007..49980) highly similar to sp|P46943
           Saccharomyces cerevisiae YLR289w GUF1, start by
           similarity
          Length = 657

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 23/49 (46%)

Query: 437 FRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSKDSGTLFNANGAKYVL 485
            +AQ+    YHD  N E Y++  V T   +DF  +    + + G   +L
Sbjct: 108 IKAQTCTMFYHDKRNGEDYLLHLVDTPGHVDFRGEVSRSYASCGGALLL 156

>AEL006W [2500] [Homologous to ScYBL004W - SH]
           complement(621384..628859) [7476 bp, 2491 aa]
          Length = 2491

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%)

Query: 270 IHETLFQQFTFELLQGFTLLFYGIGSKKKFLESFAFNFLSMKI 312
           I + L +QFT +L+  FT+LF  +  KK+++  FA   LS  I
Sbjct: 158 IFKYLSRQFTQDLIPTFTMLFPLLSHKKEYMSRFAAEALSFLI 200

>Kwal_55.20729
          Length = 862

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 167 IDDDLAYDDIQQYKHLKL-NLNPNFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQT 224
           +D+DL  D I++ KHL+  NLN       L + D     +++   +Y++ G E  ++ +
Sbjct: 726 VDEDLEIDGIKKPKHLRYQNLNTTTNDNILARGDLVPSAAEDYLDLYYYGGDEDIVNNS 784

>Kwal_27.10776
          Length = 932

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 23/52 (44%)

Query: 109 VSDTNELIHNDDEYEDLKIKIDSNESSPNKSPRRKLTFNAEPSPQRKTTRNT 160
           +S  +  +H DDEY   ++ + S        PR   T N  P+ +  T + T
Sbjct: 1   MSSGSRALHMDDEYGGQQLYVASGAPQAQGEPRNTATLNGRPAARLPTAQQT 52

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,595,960
Number of extensions: 903292
Number of successful extensions: 3902
Number of sequences better than 10.0: 87
Number of HSP's gapped: 4019
Number of HSP's successfully gapped: 88
Length of query: 587
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 480
Effective length of database: 12,891,983
Effective search space: 6188151840
Effective search space used: 6188151840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)