Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18524g35735212851e-178
Scas_569.2293883109e-33
Sklu_2357.7157682999e-33
AGR031W140682822e-30
YDR043C (NRG1)231612865e-30
Scas_718.44266602825e-29
Kwal_27.10925264812782e-28
CAGL0K12078g463792802e-27
CAGL0L07480g314612461e-23
YBR066C (NRG2)220682383e-23
Sklu_2351.6548621892e-15
KLLA0E10989g474551821e-14
Kwal_14.2278463721802e-14
AFR471C389601759e-14
YGL035C (MIG1)504601769e-14
CAGL0A01628g424611741e-13
Kwal_47.19045266591701e-13
Scas_575.3455661742e-13
CAGL0C02519g318571712e-13
Scas_712.42*290571683e-13
CAGL0K09372g396571704e-13
YGL209W (MIG2)382571686e-13
KLLA0B00605g239581621e-12
YER028C394621661e-12
CAGL0M01870g315601525e-11
Scas_687.33288561491e-10
YER169W (RPH1)796501412e-09
Scas_709.32822601394e-09
KLLA0F26961g694701387e-09
Scas_697.35839611378e-09
KLLA0F11682g374561359e-09
CAGL0L11880g980501361e-08
YOR113W (AZF1)914611361e-08
KLLA0F13046g1379561361e-08
YDR096W (GIS1)894521351e-08
Scas_602.9547621342e-08
Kwal_56.23453828631342e-08
Kwal_27.10467302801312e-08
KLLA0C17710g821521333e-08
YKL062W (MSN4)630581333e-08
AGL207W277591303e-08
Scas_681.19864521333e-08
KLLA0B07909g922581333e-08
ABR089C571641323e-08
Kwal_26.8351698601323e-08
Scas_721.921152561323e-08
CAGL0K02145g317561303e-08
YMR037C (MSN2)704671324e-08
AGR117C799521305e-08
AFR580C838581305e-08
CAGL0L06072g300751286e-08
Kwal_47.166211178511306e-08
Sklu_2443.22213511257e-08
CAGL0H04213g1321561307e-08
Scas_718.36d330591278e-08
YML081W1251511298e-08
Sklu_2181.1410601279e-08
YDR216W (ADR1)1323561291e-07
YPL230W391571271e-07
KLLA0B04477g1332511281e-07
Kwal_47.17888786551281e-07
Kwal_47.17241403601261e-07
Scas_649.28730581271e-07
Scas_717.18354571251e-07
CAGL0M13189g541561252e-07
AGR172W1057561252e-07
CAGL0E04884g1489561253e-07
AER159C1191511253e-07
KLLA0F23782g782551243e-07
KLLA0F01463g781841243e-07
ACR264W769611234e-07
Scas_703.231341511235e-07
Scas_683.25879591225e-07
KLLA0A04609g423691216e-07
CAGL0M06831g645641216e-07
CAGL0F05995g597561216e-07
YGR067C794571217e-07
ACL057W520601207e-07
Scas_720.33316651189e-07
KLLA0E08679g596781209e-07
Kwal_26.8011190541151e-06
Kwal_47.16577881511191e-06
ADR308C278591162e-06
AFL136W409441172e-06
Sklu_2398.2288661152e-06
YNL027W (CRZ1)678621172e-06
KLLA0C17072g474601162e-06
Scas_710.9505591153e-06
YJR127C (ZMS1)1380511163e-06
YER130C443561153e-06
Scas_707.31289681143e-06
Scas_717.17525621153e-06
CAGL0K04631g1013621163e-06
CAGL0L03916g642551153e-06
Scas_717.17d350571144e-06
KLLA0F20636g285521134e-06
CAGL0M00594g1020531154e-06
CAGL0H07557g476631145e-06
Kwal_14.2206254531115e-06
YMR182C (RGM1)211681106e-06
YJL056C (ZAP1)880641137e-06
AEL077W336511127e-06
Kwal_27.11460531641128e-06
Kwal_14.2543711561121e-05
Scas_707.46338651101e-05
Scas_695.2571741111e-05
ADL040W330511082e-05
ADL198W547631073e-05
CAGL0E06116g613531065e-05
ADL051W173541015e-05
KLLA0C16005g331471046e-05
ADL042W281521037e-05
Sklu_2389.2767561048e-05
Sklu_2244.3271531011e-04
CAGL0G08107g625541021e-04
Scas_656.1*10253941e-04
CAGL0J05060g713591021e-04
Scas_711.56832731012e-04
YPR015C24766982e-04
Scas_719.681350611003e-04
YPR013C31753974e-04
CAGL0J01595g34483975e-04
Sklu_2436.951769975e-04
Sklu_2289.129163965e-04
Scas_712.232766957e-04
KLLA0F10109g62366968e-04
Scas_627.6120773968e-04
AFR461C54484959e-04
CAGL0I02816g29152949e-04
Scas_602.426652940.001
CAGL0L00583g38841940.001
KLLA0D16456g85474950.001
CAGL0G10021g39447930.002
Scas_602.4d25666910.002
Kwal_47.1833753668930.002
Scas_378.120851900.002
AGR186C28767910.002
KLLA0A10373g20662900.002
CAGL0K03003g64771920.002
YMR070W (MOT3)49070910.003
ADL050W14660870.003
Scas_713.5262052920.003
AEL174W66156910.003
CAGL0L05786g34859900.003
Kwal_26.802150752890.005
CAGL0E04312g68881890.005
CAGL0E01331g68966890.006
Scas_693.3163555880.006
Scas_641.2453265880.006
KLLA0E18645g43159880.007
CAGL0M04323g703103880.007
Sklu_2359.572262880.008
YHR006W (STP2)54170870.009
Sklu_1527.120558840.010
YLR131C (ACE2)77048870.010
YDR146C (SWI5)70948860.013
Scas_717.60d16770820.014
Scas_670.243572850.015
KLLA0F07073g55834850.018
Scas_660.1236762840.018
AGL071C39649840.018
CAGL0K06413g35968840.019
Kwal_56.2392574572840.023
YDR463W (STP1)51964840.023
Kwal_34.1594627961820.030
CAGL0I02838g65537820.036
YDR253C (MET32)19154800.037
AEL278W47664810.042
YPR186C (PZF1)42964790.072
YDL048C (STP4)49065790.094
KLLA0E13519g23065770.10
YGL254W (FZF1)29969770.11
YPL038W (MET31)17752750.15
AGL197W84473770.16
Scas_683.3047861760.17
Kwal_27.1016728567750.18
YPR022C113366770.18
Kwal_26.930030459750.21
AGL246W22754730.29
Kwal_23.540042956740.31
AFR531W27462720.44
CAGL0K04697g51580730.45
Scas_568.519954710.46
Sklu_2206.235827720.48
Kwal_27.1182419954710.49
AFR588W31927720.55
Scas_604.458559720.61
Scas_636.14d27550710.65
Sklu_2154.319070700.69
KLLA0A02629g55952710.72
CAGL0H04873g45127710.80
YLR375W34361700.81
Scas_627.17d27549700.89
Scas_631.743343691.2
CAGL0E03762g58481681.7
CAGL0K02343g116278681.9
KLLA0B03454g47269662.9
KLLA0E00726g51748645.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18524g
         (352 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18524g complement(1701498..1702571) some similarities with...   499   e-178
Scas_569.2                                                            124   9e-33
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement       119   9e-33
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...   113   2e-30
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...   114   5e-30
Scas_718.44                                                           113   5e-29
Kwal_27.10925                                                         111   2e-28
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...   112   2e-27
CAGL0L07480g complement(822240..823184) some similarities with s...    99   1e-23
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    96   3e-23
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       77   2e-15
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    75   1e-14
Kwal_14.2278                                                           74   2e-14
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    72   9e-14
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    72   9e-14
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    72   1e-13
Kwal_47.19045                                                          70   1e-13
Scas_575.3                                                             72   2e-13
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    70   2e-13
Scas_712.42*                                                           69   3e-13
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    70   4e-13
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    69   6e-13
KLLA0B00605g complement(46736..47455) some similarities with sp|...    67   1e-12
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    69   1e-12
CAGL0M01870g complement(219813..220760) some similarities with t...    63   5e-11
Scas_687.33                                                            62   1e-10
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    59   2e-09
Scas_709.32                                                            58   4e-09
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    58   7e-09
Scas_697.35                                                            57   8e-09
KLLA0F11682g complement(1068992..1070116) some similarities with...    57   9e-09
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    57   1e-08
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    57   1e-08
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    57   1e-08
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    57   1e-08
Scas_602.9                                                             56   2e-08
Kwal_56.23453                                                          56   2e-08
Kwal_27.10467                                                          55   2e-08
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    56   3e-08
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    56   3e-08
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    55   3e-08
Scas_681.19                                                            56   3e-08
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    56   3e-08
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    55   3e-08
Kwal_26.8351                                                           55   3e-08
Scas_721.92                                                            55   3e-08
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    55   3e-08
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    55   4e-08
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    55   5e-08
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    55   5e-08
CAGL0L06072g complement(679924..680826) some similarities with s...    54   6e-08
Kwal_47.16621                                                          55   6e-08
Sklu_2443.22 , Contig c2443 45390-46027                                53   7e-08
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    55   7e-08
Scas_718.36d                                                           54   8e-08
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    54   8e-08
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            54   9e-08
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    54   1e-07
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    54   1e-07
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    54   1e-07
Kwal_47.17888                                                          54   1e-07
Kwal_47.17241                                                          53   1e-07
Scas_649.28                                                            54   1e-07
Scas_717.18                                                            53   1e-07
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    53   2e-07
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    53   2e-07
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    53   3e-07
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    53   3e-07
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    52   3e-07
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    52   3e-07
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    52   4e-07
Scas_703.23                                                            52   5e-07
Scas_683.25                                                            52   5e-07
KLLA0A04609g complement(411494..412765) some similarities with s...    51   6e-07
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    51   6e-07
CAGL0F05995g complement(598819..600612) some similarities with s...    51   6e-07
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    51   7e-07
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    51   7e-07
Scas_720.33                                                            50   9e-07
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    51   9e-07
Kwal_26.8011                                                           49   1e-06
Kwal_47.16577                                                          50   1e-06
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    49   2e-06
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    50   2e-06
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                49   2e-06
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    50   2e-06
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    49   2e-06
Scas_710.9                                                             49   3e-06
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    49   3e-06
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    49   3e-06
Scas_707.31                                                            49   3e-06
Scas_717.17                                                            49   3e-06
CAGL0K04631g complement(440721..443762) some similarities with s...    49   3e-06
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    49   3e-06
Scas_717.17d                                                           49   4e-06
KLLA0F20636g complement(1914452..1915309) some similarities with...    48   4e-06
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    49   4e-06
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    49   5e-06
Kwal_14.2206                                                           47   5e-06
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    47   6e-06
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    48   7e-06
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    48   7e-06
Kwal_27.11460                                                          48   8e-06
Kwal_14.2543                                                           48   1e-05
Scas_707.46                                                            47   1e-05
Scas_695.2                                                             47   1e-05
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    46   2e-05
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    46   3e-05
CAGL0E06116g complement(604708..606549) some similarities with t...    45   5e-05
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    44   5e-05
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    45   6e-05
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    44   7e-05
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            45   8e-05
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                44   1e-04
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    44   1e-04
Scas_656.1*                                                            41   1e-04
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    44   1e-04
Scas_711.56                                                            44   2e-04
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...    42   2e-04
Scas_719.68                                                            43   3e-04
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...    42   4e-04
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...    42   5e-04
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          42   5e-04
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          42   5e-04
Scas_712.2                                                             41   7e-04
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    42   8e-04
Scas_627.6                                                             42   8e-04
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    41   9e-04
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    41   9e-04
Scas_602.4                                                             41   0.001
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    41   0.001
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    41   0.001
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    40   0.002
Scas_602.4d                                                            40   0.002
Kwal_47.18337                                                          40   0.002
Scas_378.1                                                             39   0.002
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    40   0.002
KLLA0A10373g complement(907244..907864) some similarities with c...    39   0.002
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    40   0.002
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    40   0.003
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    38   0.003
Scas_713.52                                                            40   0.003
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    40   0.003
CAGL0L05786g complement(636176..637222) some similarities with t...    39   0.003
Kwal_26.8021                                                           39   0.005
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    39   0.005
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    39   0.006
Scas_693.31                                                            39   0.006
Scas_641.24                                                            39   0.006
KLLA0E18645g complement(1648263..1649558) some similarities with...    39   0.007
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    39   0.007
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          39   0.008
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    38   0.009
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             37   0.010
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    38   0.010
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    38   0.013
Scas_717.60d                                                           36   0.014
Scas_670.2                                                             37   0.015
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    37   0.018
Scas_660.12                                                            37   0.018
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    37   0.018
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    37   0.019
Kwal_56.23925                                                          37   0.023
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    37   0.023
Kwal_34.15946                                                          36   0.030
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    36   0.036
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    35   0.037
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    36   0.042
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    35   0.072
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    35   0.094
KLLA0E13519g complement(1190615..1191307) some similarities with...    34   0.10 
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    34   0.11 
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    33   0.15 
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    34   0.16 
Scas_683.30                                                            34   0.17 
Kwal_27.10167                                                          33   0.18 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    34   0.18 
Kwal_26.9300                                                           33   0.21 
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    33   0.29 
Kwal_23.5400                                                           33   0.31 
AFR531W [3723] [Homologous to ScAFR531W] complement(1389487..139...    32   0.44 
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    33   0.45 
Scas_568.5                                                             32   0.46 
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            32   0.48 
Kwal_27.11824                                                          32   0.49 
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    32   0.55 
Scas_604.4                                                             32   0.61 
Scas_636.14d                                                           32   0.65 
Sklu_2154.3 , Contig c2154 4677-5249 reverse complement                32   0.69 
KLLA0A02629g complement(233822..235501) some similarities with s...    32   0.72 
CAGL0H04873g complement(465069..466424) some similarities with t...    32   0.80 
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    32   0.81 
Scas_627.17d                                                           32   0.89 
Scas_631.7                                                             31   1.2  
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    31   1.7  
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    31   1.9  
KLLA0B03454g complement(314015..315433) some similarities with s...    30   2.9  
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    29   5.6  

