Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18568g1121116022e-82
AGR029W1121115197e-70
Kwal_27.109391101114911e-65
YDR045C (RPC11)1101114867e-65
Scas_569.4*1101114869e-65
Sklu_2357.91021014599e-61
CAGL0H08415g1001014214e-55
KLLA0F09361g2921041174e-08
KLLA0D03234g1221101117e-08
AFR417W1251201082e-07
Scas_621.15307351112e-07
YJR063W (RPA12)125411073e-07
CAGL0D06160g306351103e-07
YGL043W (DST1)309351104e-07
AGR011W3041041104e-07
Sklu_2213.5287351104e-07
Kwal_26.7521301351095e-07
Scas_673.30*148411066e-07
KLLA0B13860g160721067e-07
Kwal_27.9972125411047e-07
Sklu_2119.4125521031e-06
Kwal_56.24054122110979e-06
CAGL0F00561g12865961e-05
YGL070C (RPB9)122110933e-05
Scas_720.22*122110917e-05
CAGL0H03509g122110908e-05
AFL088W122111882e-04
Sklu_1830.311060730.020
Scas_238.163139670.25
Scas_586.712693620.74
Scas_544.7d17345592.6
YHR165C (PRP8)241339593.4
KLLA0C03564g139979575.3
KLLA0C09735g78448567.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18568g
         (111 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18568g complement(1708319..1708657) highly similar to sp|Q...   236   2e-82
AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH] complement...   204   7e-70
Kwal_27.10939                                                         193   1e-65
YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA polyme...   191   7e-65
Scas_569.4*                                                           191   9e-65
Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement      181   9e-61
CAGL0H08415g 824631..824933 highly similar to sp|Q04307 Saccharo...   166   4e-55
KLLA0F09361g complement(864425..865303) similar to sp|P07273 Sac...    50   4e-08
KLLA0D03234g 270311..270679 highly similar to sp|P27999 Saccharo...    47   7e-08
AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH] complement...    46   2e-07
Scas_621.15                                                            47   2e-07
YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I s...    46   3e-07
CAGL0D06160g complement(580707..581627) highly similar to sp|P07...    47   3e-07
YGL043W (DST1) [1934] chr7 (417485..418414) Transcription elonga...    47   4e-07
AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH] complement(...    47   4e-07
Sklu_2213.5 YGL043W, Contig c2213 7532-8395                            47   4e-07
Kwal_26.7521                                                           47   5e-07
Scas_673.30*                                                           45   6e-07
KLLA0B13860g 1215461..1215943 some similarities with sp|P32529 S...    45   7e-07
Kwal_27.9972                                                           45   7e-07
Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement         44   1e-06
Kwal_56.24054                                                          42   9e-06
CAGL0F00561g complement(58585..58971) highly similar to sp|P3252...    42   1e-05
YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA polyme...    40   3e-05
Scas_720.22*                                                           40   7e-05
CAGL0H03509g complement(326276..326644) highly similar to sp|P27...    39   8e-05
AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH] complement(...    39   2e-04
Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement         33   0.020
Scas_238.1                                                             30   0.25 
Scas_586.7                                                             28   0.74 
Scas_544.7d                                                            27   2.6  
YHR165C (PRP8) [2452] chr8 complement(429707..436948) U5 snRNA-a...    27   3.4  
KLLA0C03564g complement(323354..327553) some similarities with s...    27   5.3  
KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyce...    26   7.6  

>KLLA0F18568g complement(1708319..1708657) highly similar to
           sp|Q04307 Saccharomyces cerevisiae YDR045c RPC11 RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination singleton, start
           by similarity
          Length = 112

 Score =  236 bits (602), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 111/111 (100%), Positives = 111/111 (100%)

Query: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60
           MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA
Sbjct: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60

Query: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111
           WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE
Sbjct: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111

>AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH]
           complement(768240..768578) [339 bp, 112 aa]
          Length = 112

 Score =  204 bits (519), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 91/111 (81%), Positives = 100/111 (90%)

Query: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60
           MLSFCP CNNML VSK DSG+Y+L C SCPY+F I+G+E+YDR+NLPRKEVDDVLGGEGA
Sbjct: 1   MLSFCPYCNNMLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGA 60

Query: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111
           WDNVDQTA QCP H+ C GE+AYFFQLQIRSADEPMTTFYKCV CGHKWRE
Sbjct: 61  WDNVDQTAVQCPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWRE 111

>Kwal_27.10939
          Length = 110

 Score =  193 bits (491), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 2/111 (1%)

