Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18546g37536919080.0
Sklu_2357.834132813610.0
Kwal_27.1093534432613410.0
YDR044W (HEM13)32831013210.0
Scas_569.333331212911e-179
CAGL0K12100g32731112211e-169
AGR030C32431812111e-167
Scas_707.2162030672.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18546g
         (369 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1 Kluyver...   739   0.0  
Sklu_2357.8 YDR044W, Contig c2357 11533-12558                         528   0.0  
Kwal_27.10935                                                         521   0.0  
YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen I...   513   0.0  
Scas_569.3                                                            501   e-179
CAGL0K12100g 1183383..1184366 highly similar to sp|P11353 Saccha...   474   e-169
AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH] (768609..7...   471   e-167
Scas_707.21                                                            30   2.5  

>KLLA0F18546g 1706744..1707871 gi|26185795|emb|CAD58624.1
           Kluyveromyces lactis putative coproporphyrinogen
           oxidase, start by similarity
          Length = 375

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/369 (95%), Positives = 354/369 (95%)

Query: 1   MRREALDLYCPFLSNQAESLIKLYIQYTCLVKQTETQRPVHLNTHSKYYHCAMTDSQVPI 60
           MRREALDLYCPFLSNQAESLIKLYIQYTCLVKQTETQRPVHLNTHSKYYHCAMTDSQVPI
Sbjct: 1   MRREALDLYCPFLSNQAESLIKLYIQYTCLVKQTETQRPVHLNTHSKYYHCAMTDSQVPI 60

Query: 61  RERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKGGVNVS 120
           RERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKGGVNVS
Sbjct: 61  RERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKGGVNVS 120

Query: 121 VVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHAPTTHL 180
           VVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHAPTTHL
Sbjct: 121 VVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHAPTTHL 180

Query: 181 NYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYPKYKKW 240
           NYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYPKYKKW
Sbjct: 181 NYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYPKYKKW 240

Query: 241 CDEYFYIKHREETXXXXXXXXXXXXXXXPNEILQMVENCFDAFLPSYLEIIKRRKDMPYT 300
           CDEYFYIKHREET               PNEILQMVENCFDAFLPSYLEIIKRRKDMPYT
Sbjct: 241 CDEYFYIKHREETRGIGGIFFDDVDDRDPNEILQMVENCFDAFLPSYLEIIKRRKDMPYT 300

Query: 301 EEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHPEVDSR 360
           EEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHPEVDSR
Sbjct: 301 EEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHPEVDSR 360

Query: 361 EDKLLQVLK 369
           EDKLLQVLK
Sbjct: 361 EDKLLQVLK 369

>Sklu_2357.8 YDR044W, Contig c2357 11533-12558
          Length = 341

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/328 (75%), Positives = 274/328 (83%)

Query: 42  LNTHSKYYHCAMTDSQVPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGG 101
           +  HS           +PIR++ME L+ RKQ+EITKGLETLDTVKF+ADSW RGN+GGGG
Sbjct: 8   IENHSTAMPAPQDPKHLPIRQQMEQLILRKQKEITKGLETLDTVKFRADSWTRGNDGGGG 67

Query: 102 VSMVLQNGTTFEKGGVNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFA 161
            SMVLQNGTTFEKGGVN SVV+G LSP AI AM+ DHKNLHLP+DP TGEP+A GV FFA
Sbjct: 68  TSMVLQNGTTFEKGGVNTSVVYGQLSPKAISAMRQDHKNLHLPVDPQTGEPNADGVNFFA 127

Query: 162 CGLSMVIHPINPHAPTTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQL 221
           CGLSMVIHP NPHAPTTHLNYRYFETWN DG+PQAWWFGGGADLTPSYLYEEDA LFH+L
Sbjct: 128 CGLSMVIHPHNPHAPTTHLNYRYFETWNPDGSPQAWWFGGGADLTPSYLYEEDAILFHKL 187