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score =  499 bits (1285), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 273/352 (77%), Positives = 273/352 (77%)

Query: 1   MSVVEQKMPLTSGIAWGSSSNSCNNSATDNIHANINFNGNLNNVTNSNIVHDQYGAPVHQ 60
           MSVVEQKMPLTSGIAWGSSSNSCNNSATDNIHANINFNGNLNNVTNSNIVHDQYGAPVHQ
Sbjct: 1   MSVVEQKMPLTSGIAWGSSSNSCNNSATDNIHANINFNGNLNNVTNSNIVHDQYGAPVHQ 60

Query: 61  SYSIVASTIGQNTSRPVLPPLHMAIHSPYGVPPXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           SYSIVASTIGQNTSRPVLPPLHMAIHSPYGVPP                           
Sbjct: 61  SYSIVASTIGQNTSRPVLPPLHMAIHSPYGVPPMMGATHSSSSTASSLSISSMATGSSPL 120

Query: 121 XXXXXXXXTASAELQAKRSLDRFLFTGPDHNQVQTQTQIHNPSQGHYFIGSEPLLPPTHQ 180
                   TASAELQAKRSLDRFLFTGPDHNQVQTQTQIHNPSQGHYFIGSEPLLPPTHQ
Sbjct: 121 LPLVLPPPTASAELQAKRSLDRFLFTGPDHNQVQTQTQIHNPSQGHYFIGSEPLLPPTHQ 180

Query: 181 QKPXXXXXXXXXXNGDDVKVETLDSGKNNVISNNDIPRSNIAGXXXXXXXXXXXXXXXXX 240
           QKP          NGDDVKVETLDSGKNNVISNNDIPRSNIAG                 
Sbjct: 181 QKPSFSSSTSSLSNGDDVKVETLDSGKNNVISNNDIPRSNIAGSMNSSTSTSPSSSSYST 240

Query: 241 XXXXXXXXXXXXXXXXXASQQHKISNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLA 300
                            ASQQHKISNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLA
Sbjct: 241 PIASKSKRSSRQDRKPKASQQHKISNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLA 300

Query: 301 RHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPMPEEQQPSINT 352
           RHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPMPEEQQPSINT
Sbjct: 301 RHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPMPEEQQPSINT 352

>Scas_569.2
          Length = 293

 Score =  124 bits (310), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 55/88 (62%), Positives = 66/88 (75%), Gaps = 7/88 (7%)

Query: 258 ASQQHKISNTGKQSNTKDLP-------LAERRKYICKICSRGFTTSGHLARHNRIHTGEK 310
            S++H+IS   +    KDL        L +RRKYICK+CS+GFTTSGHLARHNRIHTGEK
Sbjct: 195 GSKKHRISKRQRAIMVKDLKKRKHEEELEKRRKYICKVCSKGFTTSGHLARHNRIHTGEK 254

Query: 311 RHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           +H C +PGC  +FSRHDN +QHYRTHFK
Sbjct: 255 KHHCSYPGCYLKFSRHDNCVQHYRTHFK 282

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score =  119 bits (299), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%)

Query: 273 TKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           T ++P+ +RR+Y+CKICSRGFTTSGHLARHNRIHTGEK H C F GC QRFSRHDN +QH
Sbjct: 89  TANVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

Query: 333 YRTHFKNN 340
           YRTH K N
Sbjct: 149 YRTHLKTN 156

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score =  113 bits (282), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%)

Query: 276 LPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           +P+ +RRK++C+ C +GFTTSGHLARHNRIHTGEK H C FPGC QRFSRHDN +QHYRT
Sbjct: 72  VPVEKRRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRT 131

Query: 336 HFKNNPMP 343
           H K   +P
Sbjct: 132 HLKRTAVP 139

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score =  114 bits (286), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (86%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337
           L +RRKYICKIC+RGFTTSGHLARHNRIHTGEK H C + GC QRFSRHDN +QHYRTH 
Sbjct: 168 LEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHL 227

Query: 338 K 338
           K
Sbjct: 228 K 228

>Scas_718.44
          Length = 266

 Score =  113 bits (282), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (86%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNN 340
           RRK++CKICS GFTTSGHL+RHNRIHTGEK H C F GCNQ+FSRHDN +QHYRTH K N
Sbjct: 207 RRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKKN 266

>Kwal_27.10925
          Length = 264

 Score =  111 bits (278), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 3/81 (3%)

Query: 265 SNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFS 324
           S  GK++ +   P+ +RR+Y+CKIC +GFTTSGHLARHNRIHTGEK H C   GC QRFS
Sbjct: 185 SGNGKRTRS---PVEQRRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFS 241

Query: 325 RHDNYIQHYRTHFKNNPMPEE 345
           RHDN +QHY+TH + N   E+
Sbjct: 242 RHDNCVQHYKTHLRRNTWHED 262

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score =  112 bits (280), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 5/79 (6%)

Query: 260 QQHKISNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGC 319
           ++H IS+     N+ D+ L  RRKY+CK+C +GFTTSGHLARHNRIHTGEKRH C + GC
Sbjct: 383 KKHSISSL---CNSDDIEL--RRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGC 437

Query: 320 NQRFSRHDNYIQHYRTHFK 338
            QRF+RHDN +QHY+TH K
Sbjct: 438 GQRFNRHDNCLQHYKTHLK 456

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 42/61 (68%), Positives = 49/61 (80%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337
           + +RRK+IC+IC  GFTTSGHL+RH +IHTGEK H C   GCNQ FSRHDN +QHYRTH 
Sbjct: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305

Query: 338 K 338
           K
Sbjct: 306 K 306

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 96.3 bits (238), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 50/68 (73%)

Query: 269 KQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDN 328
           K  +TK     +R ++ CKICS GFTTSGHL+RHNRIHTGEK H C   GC QRFSRHDN
Sbjct: 138 KLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDN 197

Query: 329 YIQHYRTH 336
             QHYRTH
Sbjct: 198 CNQHYRTH 205

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 38/62 (61%), Gaps = 2/62 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           R Y+C ICSR F    H  RH R HTGEK H C+FPGC +RFSR D   +H R H   NP
Sbjct: 32  RPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH--TNP 89

Query: 342 MP 343
            P
Sbjct: 90  AP 91

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 35/55 (63%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           R Y+C IC RGF    H  RH R HTGE+ H C FPGC++RFSR D   +H R H
Sbjct: 24  RPYVCPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>Kwal_14.2278
          Length = 463

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 40/72 (55%)

Query: 265 SNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFS 324
           S + K+  + +L     R YIC ICSR F    H  RH R HTGEK H C F GC +RFS
Sbjct: 4   SASKKKRRSANLGQESPRPYICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFS 63

Query: 325 RHDNYIQHYRTH 336
           R D   +H R H
Sbjct: 64  RSDELTRHKRIH 75

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 72.0 bits (175), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 35/60 (58%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           R Y+C IC+R F    H  RH R HTGEK H C F GC +RFSR D   +H R H  + P
Sbjct: 20  RPYVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHESDRP 79

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 72.4 bits (176), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 36/60 (60%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           R + C IC R F    H  RH RIHTGEK H C FPGC +RFSR D   +H R H  ++P
Sbjct: 36  RPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHP 95

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           R ++C IC R F    H  RH R HTGEK H C FPGC +RFSR D   +H R H   NP
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH--TNP 98

Query: 342 M 342
           +
Sbjct: 99  L 99

>Kwal_47.19045
          Length = 266

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNN 340
           R + C +C +GF    H  RH R HTGEK H C FPGC +RFSR D   +H RTH   +
Sbjct: 12  RPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHMSTS 70