Query: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60
           MLSFCP C+NML+VS A+SG Y L CGSCPY F I+G+EVYDRK LPRKEVDDVLGG   
Sbjct: 1   MLSFCPTCHNMLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGG--G 58

Query: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111
           WDNVDQTA QCPN+DQCAGERAYFFQLQIRSADEPMTTFYKCV+CG++WRE
Sbjct: 59  WDNVDQTAVQCPNYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWRE 109

>YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination [333 bp, 110 aa]
          Length = 110

 Score =  191 bits (486), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 96/111 (86%), Gaps = 2/111 (1%)

Query: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60
           MLSFCP CNNMLL++  DSG+Y LAC SCPY+F I+GIE+YDRK LPRKEVDDVLGG   
Sbjct: 1   MLSFCPSCNNMLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGG--G 58

Query: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111
           WDNVDQT  QCPN+D C GE AYFFQLQIRSADEPMTTFYKCVNCGH+W+E
Sbjct: 59  WDNVDQTKTQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109

>Scas_569.4*
          Length = 110

 Score =  191 bits (486), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 2/111 (1%)

Query: 1   MLSFCPLCNNMLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGA 60
           MLSFCPLCNNMLL++ ADSG+Y L C SCPY+F I+GIE+YDRK LPRKEVDDVLGG   
Sbjct: 1   MLSFCPLCNNMLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGG--G 58

Query: 61  WDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111
           WDNVDQT  QCPN+++C GE AYFFQLQIRSADEPMTTFYKCVNC H+W+E
Sbjct: 59  WDNVDQTKVQCPNYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 109

>Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement
          Length = 102

 Score =  181 bits (459), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 89/101 (88%)

Query: 11  MLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGAWDNVDQTAAQ 70
           MLL++  D+G+YKL C SCPY+F I+GIEVYDRK L RKEVDDVLGGEGAWDNVDQT AQ
Sbjct: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60

Query: 71  CPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111
           CPNHD C G +AYFFQLQIRSADEPMTTFYKCV CGHKWRE
Sbjct: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWRE 101

>CAGL0H08415g 824631..824933 highly similar to sp|Q04307
           Saccharomyces cerevisiae YDR045c RPC11, start by
           similarity
          Length = 100

 Score =  166 bits (421), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 2/101 (1%)

Query: 11  MLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGAWDNVDQTAAQ 70
           MLLV+ +D+G+Y L+C SCPY+F I+ IE+YDRK LPRKEVDDVLGG   WDNVDQT  Q
Sbjct: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGG--GWDNVDQTKVQ 58

Query: 71  CPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111
           CPN+D C GE AYFFQLQIRSADEPMTTFYKCVNC H+W+E
Sbjct: 59  CPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99

>KLLA0F09361g complement(864425..865303) similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS
           (transcription elongation factor) singleton, start by
           similarity
          Length = 292

 Score = 49.7 bits (117), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 8/104 (7%)

Query: 13  LVSKADSGL-YKLACGSCPYQFLI-----DGIEVYDRKNLPRKEVDDVLGGEGAWDNVDQ 66
           ++SK +  L +++  G    + L+     D    + +K +   E  ++   +GA   V++
Sbjct: 189 IISKNNPDLKHRITNGEVSAKHLVTADPKDLAPEHLKKKIEEIEKQNLFNAQGA--TVER 246

Query: 67  TAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +        +C   +  ++QLQ RSADEP+TTF  C NCG++W+
Sbjct: 247 SVTDRFQCGKCKQRKVSYYQLQTRSADEPLTTFCTCENCGNRWK 290

>KLLA0D03234g 270311..270679 highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9 DNA-directed RNA
           polymerase II, 14. 2 KD subunit singleton, start by
           similarity
          Length = 122

 Score = 47.4 bits (111), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 48/110 (43%), Gaps = 9/110 (8%)

Query: 2   LSFCPLCNNMLLVSKADSGLYKL--ACGSCPYQFLIDGIEVYDRKNLPRK--EVDDVLGG 57
             FC  CNNML   + D   +KL   C +CPY        VY R  L     E   V+  
Sbjct: 4   FRFCRDCNNMLY-PREDKETHKLLFECRTCPYVEEAGTPLVY-RHELKTNIGETAGVVQD 61

Query: 58  EGAWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGH 107
            G+   + ++  +CP   +C      FFQ Q R  D  M  FY C++C H
Sbjct: 62  IGSDPTLPRSDKECP---KCHSRENVFFQSQQRRKDTSMVLFYVCLHCSH 108

>AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH]
           complement(1184595..1184972) [378 bp, 125 aa]
          Length = 125

 Score = 46.2 bits (108), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 15/120 (12%)

Query: 2   LSFCPLCNNMLLVSKADSGLYKLACGSCPYQF-----------LIDGIEVYDRKNLPRKE 50
           L FC  C N+L    A +G + +AC  C  Q+                + +      ++ 
Sbjct: 7   LIFCVYCGNLLDNPSAVAGDH-VACALCDAQYDKATFSNLKVVTATADDAFPSALRAKRS 65

Query: 51  VDDVLGGEGAWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           V      +G  ++      +CP   QC  +   +  LQ+RSADE  T FY C +CG+++R
Sbjct: 66  VVKTTLRKGELEDGATIREKCP---QCGHDEMQYHTLQLRSADEGATVFYTCTSCGYRFR 122

>Scas_621.15
          Length = 307

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 26/35 (74%)

Query: 76  QCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +C  ++  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 271 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 305

>YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I
           subunit A12.2 [378 bp, 125 aa]
          Length = 125

 Score = 45.8 bits (107), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 70  QCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +CP   QC  E   +  LQ+RSADE  T FY C +CG+K+R
Sbjct: 85  KCP---QCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFR 122

>CAGL0D06160g complement(580707..581627) highly similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS, start by
           similarity
          Length = 306

 Score = 47.0 bits (110), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 26/35 (74%)

Query: 76  QCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +C  ++  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 270 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 304

>YGL043W (DST1) [1934] chr7 (417485..418414) Transcription
           elongation factor S-II, a DNA strand transfer protein
           catalyzing homologous DNA strand exchange [930 bp, 309
           aa]
          Length = 309

 Score = 47.0 bits (110), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 26/35 (74%)

Query: 76  QCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +C  ++  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 273 KCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

>AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH]
           complement(737606..738520) [915 bp, 304 aa]
          Length = 304

 Score = 47.0 bits (110), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 13  LVSKADSGL-YKLACGSCPYQFLI--DGIEV---YDRKNLPRKEVDDVLGGEGAWDNVDQ 66
           ++SK +  L +K+  G    ++L+  D  E+   + RK L      ++   +GA   +++
Sbjct: 201 VISKNNRDLKHKITNGDITPEYLVNCDPKELAPEHLRKKLEEIAKQNLFNAQGA--TLER 258

Query: 67  TAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +        +C  ++  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 259 SVTDRFQCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 302

>Sklu_2213.5 YGL043W, Contig c2213 7532-8395
          Length = 287

 Score = 47.0 bits (110), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 26/35 (74%)

Query: 76  QCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +C  ++  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 251 KCKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 285

>Kwal_26.7521
          Length = 301

 Score = 46.6 bits (109), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 26/35 (74%)

Query: 76  QCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +C  ++  ++QLQ RSADEP+TTF  C  CG++W+
Sbjct: 265 KCKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 299

>Scas_673.30*
          Length = 148

 Score = 45.4 bits (106), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 70  QCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +CP   QC  +  ++  LQ+RSADE  T FY C  CG+K+R
Sbjct: 108 KCP---QCGNDEMHYHTLQLRSADEGATVFYTCTKCGYKFR 145

>KLLA0B13860g 1215461..1215943 some similarities with sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, 13. 7 KD subunit singleton, hypothetical
           start
          Length = 160

 Score = 45.4 bits (106), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 8/72 (11%)

Query: 39  EVYDRKNLPRKEVDDVLGGEGAWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTT 98
           ++  +K+L +  +      +GA  N      +CP   +CA ++ ++  LQ+RSADE  T 
Sbjct: 94  KIRSKKSLVKTSIAKNELKDGAIIN-----EKCP---KCANDKMHYHTLQLRSADEGATV 145

Query: 99  FYKCVNCGHKWR 110
           FY C  CG+++R
Sbjct: 146 FYTCTACGYRFR 157

>Kwal_27.9972
          Length = 125

 Score = 44.7 bits (104), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 70  QCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           +CP   QC  +  ++  LQ+RSADE  T FY C +CG+++R
Sbjct: 85  KCP---QCGNDEMHYHTLQLRSADEGATVFYTCTSCGYRFR 122

>Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement
          Length = 125

 Score = 44.3 bits (103), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 6/52 (11%)