Query: 222 HKDALDKTDVALYPKYKKWCDEYFYIKHREETXXXXXXXXXXXXXXXPNEILQMVENCFD 281
           HK+ALDK D  LYP++KKWCDEYF+I HR ET               P EIL++VE+CFD
Sbjct: 188 HKEALDKHDTDLYPRFKKWCDEYFFINHRGETRGIGGIFFDDLDDRDPQEILKLVEDCFD 247

Query: 282 AFLPSYLEIIKRRKDMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILM 341
           AFLPSYL I+ RRKDMPYTEEE+QWQ +RRGRYVEFNLVLDRGTQFGLRTPGSRVESILM
Sbjct: 248 AFLPSYLTIVARRKDMPYTEEEKQWQSLRRGRYVEFNLVLDRGTQFGLRTPGSRVESILM 307

Query: 342 SLPVTASWLYDHHPEVDSREDKLLQVLK 369
           SLPVTASWLYDHHP+  SRED+LL+VLK
Sbjct: 308 SLPVTASWLYDHHPDAGSREDQLLEVLK 335

>Kwal_27.10935
          Length = 344

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/326 (75%), Positives = 271/326 (83%)

Query: 44  THSKYYHCAMTDSQVPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVS 103
           TH       +  +++PIR++ME L+RRKQ+EIT+GLETLDTVKF+ DSW RGN+GGGG S
Sbjct: 13  THPAKMPAPVDPTRMPIRQQMEELIRRKQREITQGLETLDTVKFRPDSWTRGNDGGGGTS 72

Query: 104 MVLQNGTTFEKGGVNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACG 163
           MVLQNGTTFEKGGVNVSVV+G LSP AI AMK DHKNL LP DP TG P+A GVKFFACG
Sbjct: 73  MVLQNGTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPTDPETGLPNADGVKFFACG 132

Query: 164 LSMVIHPINPHAPTTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHK 223
           LSMVIHP NPHAPTTHLNYRYFETWN DGTPQ WWFGGGADLTPSYLYEEDA+LFHQ HK
Sbjct: 133 LSMVIHPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPSYLYEEDARLFHQEHK 192

Query: 224 DALDKTDVALYPKYKKWCDEYFYIKHREETXXXXXXXXXXXXXXXPNEILQMVENCFDAF 283
            ALDK D +LYP+YKKWCDEYF+IKHR ET               P EIL ++E+CFDAF
Sbjct: 193 KALDKHDTSLYPRYKKWCDEYFFIKHRNETRGIGGIFFDDKDDRDPQEILSLIEDCFDAF 252

Query: 284 LPSYLEIIKRRKDMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSL 343
           LPSYL II RRKDMP+TEEE+QWQ IRRGRYVEFNLVLDRGTQFGLRTPGSR ESILMSL
Sbjct: 253 LPSYLPIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRGTQFGLRTPGSRTESILMSL 312

Query: 344 PVTASWLYDHHPEVDSREDKLLQVLK 369
           PVTA W YDHHPE  SRE+KLL+VL+
Sbjct: 313 PVTACWFYDHHPEPGSREEKLLKVLE 338

>YDR044W (HEM13) [897] chr4 (546638..547624) Coproporphyrinogen III
           oxidase, catalyzes the oxidative decarboxylation of
           coproporphyrinogen III to proto-porhyrinogen IX, the
           sixth step in heme biosynthetic pathway, repressed by
           oxygen [987 bp, 328 aa]
          Length = 328

 Score =  513 bits (1321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/310 (77%), Positives = 265/310 (85%)

Query: 58  VPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKGGV 117
           +PIR++MEAL+RRKQ EIT+GLE++DTVKF AD+W RGN+GGGG SMV+Q+GTTFEKGGV
Sbjct: 10  LPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQDGTTFEKGGV 69

Query: 118 NVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHAPT 177
           NVSVV+G LSP A+ AMKADHKNL LP DP TG P   GVKFFACGLSMVIHP+NPHAPT
Sbjct: 70  NVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVIHPVNPHAPT 129

Query: 178 THLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYPKY 237
           THLNYRYFETWN DGTPQ WWFGGGADLTPSYLYEED +LFHQLHKDALDK D ALYP++
Sbjct: 130 THLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDKHDTALYPRF 189