>Scas_575.3
          Length = 455

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           R ++C IC R F    H  RH R HTGEK H+C FPGC ++FSR D   +H R H   NP
Sbjct: 66  RPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIH--TNP 123

Query: 342 MPEEQQ 347
            P  ++
Sbjct: 124 QPRGKR 129

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 70.5 bits (171), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 37/57 (64%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337
           +R + C+ICSRGF    H  RH R HTGEK H+C+FP C + FSR D   +H RTH 
Sbjct: 17  KRPFRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTHM 73

>Scas_712.42*
          Length = 290

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 35/57 (61%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           + R + C+ C+RGF    H  RH R HTGEK H C FPGC + FSR D   +H RTH
Sbjct: 14  DERPFRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 35/57 (61%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           + R + C+ CSRGF    H  RH R HTGEK H C FPGC + FSR D   +H RTH
Sbjct: 13  KERPFKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 13/20 (65%)

Query: 289 CSRGFTTSGHLARHNRIHTG 308
           C + F+ S  L RHNR HTG
Sbjct: 52  CGKSFSRSDELKRHNRTHTG 71

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 69.3 bits (168), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 33/57 (57%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           E R + C  C RGF    H  RH R HTGEK H C FPGC + FSR D   +H RTH
Sbjct: 13  ENRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339
           R Y+C+IC   F    H  RH R HTGEK   C  PGC +RFSR+D   +H +THFK+
Sbjct: 10  RPYLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKS 67

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 68.6 bits (166), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%)

Query: 277 PLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           P  ++R + C+ICSRGF    H  RH R HTGEK H+C   GC + FSR D   +H RTH
Sbjct: 10  PDNDQRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTH 69

Query: 337 FK 338
            K
Sbjct: 70  TK 71

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           +E  K+ICK+C + F     L+ H  IHTGEK + C F  C + F+   N ++HY+ HFK
Sbjct: 168 SEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>Scas_687.33
          Length = 288

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 31/56 (55%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337
           R + C ICSRGF    H  RH R HTGEK H C F  C + FSR D   +H R H 
Sbjct: 15  RPFRCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHL 70

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 284 YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           YICK C R F++  HL RH + +H+GEK H C  P C +RF R D+ +QH
Sbjct: 709 YICKECQRKFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 756

>Scas_709.32
          Length = 822

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           E + + C+ C + F  S HL RH R +H+ E+   C  P C+++FSR DN  QH +TH K
Sbjct: 761 ENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKK 818

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 4/70 (5%)

Query: 277 PLAERRK-YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           P+ E  K + C  C++ F  S HL RH R +H+ E+   CQF  C+++FSR DN  QH +
Sbjct: 613 PMDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLK 670

Query: 335 THFKNNPMPE 344
           TH K+  + E
Sbjct: 671 THKKHGDITE 680

>Scas_697.35
          Length = 839

 Score = 57.4 bits (137), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           + Y C  C + FT  G+L  H R+HTGEK ++C+   C+++FSR  N   H  TH K  P
Sbjct: 541 KPYQCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLTHQKVKP 598

Query: 342 M 342
            
Sbjct: 599 F 599

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +++ C  C R F  S HL  H R H G K +QC +  C +RF++  N   H R H    P
Sbjct: 513 KQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLHTGEKP 570

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
            + Y C++C + F+  G+LA H   H   K   C+   CN+ F++  N   H
Sbjct: 568 EKPYECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAH 619

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 283 KYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           KY C  C + F     L+ H  IHTG+K ++C +P C ++F+   N ++HY+ H K
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 284 YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           Y+C+ C R F++  HL RH + +H+GEK H C  P C +RF R D+ +QH
Sbjct: 902 YVCQECKRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKRFKRRDHVLQH 949

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           + ++C  C + FT  G+L  H R+HTGEK + C    C+++FSR  N   H  TH K  P
Sbjct: 619 KPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLKP 676

Query: 342 M 342
            
Sbjct: 677 F 677

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +K+ C  C R F+ + HL  H R H G K   C +  C +RF++  N   H R H    P
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKP 648

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
            + Y C IC + F+  G+LA H   H   K   C+   CN+ F++  N   H
Sbjct: 646 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 277 PLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           P  + R ++CK+C+R F    HL RH R HT EK + C    C +RF+R D  I+H
Sbjct: 118 PSGKPRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRH 171

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 3/52 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           + YIC+ C+R F++  HL RH + +H+GEK H C  P C +RF R D+ +QH
Sbjct: 826 KIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSC--PRCGKRFKRRDHVLQH 875

>Scas_602.9
          Length = 547

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 4/62 (6%)

Query: 276 LPLAERRKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           LP A  +++ C  C R F    HL RH R +H GEK + C    CN+ FSR DN  QH +
Sbjct: 488 LPDA-TKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIK 544

Query: 335 TH 336
           TH
Sbjct: 545 TH 546

>Kwal_56.23453
          Length = 828

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 43/63 (68%), Gaps = 4/63 (6%)

Query: 272 NTKDLPLAERRK-YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNY 329
           N++++ ++++ K Y+C+ C R F++  HL RH + +H+GEK H C  P C ++F R D+ 
Sbjct: 722 NSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHV 779

Query: 330 IQH 332
           +QH
Sbjct: 780 LQH 782

>Kwal_27.10467
          Length = 302

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 264 ISNTGKQSNTKDLP---LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCN 320
           ++ + +++++++L    L  + +Y C  C + F     LA HN  HTG+K + C F  C+
Sbjct: 175 LARSARKASSEELQPPRLRNQPRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCD 234

Query: 321 QRFSRHDNYIQHYRTHFKNN 340
           ++F+   N  +HY+ HFK +
Sbjct: 235 KQFNARSNMTRHYKLHFKTD 254

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 3/52 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           + Y+C+ C+R F++  HL RH + +H+GEK H C  P C ++F R D+ +QH
Sbjct: 753 KVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 802

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           + + CK C + F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH K
Sbjct: 571 KPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNN 340
           ++Y+C  C +GF  +  L  H  IHTG++   C F  C + F+   N ++H++ HF+ +
Sbjct: 181 QRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFRTD 239

>Scas_681.19
          Length = 864

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           + Y+C  C R FT+  HL RH + +H+GEK H C  P C ++F R D+ +QH
Sbjct: 763 KVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 812

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           +A +RKYIC  C++ F+ S H ARH R HTG K   C    C+  F R D   +H RT
Sbjct: 2   VASQRKYICSFCAKPFSRSEHKARHERSHTGSKPFSCSI--CSHSFVRRDLLQRHIRT 57

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 277 PLAERRK-YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           PL E  K + C+ C++ F  S HL RH R +H+ ++   C +  C+++FSR DN  QH +
Sbjct: 496 PLEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLK 553

Query: 335 THFK 338
           TH K
Sbjct: 554 THRK 557

>Kwal_26.8351
          Length = 698

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 3/60 (5%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           E + + C+ C++ F  S HL RH R +H+ E+   C +  C+++FSR DN  QH +TH K
Sbjct: 637 EEKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 694

>Scas_721.92
          Length = 1152

 Score = 55.5 bits (132), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 277 PLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           P  + R ++C +CSR F    HL RH R HT EK +QC    C ++F+R D  ++H
Sbjct: 71  PSGKPRLFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRH 124

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           +++ C+ C R F    HL RH R +H GEK ++C    CN++FSR DN  QH +TH
Sbjct: 262 KQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHI--CNKKFSRSDNLNQHIKTH 315

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 273 TKDLPLAERRKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQ 331
           TK+L   E + + C IC + F  S HL RH R +H+ E+   C    C+++FSR DN  Q
Sbjct: 639 TKEL---EEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQ 693

Query: 332 HYRTHFK 338
           H +TH K
Sbjct: 694 HIKTHKK 700

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 3/52 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           + Y+C+ C R F++  HL RH + +H+GEK H C  P C ++F R D+ +QH
Sbjct: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           +A +RKYIC  C++ F+ S H  RH R HTG K   C+   CN  F R D   +H RT
Sbjct: 2   VASQRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSCKV--CNHSFVRRDLLQRHIRT 57

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 276 LPLAERRKYICKICSRGFTTSGHLARH-NRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           L   + + + C +C R F    HL RH + +H GE+ + C    C + FSR DN  QH R
Sbjct: 210 LLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDI--CLKSFSRSDNLNQHKR 267

Query: 335 THFKNNPMPEEQQPS 349
           TH  NNP P +++ S
Sbjct: 268 TH--NNPHPNKRRTS 280

>Kwal_47.16621
          Length = 1178

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R ++C IC+RGF    HL RH R HT EK   C F  C + F+R D  ++H
Sbjct: 76  RPFLCSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRH 124

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 52.8 bits (125), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R ++C IC+RGF    HL RH R HT EK   C F  C + F+R D  ++H
Sbjct: 46  RPFLCPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH-YRTH 336
           R ++C IC+RGF    HL RH R HT EK   C F  C + F+R D  ++H Y+ H
Sbjct: 31  RPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRHQYKLH 84

>Scas_718.36d
          Length = 330

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           E+  Y C +C +GF     L  H+ I +G + ++C +  C + F+   N ++HY+ HF+
Sbjct: 235 EKLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFR 293

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R ++C IC+RGF    HL RH R HT EK   C F  C + F+R D  ++H
Sbjct: 59  RPFLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           L   +++ C+ C R F    HL RH R +H GEK + C+   C ++FSR DN  QH +TH
Sbjct: 348 LDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEI--CGKKFSRSDNLNQHIKTH 405

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 277 PLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           P  + R ++C++C+R F    HL RH R HT EK + C    CN+ F+R D  I+H
Sbjct: 97  PSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRH 150

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 279 AERRKYIC---KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           A R+ + C     C+  FT + HLARH R HTGEK  QC  P C + FSR DN  QH
Sbjct: 36  ARRKTFKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQC--PACLKFFSRVDNLKQH 90

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R ++C IC+RGF    HL RH R HT EK   C F  C + F+R D  ++H
Sbjct: 81  RPFLCPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>Kwal_47.17888
          Length = 786

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           + + C+ C + FT  G+L  H R+HTGEK ++C+   C +RFSR  N   H  TH
Sbjct: 529 KPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECE--KCGRRFSRKGNLAAHRLTH 581

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +++ C  C + FT S HL  H R H G K  QC++  C +RF++  N   H R H    P
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLHTGEKP 558

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           + Y C+ C R F+  G+LA H   H   K   C+  GCN+ F++  N   H
Sbjct: 557 KPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAH 607

>Kwal_47.17241
          Length = 403

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           L   +++ C  C R F    HL RH R +H GEK   C    C ++FSR DN  QH +TH
Sbjct: 340 LDASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>Scas_649.28
          Length = 730