Query: 62  DNVDQTAA---QCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWR 110
           D +D+ A    +CP   QC  +   +  LQ+RSADE  T FY C +CG+++R
Sbjct: 74  DELDEGATIKEKCP---QCGNDEMRYHTLQLRSADEGATVFYTCTSCGYRFR 122

>Kwal_56.24054
          Length = 122

 Score = 42.0 bits (97), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 5/110 (4%)

Query: 2   LSFCPLCNNMLLVSK-ADSGLYKLACGSCPYQFLIDGIEVYDRKNLPR-KEVDDVLGGEG 59
             FC  CNNML   +  D+      C +C Y        VY  + +    E   V+   G
Sbjct: 4   FRFCRDCNNMLYPREDKDNQRLLFECRTCTYAEEAGTPMVYRHELITNIGETAGVVQDIG 63

Query: 60  AWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKW 109
           +   + ++  +CP   +C      FFQ Q R +D  M  F+ C+ C H +
Sbjct: 64  SDPTLPRSDRECP---KCHSHENVFFQSQQRRSDTSMVLFFVCLGCSHIF 110

>CAGL0F00561g complement(58585..58971) highly similar to sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, start by similarity
          Length = 128

 Score = 41.6 bits (96), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 46  LPRKEVDDVLGGEGAWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNC 105
           L R  V   L  +   D+      +CP   +C  +   +  LQ+RSADE  T FY C+ C
Sbjct: 64  LKRSVVKTHLKRDELKDDGATIKEKCP---KCGHDEMRYQTLQLRSADEGATVFYTCIKC 120

Query: 106 GHKWR 110
            +K+R
Sbjct: 121 NYKYR 125

>YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA
           polymerase II, non-essential subunit, involved in
           transcription start site selection [369 bp, 122 aa]
          Length = 122

 Score = 40.4 bits (93), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 5/110 (4%)

Query: 2   LSFCPLCNNMLLVSK-ADSGLYKLACGSCPYQFLIDGIEVYDRKNLPR-KEVDDVLGGEG 59
             FC  CNNML   +  ++      C +C Y        VY  + +    E   V+   G
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIG 63

Query: 60  AWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKW 109
           +   + ++  +CP   +C      FFQ Q R  D  M  F+ C++C H +
Sbjct: 64  SDPTLPRSDRECP---KCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIF 110

>Scas_720.22*
          Length = 122

 Score = 39.7 bits (91), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 5/110 (4%)

Query: 2   LSFCPLCNNMLLVSK-ADSGLYKLACGSCPYQFLIDGIEVYDRKNLPR-KEVDDVLGGEG 59
             FC  CNNML   +  ++      C +C Y        VY  + +    E   V+   G
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGAPLVYRHELITNIGETAGVVQDIG 63

Query: 60  AWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKW 109
           +   + ++  +CP   +C      FFQ Q R  D  M  F+ C+ C H +
Sbjct: 64  SDPTLPRSDRECP---RCHARDNVFFQSQQRRKDTSMVLFFVCLQCSHIF 110

>CAGL0H03509g complement(326276..326644) highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9, start by
           similarity
          Length = 122

 Score = 39.3 bits (90), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 5/110 (4%)

Query: 2   LSFCPLCNNMLLVSK-ADSGLYKLACGSCPYQFLIDGIEVYDRKNLPR-KEVDDVLGGEG 59
             FC  CNNML   +  ++      C +C Y        VY  + +    E   V+   G
Sbjct: 4   FRFCRDCNNMLYPREDKENNRLLFECRTCSYIEEAGSPLVYRHELITNIGETAGVVQDIG 63

Query: 60  AWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKW 109
           +   + ++  +CP   +C      FFQ Q R  D  M  F+ C+ C H +
Sbjct: 64  SDPTLPRSDRECP---KCHSRENVFFQSQQRRKDTSMVLFFVCLACSHIF 110

>AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH]
           complement(276175..276543) [369 bp, 122 aa]
          Length = 122

 Score = 38.5 bits (88), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 2   LSFCPLCNNMLLVSKADSGLYKL--ACGSCPYQFLIDGIEVYDRKNLPR-KEVDDVLGGE 58
             FC  CNNML   + D    +L   C +C Y        VY  + +    E   V+   
Sbjct: 4   FRFCRDCNNMLY-PREDKEEQRLLFECRTCTYAEEAGTPLVYRHELITNIGETAGVVQDI 62

Query: 59  GAWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKW 109
           G+   + ++  +CP   +C      FFQ Q R  D  M  F+ C+ C H +
Sbjct: 63  GSDPTLPRSDRECP---RCHSHDNVFFQSQQRRRDTSMVLFFVCLGCSHIF 110

>Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement
          Length = 110

 Score = 32.7 bits (73), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 50  EVDDVLGGEGAWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKW 109
           E   V+   G+   + ++  +CP   +C      FFQ Q R  D  M  F+ C+ C H +
Sbjct: 42  ETAGVVQDIGSDPTLPRSDRECP---KCHSHENVFFQSQQRRKDTSMVLFFVCLACSHIF 98

>Scas_238.1
          Length = 631

 Score = 30.4 bits (67), Expect = 0.25,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 4/39 (10%)

Query: 33  FLIDGIEVYDRKNLPRKEVDDVLG-GEGAWDNVDQTAAQ 70
           F + G EV   + LP++ +D+V+   EG WD +D+T+ Q
Sbjct: 478 FTMCGFEV---RILPKQRMDEVISTDEGVWDLIDETSKQ 513

>Scas_586.7
          Length = 126

 Score = 28.5 bits (62), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 18/93 (19%)

Query: 13  LVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPR-KEVDDVLGGEGAWDNVDQ----T 67
           LVSKA      + C       ++  + + + KNL   K + D L GEG+ DNV Q    T
Sbjct: 16  LVSKATFATTSVRCN------VMQDLYLKELKNLQNDKTMMDALAGEGSLDNVKQWHNPT 69

Query: 68  AAQCPN-------HDQCAGERAYFFQLQIRSAD 93
           A + P+        D  + ++     LQ  SAD
Sbjct: 70  APKVPSSLTEVNAQDMDSYKKQKIETLQTTSAD 102

>Scas_544.7d
          Length = 173

 Score = 27.3 bits (59), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 3/45 (6%)

Query: 5   CPLCNNMLLVSKADSGL---YKLACGSCPYQFLIDGIEVYDRKNL 46
           CP C   L V  A S     YK  C  C Y ++   + V D +++
Sbjct: 61  CPNCETALTVLLAKSSRKKRYKFTCKHCDYDYVTPSMSVTDERSI 105

>YHR165C (PRP8) [2452] chr8 complement(429707..436948) U5
            snRNA-associated splicing factor, involved in association
            of U5 snRNP with U4/U6 snRNP and promotes both catalytic
            steps of splicing [7242 bp, 2413 aa]
          Length = 2413

 Score = 27.3 bits (59), Expect = 3.4,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 4/39 (10%)

Query: 33   FLIDGIEVYDRKNLPRKEVDDVLGG-EGAWDNVDQTAAQ 70
            F + G EV   + LPR+ +++V+   EG WD VD+   Q
Sbjct: 1260 FSMCGFEV---RILPRQRMEEVVSNDEGVWDLVDERTKQ 1295

>KLLA0C03564g complement(323354..327553) some similarities with
            sp|P25357 Saccharomyces cerevisiae YCR033w singleton,
            hypothetical start
          Length = 1399

 Score = 26.6 bits (57), Expect = 5.3,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 30   PYQFLIDGIEVYDRKNLPRKEVDDVLGGEGAWDNVDQTAAQCPNHDQCAGERAYFFQLQI 89
            PY+ ++  +     K++  + V +    +  +DN   T +     D+ + + + + Q  +
Sbjct: 930  PYEDIVPMLADMTSKSVINESVKNADHADIGFDN---TESHLKPEDEVSSKHSLYDQSNV 986

Query: 90   RSADEPMTTFYKCVNCGHK 108
             SAD+PM    K     HK
Sbjct: 987  NSADQPMKKKLKQTEAVHK 1005

>KLLA0C09735g 841867..844221 similar to sgd|S0005782 Saccharomyces
           cerevisiae YOR256c, start by similarity
          Length = 784

 Score = 26.2 bits (56), Expect = 7.6,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 13/48 (27%)

Query: 52  DDVLGGEGAWDNVDQTAAQCPNHDQCAGERAYFFQLQIRSADEPMTTF 99
           +++ G EGAW+ V  T               Y +++ +R  DEP+  F
Sbjct: 592 EEIKGTEGAWEQVADTL-------------IYTYEMLLRLIDEPLLPF 626

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.464 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,642,488
Number of extensions: 133643
Number of successful extensions: 277
Number of sequences better than 10.0: 34
Number of HSP's gapped: 273
Number of HSP's successfully gapped: 34
Length of query: 111
Length of database: 16,596,109
Length adjustment: 81
Effective length of query: 30
Effective length of database: 13,792,051
Effective search space: 413761530
Effective search space used: 413761530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)