Query: 238 KKWCDEYFYIKHREETXXXXXXXXXXXXXXXPNEILQMVENCFDAFLPSYLEIIKRRKDM 297
           KKWCDEYFYI HR+ET               P EIL+MVE+CFDAFLPSYL I+KRRKDM
Sbjct: 190 KKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYLTIVKRRKDM 249

Query: 298 PYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHPEV 357
           PYT+EE+QWQ IRRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  ASWLY+HHP  
Sbjct: 250 PYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHPAP 309

Query: 358 DSREDKLLQV 367
            SRE KLL+V
Sbjct: 310 GSREAKLLEV 319

>Scas_569.3
          Length = 333

 Score =  501 bits (1291), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 237/312 (75%), Positives = 261/312 (83%)

Query: 56  SQVPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKG 115
           + +PIR++MEAL+RRKQ EITKGLE+LDTVKF ADSW RGN+GGGG SMV+ NG+TFEKG
Sbjct: 14  THLPIRQQMEALIRRKQAEITKGLESLDTVKFHADSWTRGNDGGGGTSMVIANGSTFEKG 73

Query: 116 GVNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHA 175
           GVNVSVV+GNL+P A+ AMK DHKNL LP DP TG P   GVKFFACGLSMVIHP NPHA
Sbjct: 74  GVNVSVVYGNLTPTAVLAMKDDHKNLKLPKDPKTGLPVPDGVKFFACGLSMVIHPKNPHA 133

Query: 176 PTTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYP 235
           PTTHLNYRYFETWN DGTPQ+WWFGGGADLTP YLYEEDAK FH+LHK ALDK D  LYP
Sbjct: 134 PTTHLNYRYFETWNPDGTPQSWWFGGGADLTPFYLYEEDAKHFHELHKKALDKHDKTLYP 193

Query: 236 KYKKWCDEYFYIKHREETXXXXXXXXXXXXXXXPNEILQMVENCFDAFLPSYLEIIKRRK 295
           KYKKWCDEYFYI HR+ET               P EIL++ E+CFDAFLPSYL II++RK
Sbjct: 194 KYKKWCDEYFYIAHRKETRGIGGIFFDDFDDRDPQEILKICEDCFDAFLPSYLPIIEKRK 253

Query: 296 DMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHP 355
           DMPYTEEE+QWQ IRRGRYVEFNL+ DRGTQFGLRTPGSRVESILMSLP  ASWLY+HHP
Sbjct: 254 DMPYTEEEKQWQLIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHASWLYNHHP 313

Query: 356 EVDSREDKLLQV 367
              SRE KLL+V
Sbjct: 314 APGSREAKLLEV 325

>CAGL0K12100g 1183383..1184366 highly similar to sp|P11353
           Saccharomyces cerevisiae YDR044w HEM13
           coproporphyrinogen III oxidase, start by similarity
          Length = 327

 Score =  474 bits (1221), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 220/311 (70%), Positives = 260/311 (83%), Gaps = 1/311 (0%)

Query: 57  QVPIRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTTFEKGG 116
            +PIR++MEAL+RRKQ+EIT+GLE++DTVKF AD+W+RGN+GGGG SMV+QNG+TFEKGG
Sbjct: 9   HLPIRQQMEALIRRKQKEITEGLESIDTVKFTADTWERGNDGGGGTSMVIQNGSTFEKGG 68

Query: 117 VNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPINPHAP 176
           VNVSVV+G L+P A+ AMK +HK+L LP + A G P++ GVKFFACGLSMVIHP+NP AP
Sbjct: 69  VNVSVVYGELTPGAVLAMKQEHKDLKLP-ESANGLPNSEGVKFFACGLSMVIHPVNPLAP 127

Query: 177 TTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDVALYPK 236
           TTHLNYRYFETWN DGTPQ WWFGGGADLTP YL+EEDA+ FH+LHK ALDK D ALYP+
Sbjct: 128 TTHLNYRYFETWNPDGTPQTWWFGGGADLTPFYLFEEDAEHFHKLHKAALDKHDTALYPR 187