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           + + C  C + F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH K
Sbjct: 671 KPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKK 726

>Scas_717.18
          Length = 354

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           R + C IC +  T S  L  H  IHTGEK ++C +P C+   S   N  +HY++H K
Sbjct: 294 RIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           + + C  C + F  S HL RH R +H+ E+   C F  C ++FSR DN  QH +TH
Sbjct: 482 KPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTH 535

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 277 PLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           P  + R ++C  C+R F    HL RH R HT EK + C    C++RFSR D  ++H
Sbjct: 42  PSGKPRLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGI--CDRRFSRRDLLLRH 95

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 277 PLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           P  + R ++C+ C+R F    HL RH R HT EK + C    C++RF+R D  ++H
Sbjct: 23  PSGKPRLFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGI--CDRRFTRRDLLLRH 76

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R ++C +C+RGF    HL RH R HT EK   C F  C + F+R D  ++H
Sbjct: 78  RPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           + + C+ C + FT  G+L  H R+HTGEK ++C+   C ++FSR  N   H  TH
Sbjct: 549 KPFSCEFCGKRFTQGGNLRTHIRLHTGEKPYECE--RCGRKFSRKGNLAAHKLTH 601

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +++ C  C + FT S HL  H R H G K   C+F  C +RF++  N   H R H    P
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLHTGEKP 578

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           + Y C+ C R F+  G+LA H   H   K  +C+   CN+ F++  N   H
Sbjct: 577 KPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAH 627

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 8/84 (9%)

Query: 263 KISNTGKQSNTKDLPL------AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQF 316
           + +  GK  NT+D+        +  R + C +C + ++TS  L  H R HTGEK   C  
Sbjct: 693 RCAECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRTHTGEKPLSC-- 750

Query: 317 PGCNQRFSRHDNYIQHYRTHFKNN 340
           P CN+RF+   N  +H RTH + N
Sbjct: 751 PICNKRFNESSNLAKHIRTHKREN 774

 Score = 35.0 bits (79), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 280 ERRKYICKI--CSRGFTTSGHLARHNR---IHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           E +  ICK   C++ F ++  L  H     + +G   ++C++ GCN+ F +    I+H +
Sbjct: 625 EPQSCICKWAGCNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLK 684

Query: 335 THFKNNPM 342
            H K  P 
Sbjct: 685 VHSKYKPF 692

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 27/61 (44%), Gaps = 4/61 (6%)

Query: 284 YICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           Y C+   C++ F     L RH ++H+  K  +C    C + F+  D   QH R H    P
Sbjct: 662 YKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRC--AECGKCFNTQDILTQHLRVHSGERP 719

Query: 342 M 342
            
Sbjct: 720 F 720

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           + + C+ C + FT  G+L  H R+HTGE+ ++C    C +RFSR  N   H  TH    P
Sbjct: 513 KPFQCEYCGKRFTQGGNLRTHVRLHTGERPYECD--KCGKRFSRKGNLAAHMLTHENYKP 570

Query: 342 M 342
            
Sbjct: 571 F 571

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +++ C  C + FT S HL  H R H G K  QC++  C +RF++  N   H R H    P
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLHTGERP 542

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R Y C  C + F+  G+LA H   H   K  QC+   CN+ F++  N   H
Sbjct: 541 RPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAH 591

>Scas_703.23
          Length = 1341

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R ++C  C+RGF    HL RH R HT EK   C F  C + F+R D  ++H
Sbjct: 70  RPFLCPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>Scas_683.25
          Length = 879

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 277 PLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           P   ++++IC  C++GF+ + H  RH R HTG K ++C+   C   F R D  ++H +T
Sbjct: 8   PTTFQKRFICSFCAKGFSRAEHKIRHERSHTGLKPYKCKV--CTHCFVRSDLALRHIKT 64

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 6/69 (8%)

Query: 272 NTKDLPLAERRKYIC-KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYI 330
           N   LPL + + +IC +ICSR  T   HL+    IHTG+K ++C    C++RF+   N +
Sbjct: 332 NDSSLPLKKNQCHICGRICSRPSTLQTHLS----IHTGDKPYKCPKRNCHKRFNVKSNML 387

Query: 331 QHYRTH-FK 338
           +HY+ H FK
Sbjct: 388 RHYKRHEFK 396

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQC-------QFPGCNQRFSRHDNYIQ 331
            + + Y C IC + F       RH  +HTG+KR+ C        F GC ++F+R D   +
Sbjct: 544 TDEKPYQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGR 603

Query: 332 HYRT 335
           H++T
Sbjct: 604 HFKT 607

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           Y+C++C + F+   +L  H R HT EK +QC    C + F+R  +  +H   H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLH 571

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 284 YICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           + C +CS+ F  S HL RH R +H+ ++   C    C ++FSR DN  QH +TH K
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKK 588

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           A ++KYIC  C + F+ S H  RH R H G K  QCQ   C   F R D   +H RT
Sbjct: 3   AGQKKYICSFCLKPFSRSEHKIRHERSHAGVKPFQCQ--VCKHSFVRRDLLQRHIRT 57

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           L   + + C+ C R F    HL RH R +H GEK + C    C ++FSR DN  QH +TH
Sbjct: 454 LDATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDI--CGKKFSRSDNLNQHIKTH 511

>Scas_720.33
          Length = 316

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 36/65 (55%), Gaps = 6/65 (9%)

Query: 280 ERRKYIC---KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT- 335
           ER+ + C   K C   FT   HLARH R HTGEK  QC    C + FSR DN  QH  T 
Sbjct: 11  ERKTFACQGYKDCHMTFTREEHLARHIRKHTGEKPFQCYI--CFRFFSRMDNLKQHRDTV 68

Query: 336 HFKNN 340
           H K+N
Sbjct: 69  HGKSN 73

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 10/78 (12%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQC-------QFPGCNQRFSRHDNYIQH 332
           + R Y+C +C + F       RH  +HTG++R+ C          GC ++F+R D   +H
Sbjct: 493 DERPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRH 552

Query: 333 YRTHFKNN---PMPEEQQ 347
           ++T        P+ EE +
Sbjct: 553 FKTELGKKCILPLYEEAE 570

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           Y C IC + FT   +L  H R HT E+ + C    C + F+R  +  +H   H
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLH 519

>Kwal_26.8011
          Length = 190

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 283 KYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           KY C++C + F+ S  L  H   HTG +  +C F  C++ F+   N ++H +TH
Sbjct: 127 KYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH 180

>Kwal_47.16577
          Length = 881

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339
           CS+ F+ S HL RH   H+ EK ++C++P C + FSR D   +H+  H ++
Sbjct: 20  CSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKKHFGRHLRD 69

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 314 CQFPGCNQRFSRHDNYIQHYRTH 336
           C FPGC++ FSR D+  +H   H
Sbjct: 15  CPFPGCSKSFSRSDHLGRHKANH 37

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNN 340
           +K +CK+C R       L  H   HTG++   C+ PGC++ F+   N ++H R H + +
Sbjct: 202 KKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSRGS 260

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           C R FT + HLARH R  TGEK  QC+   CN+ FSR DN  QH
Sbjct: 28  CDRSFTRAEHLARHIRKQTGEKPSQCEV--CNRFFSRIDNLKQH 69

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 275 DLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           + P   + +++C  C + F     L  H+ IH G   + C + GC++RF+   N ++HYR
Sbjct: 209 EAPARPKLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYR 268

Query: 335 THFKNN 340
            H K  
Sbjct: 269 IHTKKK 274

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFP-------GCNQRFSRHDNYIQHYR 334
           R +IC IC + F       RH  +HTG+KR+ C          GC ++F+R D   +H++
Sbjct: 595 RPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654

Query: 335 TH 336
           T 
Sbjct: 655 TE 656

 Score = 35.0 bits (79), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           + C +C + FT   +L  H R HT E+   C    C + F+R  +  +H   H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLH 619

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           L   + + C+ C R F    HL RH R +H  EK + C    C ++FSR DN  QH +TH
Sbjct: 412 LDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKR 311
           Y C +C + F+ S +L++H + HT E +
Sbjct: 447 YGCHLCGKKFSRSDNLSQHLKTHTHEDK 474

>Scas_710.9
          Length = 505

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337
             +RK  CK+C +  T +  L  H  IHTG +   C +PGC + F+   N  +H + H 
Sbjct: 442 TRKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHL 500

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R ++C  C+RGF    HL RH   HT EK + C F  C + F+R D  ++H
Sbjct: 149 RPFLCPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           +++ C+ C R F    HL RH R +H  EK   C    CN+ FSR DN  QH +TH
Sbjct: 387 KQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>Scas_707.31
          Length = 289

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 36/68 (52%), Gaps = 11/68 (16%)

Query: 282 RKYICKICSRGFTTSGHLARHNR-IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNN 340
           ++Y C +C + F    HL RH R IH   +  +C    C++RFSR+DN  QH R H    
Sbjct: 221 KQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSV--CHKRFSRNDNLNQHVRIH---- 274

Query: 341 PMPEEQQP 348
               EQQP
Sbjct: 275 ----EQQP 278

>Scas_717.17
          Length = 525

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT-HF 337
           +E   YIC ICS+ F     L RH   H+ E+ + C  P C  R  R DN +QH +  H 
Sbjct: 383 SENAVYICHICSKNFKRRSWLKRHLLSHSSERHYFC--PWCLSRHKRRDNLLQHMKLKHS 440

Query: 338 KN 339
           KN
Sbjct: 441 KN 442

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 274 KDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHY 333
           +D P  + +++ C  C++ F+ S H  RH R H G K  +CQ   C+  F R D   +H 
Sbjct: 2   QDQPTGKTKRHFCSFCNKAFSRSEHKTRHERSHAGVKPFECQV--CSHSFVRRDLLQRHI 59

Query: 334 RT 335
           RT
Sbjct: 60  RT 61

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 3/31 (9%)

Query: 307 TGE-KRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           TG+ KRH C F  CN+ FSR ++  +H R+H
Sbjct: 6   TGKTKRHFCSF--CNKAFSRSEHKTRHERSH 34

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           + + C+ C + FT +G+L  H R+HTGE+  +C    C++ F+R  N   H  TH
Sbjct: 506 KPFECEFCGKRFTQAGNLRTHRRLHTGERPFKCD--KCDKTFARRGNLTAHEFTH 558

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPM 342
           Y C  CS+ F+ S HL  H + H G K  +C+F  C +RF++  N   H R H    P 
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLHTGERPF 536

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 23/52 (44%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
            R + C  C + F   G+L  H   H   K + C+   C +RFS+  N   H
Sbjct: 533 ERPFKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSH 584

>Scas_717.17d
          Length = 350

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           + +IC +C +  T S  L  H  IHTG +  +C +P C    S   N  +H+++H K
Sbjct: 283 KLHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLK 339

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 285 ICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           IC  C + FT    L  H  +H+G+K  +C + GCN++F+   N I+H + H
Sbjct: 233 ICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           R ++C ICSRGF    HL RH   HT EK   C    C + F+R D  ++H +
Sbjct: 25  RPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCLI--CGKCFARKDLVLRHLQ 75

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 2/63 (3%)

Query: 282 RKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339
           RKY+C+I  C R F+    LA+H   HT E+ + C  P C +RF R  +   H  TH + 
Sbjct: 55  RKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLRPCHLRVHKWTHAQV 114

Query: 340 NPM 342
            P+
Sbjct: 115 KPL 117

>Kwal_14.2206
          Length = 254

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           C+IC + F+    L+ H  IHTG + + C  P C +RF+   N ++H + H K
Sbjct: 196 CRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 268 GKQSNTKDLPLAERRKYIC---KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFS 324
           GKQ        + +R Y C     C+  F  + HLARH R HTGEK  QC    C + FS
Sbjct: 3   GKQPKRNKDNASVKRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNI--CLKFFS 60

Query: 325 RHDNYIQH 332
           R DN  QH
Sbjct: 61  RIDNLRQH 68

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           ++ + Y CK C R F++   L +H R H+GEK ++C    CN++F+   +   H RTH  
Sbjct: 763 SKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTG 820

Query: 339 NNPM 342
             P+
Sbjct: 821 EKPL 824

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
            + Y C IC++ F  S  L  H R HTGEK  QC+   C +RF+   N  +H +TH K
Sbjct: 793 EKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQK 848

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           C R F     L RH ++H+  K ++C+   C + FS  +  +QH RTH    P
Sbjct: 745 CHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTHSGEKP 795

 Score = 32.3 bits (72), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 277 PLAERRKYICKI--CSRGFTTSGHLARH-NRIHT--GEKRHQCQFPGCNQRFSRHDNYIQ 331
           P+ +  + IC+   C++ F+++  L  H   +H   G+  +QC +  C++ F +    I+
Sbjct: 698 PIKQPEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIR 757

Query: 332 HYRTHFKNNP 341
           H + H K  P
Sbjct: 758 HLKVHSKYKP 767

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           C +C +       L  H  IHTG +   C++PGC +RF+   N ++HYR H
Sbjct: 276 CPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLH 326

>Kwal_27.11460
          Length = 531

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFP-------GCNQRFSRHDNYIQH 332
           + R + C IC + F       RH  +HTG+KR+ C          GC ++F+R D   +H
Sbjct: 437 DERPFSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRH 496

Query: 333 YRTH 336
           ++T 
Sbjct: 497 FKTE 500

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           Y C++C + FT   +L  H R HT E+   C    C + F+R  +  +H   H
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLH 463

>Kwal_14.2543
          Length = 711

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
            + Y C  C +GF TS  L  H R HTGEK  +C+   C +RF+   N  +H RTH
Sbjct: 631 EKPYKCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTH 684

 Score = 35.4 bits (80), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 4/63 (6%)

Query: 281 RRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           +  Y+C    C R  T    L RH R+HT  K   C+   C + FS  D   QH RTH  
Sbjct: 573 KSSYVCGWENCGRVITQRQKLLRHLRVHTRYK--PCKCVHCLKTFSTQDILQQHMRTHSG 630

Query: 339 NNP 341
             P
Sbjct: 631 EKP 633

 Score = 35.0 bits (79), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPM 342
           C  C + F+T   L +H R H+GEK ++C    C + F+   +   H RTH    P+
Sbjct: 608 CVHCLKTFSTQDILQQHMRTHSGEKPYKCSH--CGKGFATSSSLRIHIRTHTGEKPL 662

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 259 SQQHKISNTGKQSNTKDLP-LAERRKYICK--ICSRGFTTSGHLARH---NRIHTGEKRH 312
           S+QH + + G       +P   + +K+IC+   C + F++   L  H     I  G+  +
Sbjct: 517 SEQHHLLHCGTCHTNSLIPNETDNQKHICRWDACMQEFSSCEELNTHIEKEHIPRGKSSY 576

Query: 313 QCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
            C +  C +  ++    ++H R H +  P
Sbjct: 577 VCGWENCGRVITQRQKLLRHLRVHTRYKP 605

>Scas_707.46
          Length = 338

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%)

Query: 274 KDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHY 333
           K+L LA R +  C +C +  +    L  H  IHTG+   +C +  CN+ F+   N ++H 
Sbjct: 260 KNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHL 319

Query: 334 RTHFK 338
           ++H K
Sbjct: 320 KSHQK 324

>Scas_695.2
          Length = 571

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 10/74 (13%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFP-------GCNQRFSRHDNYIQHYRTH 336
           ++C IC + F       RH  +HTG+KR+ C          GC+++F+R D   +H++T 
Sbjct: 480 FVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFKTD 539

Query: 337 FKNN---PMPEEQQ 347
                  P+ EE Q
Sbjct: 540 SGRKCIAPLYEEAQ 553

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           Y C++C + FT   +L  H R HT E    C    C + F+R  +  +H   H
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLH 502

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%)

Query: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           C +C R  T    L  H  IHTGE   QC +PGC++RF+   N  +H  +H
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSH 310

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQC-------QFPGCNQRFSRHDNYIQH 332
           + R + C +C + F       RH  +H+G+KR+ C          GC ++F+R D   +H
Sbjct: 450 DERPFSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRH 509

Query: 333 YRT 335
           ++T
Sbjct: 510 FKT 512

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           Y C +C + FT   +L  H R HT E+   C    C + F+R  +  +H   H
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLH 476

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT-HFKNN 340
           C   F+ + HLARH R HTGEK  +C    C + FSR DN  QH  T H K+N
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQHKDTVHAKDN 83

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 309 EKRHQCQ-FPGCNQRFSRHDNYIQHYRTHFKNNPM 342
           EK  +C  +PGC   FSR ++  +H R H    P 
Sbjct: 22  EKNFKCTGYPGCEMSFSRAEHLARHIRRHTGEKPF 56

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%)

Query: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339
           C IC + FT    L  H  IHT  K ++C +  CN+ F+   N  +H R H +N
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKRN 171

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           C   FT   HLARH R HTGE+  QC    C + FSR DN  QH  +
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHL--CLRFFSRLDNLKQHVES 72

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 285 ICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           +C+IC + F     L  H  +H  +K + C+  GC +RF+   N ++H R H
Sbjct: 226 VCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
            R + C  C++ F TS  L  H R HTGEK  +C+   C +RF+   N  +H +TH
Sbjct: 683 ERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTH 736

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPM 342
           CS+ FT    L RH ++H+G K  +C  P C ++FS  D   QH RTH    P 
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKC--PHCTKKFSTEDILQQHIRTHSGERPF 686

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           + + C  C++ F+T   L +H R H+GE+  +C +  C ++F+   +   H RTH    P
Sbjct: 656 KPFKCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTHTGEKP 713

Query: 342 M 342
           +
Sbjct: 714 L 714

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           Y C  C + F     L  H  IH G     C++P C+++F+   N ++HYR+H
Sbjct: 216 YCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSH 268

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 282 RKYICKICSRGFTTSGHLARH-NRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           + + C+IC   F +S HL RH N +H+ EK + C  P C++ F R D+  QH +
Sbjct: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611

>Scas_656.1*
          Length = 102

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           C IC +  T S  L  H  +HTG++  +C++  C + F+   N  +HY+ H K
Sbjct: 42  CPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPM 342
           Y C  C + F+T   L +H R+H+GEK ++C    C++RF+  ++   H RTH    P+
Sbjct: 597 YQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHI--CHKRFAISNSLKIHIRTHTGEKPL 653

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           Y C IC + F  S  L  H R HTGEK  +C+   C + F+   N  +H +TH K
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMK 677

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 8/79 (10%)

Query: 271 SNTKDLP---LAERRKYICKI--CSRGFTTSGHLARH-NRIHT--GEKRHQCQFPGCNQR 322
           S +K LP     +  ++ CK   C+  F ++G L  H   +H   G+ ++ C++ GCN+ 
Sbjct: 518 SRSKKLPEPTKPDETEFCCKWAGCNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKT 577

Query: 323 FSRHDNYIQHYRTHFKNNP 341
           FS+    ++H + H K  P
Sbjct: 578 FSQRQKLVRHLKVHSKYKP 596

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 281 RRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           + +Y C+   C++ F+    L RH ++H+  K +QC  P C + FS  D   QH R H  
Sbjct: 564 KSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQC--PQCQKCFSTEDTLNQHKRVHSG 621

Query: 339 NNP 341
             P
Sbjct: 622 EKP 624

>Scas_711.56
          Length = 832

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 271 SNTKDLPLAER-----RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSR 325
           SN + L   ER     + + C IC + F  S  L  H R HTGEK   C+   C + F+ 
Sbjct: 736 SNEETLKQHERTHSGEKPFKCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNE 793

Query: 326 HDNYIQHYRTHFK 338
             N  +H +TH K
Sbjct: 794 SSNLSKHMKTHLK 806

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           + + C IC + F+    L +H R H+GEK  +C    C +RF+   +   H RTH    P
Sbjct: 724 KPFQCSICKKHFSNEETLKQHERTHSGEKPFKCDI--CGKRFAISSSLKIHIRTHTGEKP 781

Query: 342 M 342
           +
Sbjct: 782 L 782

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 4/67 (5%)

Query: 278 LAERRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           L  + +Y C    C + F+    L RH R+H+G K  QC    C + FS  +   QH RT
Sbjct: 690 LKGQSQYECHWANCHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERT 747

Query: 336 HFKNNPM 342
           H    P 
Sbjct: 748 HSGEKPF 754

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 289 CSRGFTTSGHLARHNR---IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           CS  F+++  L  H     +  G+ +++C +  C++ FS+    ++H R H
Sbjct: 670 CSGSFSSAQELNIHMENMHLLKGQSQYECHWANCHKIFSQRQRLVRHMRVH 720

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%)

Query: 274 KDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHY 333
           K L    + +  C IC +  +    L  H  IHTG+   +C +  CN+ F+   N ++H 
Sbjct: 175 KQLRAVVKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHL 234

Query: 334 RTHFKN 339
           RTH K 
Sbjct: 235 RTHQKK 240

>Scas_719.68
          Length = 1350

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           R ++C IC+R    + HL RH R HT EK   C F  C + F+R D  +  Y+T   ++ 
Sbjct: 39  RPFLCPICTR----TEHLKRHQRSHTREKPFVCVF--CGRCFARRD-LVLRYQTKLHSSI 91

Query: 342 M 342
           M
Sbjct: 92  M 92

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 285 IC-KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           +C KICSR  T    L  H  IHTG+   +C + GC + F+   N ++H ++H
Sbjct: 258 VCGKICSRPST----LKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSH 306