Query: 237 YKKWCDEYFYIKHREETXXXXXXXXXXXXXXXPNEILQMVENCFDAFLPSYLEIIKRRKD 296
           +KKWCDEYFYI HR ET               P EIL++ E+CFDAFLPSYL I+KRRKD
Sbjct: 188 FKKWCDEYFYIAHRGETRGIGGIFFDDYNEKDPQEILKICEDCFDAFLPSYLTIMKRRKD 247

Query: 297 MPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLYDHHPE 356
           +PY E+++ WQ IRRGRY EFNL+ DRGTQFGLRTPGSRVESILMSLP+ ASW+Y+HHPE
Sbjct: 248 LPYNEKQKNWQLIRRGRYAEFNLIYDRGTQFGLRTPGSRVESILMSLPLHASWVYNHHPE 307

Query: 357 VDSREDKLLQV 367
             S E KLL+V
Sbjct: 308 PGSEEAKLLEV 318

>AGR030C [4340] [Homologous to ScYDR044W (HEM13) - SH]
           (768609..769583) [975 bp, 324 aa]
          Length = 324

 Score =  471 bits (1211), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 254/318 (79%), Gaps = 3/318 (0%)

Query: 53  MTDSQVP-IRERMEALVRRKQQEITKGLETLDTVKFQADSWDRGNNGGGGVSMVLQNGTT 111
           M  +  P +RERME LVRRKQ+EIT   E +DTVKF+ADSW+R   GGGG S VLQ+GTT
Sbjct: 1   MASAHTPHMRERMEELVRRKQREITAAFEAIDTVKFKADSWER-KEGGGGTSCVLQHGTT 59

Query: 112 FEKGGVNVSVVHGNLSPPAIKAMKADHKNLHLPIDPATGEPDATGVKFFACGLSMVIHPI 171
           FEK GVNVSVVHG LSP A+ AM+A+HKNLHLP DP TG+P A GV+FFACG+S+V+HP+
Sbjct: 60  FEKAGVNVSVVHGELSPAAVSAMRAEHKNLHLPTDPVTGQP-AAGVRFFACGISLVMHPV 118

Query: 172 NPHAPTTHLNYRYFETWNADGTPQAWWFGGGADLTPSYLYEEDAKLFHQLHKDALDKTDV 231
           NPHAPT HLNYRYFETW+A G PQ WWFGGG+DLTPSYLYEEDA+LFH  HK ALD+TD 
Sbjct: 119 NPHAPTVHLNYRYFETWDAAGKPQTWWFGGGSDLTPSYLYEEDARLFHAAHKAALDRTDP 178

Query: 232 ALYPKYKKWCDEYFYIKHREETXXXXXXXXXXXXXXXPNEILQMVENCFDAFLPSYLEII 291
           ALYP++KKWCDEYF+IKHR E+               P  +L+M E+C DAF+P+Y  I+
Sbjct: 179 ALYPRFKKWCDEYFWIKHRGESRGIGGIFYDDADDREPETLLRMAEDCLDAFVPAYKTIM 238

Query: 292 KRRKDMPYTEEERQWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTASWLY 351
            RRKDMPYT  E +WQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTA W Y
Sbjct: 239 LRRKDMPYTAAEHEWQQIRRGRYVEFNLVLDRGTQFGLRTPGSRVESILMSLPVTARWEY 298

Query: 352 DHHPEVDSREDKLLQVLK 369
           DHHP   +RE  LL+VL+
Sbjct: 299 DHHPAEGTREAALLEVLR 316

>Scas_707.21
          Length = 620

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 18/30 (60%)

Query: 25  IQYTCLVKQTETQRPVHLNTHSKYYHCAMT 54
           +Q+T L K    +RP+  N + ++YH AM 
Sbjct: 99  LQFTLLTKLFSDERPIFTNIYKEFYHNAMV 128

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,347,451
Number of extensions: 534149
Number of successful extensions: 1177
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1188
Number of HSP's successfully gapped: 12
Length of query: 369
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 266
Effective length of database: 13,030,455
Effective search space: 3466101030
Effective search space used: 3466101030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)