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 258 ASQQHKISNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFP 317
           A  + +I  T +Q       L ++     KICSR  T   H+     IHTG+   +C + 
Sbjct: 262 AMTKQEIKLTKRQLKKATTRLRKQCPVCGKICSRPSTLKTHIL----IHTGDTPFKCTWK 317

Query: 318 GCNQRFSRHDNYIQHYRTHFKNN 340
            C + F+   N ++H ++H KN+
Sbjct: 318 DCRKAFNVKSNLLRHLKSHEKNS 340

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 11/69 (15%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQF--------PGCNQR--FSRHDNY 329
           +R KY+C  C   F   G+L RH + H  EK + C F          C+    FSR D Y
Sbjct: 158 QRGKYVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTY 217

Query: 330 IQHYRT-HF 337
             H ++ HF
Sbjct: 218 KTHLKSRHF 226

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 282 RKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339
           +KY+C +  C + ++    L +H R HT E+   C+ PGC + F R  +   H  +H + 
Sbjct: 6   KKYLCSVDGCGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQV 65

Query: 340 NPM 342
            P+
Sbjct: 66  KPL 68

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 281 RRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
            R ++C+   C +GF  + HL  H   H+  K   C  P C++ F+ +    +H +TH K
Sbjct: 35  ERPFVCEEPGCGKGFLRASHLKVHKWSHSQVKPLAC--PVCSKGFTTNQQLSRHKKTH-K 91

Query: 339 NNPMPEEQQ 347
           + P P ++Q
Sbjct: 92  DLPSPPQEQ 100

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 6/38 (15%)

Query: 269 KQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIH 306
           K S+++  PLA      C +CS+GFTT+  L+RH + H
Sbjct: 59  KWSHSQVKPLA------CPVCSKGFTTNQQLSRHKKTH 90

>Scas_712.2
          Length = 327

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 279 AERRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           ++++ Y C+   C R FT    L +H   HT E+ + C   GC +RF R  +   H  TH
Sbjct: 8   SKKKVYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTH 67

Query: 337 FKNNPM 342
            K  P+
Sbjct: 68  SKVKPL 73

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 11/66 (16%)

Query: 283 KYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCN----QR------FSRHDNYIQH 332
           K++C  C   F   G+L RH + H  EK + C F   +    +R      FSR D+Y  H
Sbjct: 241 KFVCHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTH 300

Query: 333 YRT-HF 337
            R+ HF
Sbjct: 301 LRSRHF 306

>Scas_627.6
          Length = 1207

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 8/73 (10%)

Query: 274 KDLPLAERRKYICK--ICSRGFTTSGHLARHNRIHTGEKRHQCQF------PGCNQRFSR 325
           K   LA   +YIC    C++ FT   HL+RH   H  ++   C F        CN+ F R
Sbjct: 32  KSAKLAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTFVR 91

Query: 326 HDNYIQHYRTHFK 338
            D  I+H + H K
Sbjct: 92  KDLLIRHQKRHTK 104

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 11/84 (13%)

Query: 265 SNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQF-------- 316
           S++  Q   +D     + +++C  C   F   G+L RH + H  EK + C F        
Sbjct: 133 SSSAAQLKDEDGDELSKERFVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSHVPPE 192

Query: 317 PGCNQR--FSRHDNYIQHYRT-HF 337
             C+    FSR D Y  H R+ HF
Sbjct: 193 TRCHTTGGFSRRDTYKTHLRSRHF 216

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
            + Y C IC + F+  G+LA H   H   +   C+   CN+ FS+  N   H
Sbjct: 8   EKPYECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSH 59

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%)

Query: 307 TGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPM 342
           TGEK ++C    C +RFSR  N   H  TH K  P 
Sbjct: 6   TGEKPYECDI--CKKRFSRKGNLAAHKMTHGKIRPF 39

>Scas_602.4
          Length = 266

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 287 KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           KICSR  T   H      IHTG+   +C +  CN+ F+   N ++H + H K
Sbjct: 207 KICSRPSTLKAHYL----IHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEK 254

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 292 GFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
            FT + H ARH R HTGEK  QC    C + FSR DN  QH
Sbjct: 2   AFTRAEHHARHIRKHTGEKPFQCDI--CMKFFSRIDNLKQH 40

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 11/74 (14%)

Query: 276 LPLAERRKYICKI-----------CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFS 324
           LP  +  KYI +I           C + F    +   H + H  ++ ++C FPGC + F 
Sbjct: 676 LPREQIDKYILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFV 735

Query: 325 RHDNYIQHYRTHFK 338
           R+ + ++H ++H +
Sbjct: 736 RNHDLLRHKKSHLE 749

 Score = 35.0 bits (79), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 305 IHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +  G K+ QC+F  C +RF+R  N   H +TH  + P
Sbjct: 686 LEIGPKQFQCKFKDCQKRFNRRYNARTHIQTHLCDRP 722

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 5/53 (9%)

Query: 282 RKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           R Y C    C + F  +  L RH + H  EK + C   GC ++F   D+ ++H
Sbjct: 721 RPYKCDFPGCQKAFVRNHDLLRHKKSHL-EKGYSC--AGCGKKFHSEDSLVKH 770

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRH 326
           + R + C  C +G  T   L RH   HT  K   C++ GCN+ F +H
Sbjct: 91  DERPFYCSFCGKGLITRQQLKRHEVTHT--KSFNCEYEGCNESFYKH 135

>Scas_602.4d
          Length = 256

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 12/66 (18%)

Query: 272 NTKDLPLAERRKYIC-KICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYI 330
           NTK+ P       +C K+CSR  T    L  H  IHTG+   +C + GC + F+   N  
Sbjct: 193 NTKECP-------VCGKMCSRPST----LKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMF 241

Query: 331 QHYRTH 336
           +H + H
Sbjct: 242 RHLKCH 247

>Kwal_47.18337
          Length = 536

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 11/68 (16%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQ----------RFSRHDNYI 330
           +++++C  C+  F   G+L RH + H  EK + C F   +            FSR D Y 
Sbjct: 154 QKRFVCHYCNAEFYIRGYLTRHIKKHAVEKAYYCPFFNADAPKDARCHTTGGFSRRDTYK 213

Query: 331 QHYRT-HF 337
            H R+ HF
Sbjct: 214 THLRSRHF 221

>Scas_378.1
          Length = 208

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           Y C +C + F     L RH   H+ ++ + C  P C  +  R DN +QH +
Sbjct: 84  YQCHMCVKSFRRHSWLKRHLLAHSSQRHYSC--PKCVSKHKRKDNLLQHLK 132

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 285 ICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPMPE 344
           IC +C + FT    L  H  IHT  K  +C F  C++ F+   N  +H R H +    P 
Sbjct: 168 ICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIHRQKASPPL 225

Query: 345 EQQPSIN 351
             +P+ +
Sbjct: 226 ATKPACD 232

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 282 RKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339
           ++Y+C I  C + ++    L +H R HT EK   C  PGC++ F R  +   H  +H K 
Sbjct: 6   KRYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSKV 65

Query: 340 NP 341
            P
Sbjct: 66  KP 67

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 4/42 (9%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEK----RHQCQFPGC 319
           + Y C +C +GF T     RH + HT  +     +QC + GC
Sbjct: 66  KPYNCSVCGKGFATKQQFQRHQQTHTQNQDDTSTYQCGYYGC 107

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 30/71 (42%), Gaps = 6/71 (8%)

Query: 264 ISNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRF 323
             N G++     L    R    C +C + F     L RH   H+ ++   C  P CN R 
Sbjct: 518 FGNQGEKIEVSSLAFPHR----CHLCPKLFKRKSWLKRHLLSHSQQRHFLC--PWCNSRH 571

Query: 324 SRHDNYIQHYR 334
            R DN +QH +
Sbjct: 572 KRRDNLLQHMK 582

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 283 KYI--CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNN 340
           KYI  C+ C + F     L RH   H+ ++   C  P C  R  R DN +QH +    N 
Sbjct: 343 KYIHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLC--PWCLSRQKRKDNLLQHMKLKHTNY 400

Query: 341 PMPEEQQPSI 350
            + E ++ +I
Sbjct: 401 LLDELKKNNI 410

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%)

Query: 277 PLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           PL       C +C + FT    L  H  IH   + + C +  CN+ F+   N  +H R H
Sbjct: 69  PLMALNSKTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>Scas_713.52
          Length = 620

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 29/52 (55%)

Query: 285 ICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           + + C + F    ++  H + H  +K + C FPGC + F R+ + ++H ++H
Sbjct: 483 LYEDCGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSH 534

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
            R + C  C + F+TS  L  H R HTGEK   C    C +RF+   N  +H + H
Sbjct: 569 ERPFHCHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIH 622

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPM 342
           C  C + F+T   LA+H R H+GE+   C +  C ++FS   +   H RTH    P+
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTHTGEKPL 600

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 27/65 (41%), Gaps = 6/65 (9%)

Query: 281 RRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQ-CQFPGCNQRFSRHDNYIQHYRTHF 337
           R  Y C    C++ FT    L      H G  RH+ C  P C + FS  D   QH RTH 
Sbjct: 511 RSAYQCNWAGCTKHFTQRQKLFA---PHQGTHRHKPCSCPHCPKTFSTDDILAQHIRTHS 567

Query: 338 KNNPM 342
              P 
Sbjct: 568 GERPF 572

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           L++ RK  C +C +  +    L  H  IHTG+   +C +  C + F+   N ++H + H
Sbjct: 280 LSKLRKQ-CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCH 337

>Kwal_26.8021
          Length = 507

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 2/52 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           Y C +C + F       RH   H+  K + C  P C  R  R DN  QH +T
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSC--PWCQSRHKRRDNLFQHMKT 438

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 13/81 (16%)

Query: 266 NTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQR--- 322
           +T  +S T D    + ++++C  C   F   G+L RH + H  EK + C F    +    
Sbjct: 183 DTKAKSETLD---DDEKEFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSK 239

Query: 323 -------FSRHDNYIQHYRTH 336
                  FSR D Y  H +  
Sbjct: 240 RCHNSGGFSRRDTYKTHMKAR 260

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 273 TKDLPLAERRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYI 330
            K+LP    R Y C    C + F    ++  H + H  ++ ++C + GC++ F R+ + +
Sbjct: 548 VKELP---DRMYECLYPQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLV 604

Query: 331 QHYRTH 336
           +H +TH
Sbjct: 605 RHKKTH 610

 Score = 32.0 bits (71), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 309 EKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           ++ ++C +P C + F R  N   H +TH ++ P
Sbjct: 553 DRMYECLYPQCGKTFKRRYNIRSHIQTHLEDRP 585

>Scas_693.31
          Length = 635

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 280 ERRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           E R Y C    C + F  +  L RH ++H+ EK + C    C ++F+R D  I H
Sbjct: 515 EDRPYACDFPNCDKAFVRNHDLVRHKKVHS-EKSYACP---CGKKFNREDALIVH 565

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 25/48 (52%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           C + F    +   H + H  ++ + C FP C++ F R+ + ++H + H
Sbjct: 496 CGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVH 543

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 290 SRGFTT--SGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +R  TT   G + R+ +    +K  +C +P C + F R  N   H +TH ++ P
Sbjct: 466 TRKLTTLPPGSIDRYVK-ELPDKTFECLYPNCGKHFKRRYNTRSHIQTHLEDRP 518

>Scas_641.24
          Length = 532

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 11/65 (16%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQF--------PGCNQR--FSRHDNYIQHY 333
           +IC  C   F   G+L RH + H  EK + C F          C+    FSR D Y  H 
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHL 242

Query: 334 RT-HF 337
           +  HF
Sbjct: 243 KARHF 247

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query: 276 LPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           +P      Y C +C + F     L RH   H+  K+  C  P C+    R DN +QH +
Sbjct: 298 VPHESHHSYQCHLCEKQFRRKSWLKRHLLSHSNVKKFHC--PWCSSTHKRKDNLLQHLK 354

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 258 ASQQHKISNTGKQSNTKDLPLAERRK-----------YICKI-----------CSRGFTT 295
           A     +SN  + SNT+  P  +R+K           Y+ ++           C + F  
Sbjct: 477 AGDDSNVSNRLQFSNTESSPSRQRKKPTTLPPGYIDRYVKELPDKNFECLFPNCGKFFRR 536

Query: 296 SGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFK 338
             ++  H + H  +K ++C F GC + F R+ +  +H +TH K
Sbjct: 537 RYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 283 KYICK--ICSRGFTTSGHLARHNRIHTGEKRHQCQF------PGCNQRFSRHDNYIQHYR 334
           +Y+C    CS+ FT   HL+RH   H  ++  +C +        CN+ F R D  ++H +
Sbjct: 15  RYVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEK 74

Query: 335 TH 336
            H
Sbjct: 75  RH 76

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 11/70 (15%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPG--------CNQR--FSRHDN 328
           +E   YIC  C   F   G+L RH + H   K + C F          C+    FSR D 
Sbjct: 199 SETLPYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDT 258

Query: 329 YIQHYRT-HF 337
           Y  H ++ HF
Sbjct: 259 YKTHLKSRHF 268

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 37.0 bits (84), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 278 LAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           L E +KY C  C   F  S  L RH R H     + C    C + F+R D   +HY T
Sbjct: 119 LNEDKKYQCDKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHYDT 174

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           C++ F    ++  H + H  ++ + C FPGC + F R+ + I+H  +H
Sbjct: 610 CNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISH 657

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 309 EKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +K  +C +P CN+ F R  N   H +TH ++ P
Sbjct: 600 DKLFECLYPNCNKVFKRRYNIRSHIQTHLQDRP 632

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 28/48 (58%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           C++ F    ++  H + H  ++ + C  PGC++ F R+ + I+H ++H
Sbjct: 557 CTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSH 604

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 309 EKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +K  +C FPGC + F R  N   H +TH ++ P
Sbjct: 547 DKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRP 579

>Scas_717.60d
          Length = 167

 Score = 36.2 bits (82), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 264 ISNTGKQSNTKDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRF 323
            ++ G+ +++    L     + CK CS+ F TS  L +H +    ++   C++  C + F
Sbjct: 79  FTDEGQSADSSCEILTSNELFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEY-NCGKAF 137

Query: 324 SRHDNYIQHY 333
            R D    HY
Sbjct: 138 KRKDQRKSHY 147

>Scas_670.2
          Length = 435

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 8/72 (11%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHT--GEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337
           +RRK  C ICS  +    +L  H   H    ++ H+C  P C + F R+++ I+H + H+
Sbjct: 248 KRRKKQCPICSGYY---ANLTTHKATHLVPEDRPHKC--PICQRGFGRNNDLIRHQKRHW 302

Query: 338 KNNPMPEEQQPS 349
           K + +PE ++ S
Sbjct: 303 K-DALPEGKKAS 313

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQ 313
           E R + C++CSRGF  S  L RH ++H  +  +Q
Sbjct: 407 ETRPFKCEVCSRGFARSNDLIRHKKLHWKDDLNQ 440

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNN 340
           R+K  C +C   F+   +L+ H   H   +    +   C++ F+R ++ I+H + H+K++
Sbjct: 381 RKKKQCPLCGLFFS---NLSTHKSTHLSPETRPFKCEVCSRGFARSNDLIRHKKLHWKDD 437

>Scas_660.12
          Length = 367

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 10/62 (16%)

Query: 283 KYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPG--------CNQR--FSRHDNYIQH 332
           +Y+C  C   F   G+L RH + H  EK + C F          C+    FSR D Y  H
Sbjct: 95  EYVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTH 154

Query: 333 YR 334
            +
Sbjct: 155 LK 156

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 286 CKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334
           C  C + F     L RH   H+  K + C  P C+ R  R DN  QH +
Sbjct: 187 CHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLK 233

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 14/68 (20%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQR------------FSRHD 327
           E+ +++C  C   F   G+L RH + H  +K + C  P  N++            FSR D
Sbjct: 37  EQEEFVCHYCDARFKIRGYLTRHIKKHALQKAYYC--PYYNEKAPPDLRCHNNGGFSRRD 94

Query: 328 NYIQHYRT 335
            Y  H +T
Sbjct: 95  TYKAHMKT 102

>Kwal_56.23925
          Length = 745

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 276 LPLAERRKYICKI-----------CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFS 324
           LP  E  K++ ++           C + F    ++  H + H  ++ + C F GC++ F 
Sbjct: 568 LPPGEIDKFVKELPDKTFECLHPDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFV 627

Query: 325 RHDNYIQHYRTH 336
           R+ + I+H +TH
Sbjct: 628 RNHDLIRHKKTH 639

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 17/33 (51%)

Query: 309 EKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           +K  +C  P C + F R  N   H +TH ++ P
Sbjct: 582 DKTFECLHPDCGKTFRRRYNIRSHIQTHLEDRP 614

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 10/64 (15%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPG--------CNQR--FSRHDNYI 330
             ++IC  C   F   G+L RH + H  EK + C F          C+    FSR D Y 
Sbjct: 157 EEEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYK 216

Query: 331 QHYR 334
            H +
Sbjct: 217 THLK 220

>Kwal_34.15946
          Length = 279

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 7/61 (11%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQR------FSRHDNYIQHYRT-H 336
           + C  C   F   G+L RH + H   K  +C F   + R      FSR D Y  H ++ H
Sbjct: 173 FQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRKDTYKTHLKSIH 232

Query: 337 F 337
           F
Sbjct: 233 F 233

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPG 318
           +++ C+ C R F    HL  H R H G+K +QC++ G
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRSHLGKKPYQCEYCG 648

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           +++ C  CS  F+ S  L RH + H     + C  P C + F+R D   +HY T
Sbjct: 96  KRFKCAKCSLEFSRSSDLRRHEKTHFAILPNIC--PQCGKGFARKDALKRHYDT 147

 Score = 31.2 bits (69), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 307 TGEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337
           TGEKR +C    C+  FSR  +  +H +THF
Sbjct: 93  TGEKRFKC--AKCSLEFSRSSDLRRHEKTHF 121

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 35.8 bits (81), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 2/64 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           R Y C+ C RGFT   HL RH   H+  K   C    C +  +      +H  TH K+  
Sbjct: 148 RAYQCEQCGRGFTKKSHLERHLFSHSETKPFSCTV--CGKGVTTRQQLRRHEITHTKSFK 205

Query: 342 MPEE 345
            P E
Sbjct: 206 CPHE 209

 Score = 35.4 bits (80), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRH 326
           +E + + C +C +G TT   L RH   HT  K  +C   GC + F +H
Sbjct: 173 SETKPFSCTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAFYKH 218

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 35.0 bits (79), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNP 341
           R + C  C++ F    HL RH   H+  K  QC +  C +  +      +H  TH K+  
Sbjct: 78  RAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRHEVTHTKSFI 135

Query: 342 MPEE 345
            PEE
Sbjct: 136 CPEE 139

 Score = 34.7 bits (78), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 2/43 (4%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRH 326
           + C  C +G TT   L RH   HT  K   C   GCN RF +H
Sbjct: 108 FQCSYCGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKH 148

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 35.0 bits (79), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 7/65 (10%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIH-TGEKR-HQCQFPGCNQRFSRHDNYIQHYRTHF 337
           +R+K  C IC   +    +L+ H   H T E R H+C  P C + F+R+++ I+H + H+
Sbjct: 273 QRKKKECPICHNFY---ANLSTHKSTHLTPEDRPHKC--PICQRGFARNNDLIRHKKRHW 327

Query: 338 KNNPM 342
           K+  M
Sbjct: 328 KDEFM 332

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQ 313
           E R + C IC RGF  +  L RH + H  ++  Q
Sbjct: 300 EDRPHKCPICQRGFARNNDLIRHKKRHWKDEFMQ 333

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 283 KYICK--ICSRGFTTSGHLARHNRIHTGEKRHQCQF--PG----CNQRFSRHDNYIQHYR 334
           +Y+C    C + F+   HL RH   H  ++  +C++  P     CN+ F R D  ++H R
Sbjct: 17  RYVCPHPDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQR 76

Query: 335 THFKN 339
            H  N
Sbjct: 77  RHTNN 81

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 275 DLPLAERRKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           D+   + R Y C    C + +     L +H   HT +K + C  PGC ++F R  +   H
Sbjct: 3   DIGRTKSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVH 62

Query: 333 YRTHFKNNP 341
             TH +  P
Sbjct: 63  KWTHSQIKP 71

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           Y C  C   F+ S  L RH ++H+    H C    C + F+R D   +H  T
Sbjct: 95  YSCAKCQLKFSRSSDLRRHEKVHSLVLPHICS--NCGKGFARKDALKRHSNT 144

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 11/73 (15%)

Query: 275 DLPLAERRKYICKI-----------CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRF 323
           +LP  E  +YI K+           C + F    ++  H + H  ++  +C   GC + F
Sbjct: 656 NLPQGEIDQYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAF 715

Query: 324 SRHDNYIQHYRTH 336
            R+ + I+H +TH
Sbjct: 716 VRNHDLIRHKKTH 728

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 309 EKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPM 342
           +K  QC +P C + F+R  N   H +TH ++ P 
Sbjct: 671 DKTFQCLYPECGKLFNRRYNIRSHIQTHLEDRPF 704

>Scas_683.30
          Length = 478

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIH-TGEKR-HQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           RRK  C  C   +    +L+ H   H T E R H+C  P C + F+R+++ I+H + H+K
Sbjct: 284 RRKKQCPTCLNYY---ANLSTHKSTHLTPEDRPHKC--PICERGFARNNDLIRHKKRHWK 338

Query: 339 N 339
           +
Sbjct: 339 D 339

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIH 306
           E R + C IC RGF  +  L RH + H
Sbjct: 310 EDRPHKCPICERGFARNNDLIRHKKRH 336

>Kwal_27.10167
          Length = 285

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 282 RKYICKI--CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339
           +KYIC I  C++ +     L  H   H   +   C  P C +RF R  +   H  TH K 
Sbjct: 33  KKYICPITSCNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRFLRVCHMNVHRWTHSKI 92

Query: 340 NPMPEEQ 346
            P+  E+
Sbjct: 93  KPLKCEE 99

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 286 CKICSRGFTTSGHLARHNRIH 306
           C+ CS+GFTT   L+RH   H
Sbjct: 97  CEECSKGFTTKQQLSRHLATH 117

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 6/66 (9%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQF------PGCNQRFSRHDNYIQH 332
           AER +     C++ F+   HL+RH   H  ++ + C +        CN+ F R D  I+H
Sbjct: 28  AERFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

Query: 333 YRTHFK 338
            + H K
Sbjct: 88  EKRHSK 93

>Kwal_26.9300
          Length = 304

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKN 339
           RRK  C IC   F  +    R + +    K H+C  P C + F+RH++ ++H + H+K+
Sbjct: 143 RRKKECPIC-HNFYANLSTHRSSHLQPENKPHKC--PVCGRGFTRHNDLLRHRKRHWKD 198

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQC 314
           E + + C +C RGFT    L RH + H  ++ + C
Sbjct: 169 ENKPHKCPVCGRGFTRHNDLLRHRKRHWKDEDNSC 203

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           +++ C  C   F  SG L RH ++H     + C    C + F+R D   +H+ T
Sbjct: 145 KRFHCTKCELVFRRSGDLRRHEKVHLPILPNICSL--CGKGFARKDALKRHFGT 196

>Kwal_23.5400
          Length = 429

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 6/56 (10%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPG----CNQRFSRHDNYIQHYRT 335
           + C +C+R F+   HL RH   H+ +K  +C + G      Q+  RH+  I H R+
Sbjct: 81  FQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYCGKGVTTKQQLRRHE--ITHTRS 134

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 279 AERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRH 326
           +E + + C  C +G TT   L RH   HT  +   C   GC + F +H
Sbjct: 104 SEDKPFKCSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESFYKH 149

>AFR531W [3723] [Homologous to ScAFR531W]
           complement(1389487..1390311) [825 bp, 274 aa]
          Length = 274

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 10/62 (16%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQR------FSRHDNYIQHYRTHF 337
           Y C  C   F   G+L RH + H   K  +C +   + R      FSR D     +RTH 
Sbjct: 156 YRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDT----FRTHL 211

Query: 338 KN 339
           K+
Sbjct: 212 KS 213

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 11/80 (13%)

Query: 267 TGKQSNTKDLPLAE----RRKYICKICSRGFTTSGHLARHNRIH-TGEKR-HQCQFPGCN 320
           T ++ N K   LA+    ++K  C IC + F    +L+ H   H T + R H+C    C 
Sbjct: 303 TLQEINLKKALLADYSKTKKKRQCPICHKYF---ANLSTHKSTHLTSQDRPHKCII--CQ 357

Query: 321 QRFSRHDNYIQHYRTHFKNN 340
             F+R+++ I+H + H+K++
Sbjct: 358 SGFARNNDLIRHRKRHWKDD 377

>Scas_568.5
          Length = 199

 Score = 32.0 bits (71), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           ++Y C  C   F  S  L RH + H     H C    C + F+R D   +H+ T
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKAHLLVLPHICS--QCGKGFARKDALKRHFNT 167

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIH 306
           E R + C +CSRGF  S  L RH + H
Sbjct: 184 EDRPHKCSVCSRGFARSNDLLRHKKRH 210

 Score = 32.0 bits (71), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIH-TGEKR-HQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           RRK  C +C   +    +L+ H   H T E R H+C    C++ F+R ++ ++H + H+K
Sbjct: 158 RRKKECPVCHNFY---ANLSTHKSTHLTPEDRPHKCSV--CSRGFARSNDLLRHKKRHWK 212

Query: 339 N 339
           +
Sbjct: 213 D 213

>Kwal_27.11824
          Length = 199

 Score = 32.0 bits (71), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 282 RKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRT 335
           +K+ C  C   F  S  L RH R H     + C    C + F+R D   +H+ T
Sbjct: 117 KKFPCAKCELVFRRSSDLRRHERAHLPILPNICSL--CGKGFARKDALKRHFDT 168

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 32.3 bits (72), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIH 306
           E R + C ICSRGF  S  L RH + H
Sbjct: 150 EARPHKCDICSRGFARSNDLQRHKKRH 176

>Scas_604.4
          Length = 585

 Score = 32.3 bits (72), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 25/59 (42%), Gaps = 2/59 (3%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNNPMPEEQQ 347
           C        H+  H R+H   K   C+   C ++F R  +  +H RTH  +   P + +
Sbjct: 224 CFTKTVKRDHITSHLRVHVPLKPFACK--KCTKKFKRPQDLKKHLRTHLDSAGFPSQTK 280

>Scas_636.14d
          Length = 275

 Score = 32.0 bits (71), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 283 KYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           ++ C  C + + T     +H +    E++H C F  C++ F R D+ I+H
Sbjct: 214 EFPCPHCQKTYRTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261

>Sklu_2154.3 , Contig c2154 4677-5249 reverse complement
          Length = 190

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 7/70 (10%)

Query: 275 DLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQF--PGCNQ----RFSRHDN 328
           +L    R  + C  C   F   G+L RH + H   K + C +  P C       FSR D 
Sbjct: 69  ELGAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRKDT 128

Query: 329 YIQHYRT-HF 337
           +  H ++ HF
Sbjct: 129 FKTHLKSIHF 138

>KLLA0A02629g complement(233822..235501) some similarities with
           sp|P32338 Saccharomyces cerevisiae YGR044c RME1
           zinc-finger transcription factor singleton, hypothetical
           start
          Length = 559

 Score = 32.0 bits (71), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 7/52 (13%)

Query: 275 DLPLAE-------RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGC 319
           D PL E       R  Y C  C   F T    A+H   +  E++++C FP C
Sbjct: 397 DKPLMEAISKKQKRGAYKCAHCPEMFNTIFEFAKHIDEYQVERKYKCPFPLC 448

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 32.0 bits (71), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEK 310
           ++C +C RGF     + RH ++H  +K
Sbjct: 291 FVCSVCQRGFVRQNDVMRHEKMHWKDK 317

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 7/61 (11%)

Query: 281 RRKYICKICSRGFTTSGHLARHNRIH-TGEKR-HQCQFPGCNQRFSRHDNYIQHYRTHFK 338
           R+K  C IC R F  +  L  H   H T E R H+C  P C++ F+R+++ ++H + H+K
Sbjct: 139 RKKKQCPIC-RNFYAN--LTTHKATHLTPEDRPHKC--PICHRGFARNNDLLRHKKRHWK 193

Query: 339 N 339
           +
Sbjct: 194 D 194

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 280 ERRKYICKICSRGFTTSGHLARHNRIHTGEK 310
           E R + C IC RGF  +  L RH + H  ++
Sbjct: 165 EDRPHKCPICHRGFARNNDLLRHKKRHWKDE 195

>Scas_627.17d
          Length = 275

 Score = 31.6 bits (70), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQH 332
           + C  C + + T     +H +    E++H C F  C++ F R D+ I+H
Sbjct: 215 FPCPHCQKTYLTEAQQKKHLKDVHVERKHMCLF--CSRWFKRKDHMIKH 261

>Scas_631.7
          Length = 433

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRH 326
           + C  C +G TT   L RH   HT  K  +C +  C++ + +H
Sbjct: 116 FCCLHCGKGVTTRQQLKRHEVTHT--KSFKCPYENCDEAYYKH 156

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 32/81 (39%), Gaps = 11/81 (13%)

Query: 270 QSNTKDLPLAERRKYICKI--CSRGFTTSGHLARH-NRIHTGEKRHQ-----CQFPGCNQ 321
           +  +KD P   +   ICK   C R F  +  L  H  + H G K  +     CQ+  C  
Sbjct: 142 KDTSKDTP---KETLICKWSHCYREFQQAELLYHHLCQEHVGRKSQKNLQLKCQWDNCTS 198

Query: 322 RFSRHDNYIQHYRTHFKNNPM 342
           +  + D+   H R H    P 
Sbjct: 199 KTEKRDHMTSHLRVHVPLKPF 219

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 10/78 (12%)

Query: 269 KQSNTKDLPLAERRKYICK----ICSRGFTTSGHLARHNRIHTGEKRHQCQFPG------ 318
           K+S T  + + E  +Y  K     C + F+   HL+RH   H  ++  +C +        
Sbjct: 28  KRSKTVSMVVGEDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQP 87

Query: 319 CNQRFSRHDNYIQHYRTH 336
           C + F R D   +H + H
Sbjct: 88  CGKTFVRRDLLNRHEKRH 105

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 19/30 (63%)

Query: 308 GEKRHQCQFPGCNQRFSRHDNYIQHYRTHF 337
           G+ R++C  P C++ FSR ++  +H   H+
Sbjct: 41  GQYRYKCPHPTCDKSFSRQEHLSRHKLNHW 70

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 25/69 (36%), Gaps = 26/69 (37%)

Query: 284 YICKICSRGFTTSGHLARHNRIHTGE------------------KRHQ--------CQFP 317
           + C  C + F    HL RH   HT +                  KRH+        C + 
Sbjct: 137 FKCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSICGKGVTTRQQLKRHEITHTKSFHCSYE 196

Query: 318 GCNQRFSRH 326
           GCN+ F +H
Sbjct: 197 GCNESFYKH 205

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 20/48 (41%), Gaps = 2/48 (4%)

Query: 289 CSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTH 336
           C        H+  H R+H   K   C    CN++F R  +  +H + H
Sbjct: 154 CQTKTVKRDHITSHLRVHVQLKPFACS--TCNKKFKRPQDLKKHLKVH 199

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (41%), Gaps = 6/62 (9%)

Query: 287 KICSRGFTTSGHLARH-NRIHTGEKRHQ-----CQFPGCNQRFSRHDNYIQHYRTHFKNN 340
           K CS  FT+   L  H  + H G K  +     CQ+  C  +  + D+   H R H +  
Sbjct: 116 KGCSLEFTSPELLYHHLCQDHVGRKSQKNLQLNCQWGDCQTKTVKRDHITSHLRVHVQLK 175

Query: 341 PM 342
           P 
Sbjct: 176 PF 177

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.129    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,910,160
Number of extensions: 381120
Number of successful extensions: 2363
Number of sequences better than 10.0: 236
Number of HSP's gapped: 2116
Number of HSP's successfully gapped: 333
Length of query: 352
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 249
Effective length of database: 13,030,455
Effective search space: 3244583295
Effective search space used: 3244583295
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 62 (28.5 bits)