Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18458g1401386592e-90
CAGL0H10274g114953102e-37
Kwal_27.10546104953057e-37
AGR034W159912915e-34
YBR062C115962841e-33
Scas_560.6*1181012608e-30
Scas_625.11274851521e-12
Kwal_56.2311213584991e-05
KLLA0F12166g1528721011e-05
Sklu_1684.114475972e-05
Kwal_27.12327157477993e-05
ABL058C154679959e-05
KLLA0C14344g151881951e-04
Scas_705.4142858913e-04
Sklu_2432.9147556914e-04
YMR247C156277889e-04
Kwal_56.2252251374870.001
YDL008W (APC11)16567840.002
Scas_696.17156478850.002
Kwal_14.1287151864840.002
Scas_713.4557047840.003
KLLA0E07139g11058800.003
Scas_573.9150262840.003
Kwal_55.2205411159800.003
Sklu_2416.811028790.005
AER016C14760800.005
ACL019C57553810.007
CAGL0I04576g14964780.009
YKL034W (TUL1)75863790.011
CAGL0H02651g154489790.013
Scas_585.5*10959750.014
Scas_644.651050780.014
AAL030C153953790.014
KLLA0C05874g55353780.015
Sklu_1785.333135780.016
YOL133W (HRT1)12159750.016
CAGL0E02299g54528780.018
Scas_625.476162770.020
YOL013C (HRD1)55155760.028
ADL181W10844730.033
ABR104W32879740.046
KLLA0E03960g70440740.054
Sklu_2337.232250730.072
Scas_665.139277720.087
CAGL0B05049g147024730.089
KLLA0F25674g757100720.10
KLLA0E17787g16264700.11
Kwal_26.809975058720.11
Sklu_2317.249346720.11
Kwal_56.2390058927720.11
Scas_720.8946959710.12
AFR220W108582710.12
YPR093C28849700.13
Kwal_55.2120627552700.15
Kwal_26.809052046700.15
YLR247C155690700.21
YOL054W40652690.21
CAGL0L01947g757104690.25
CAGL0J03586g41166680.29
YHL010C58546680.31
AGL217W41461680.33
Sklu_2102.175130670.41
YDR265W (PEX10)33761660.47
Kwal_27.1041930032660.52
YDR143C (SAN1)61031660.52
CAGL0M08690g32824660.54
CAGL0E01441g71731660.61
CAGL0K02563g58658650.69
KLLA0E16720g30545640.84
Kwal_55.1999915288630.91
CAGL0I09988g38758641.0
AER208C56350641.1
Scas_718.7712833621.2
AFR275W75330631.4
AGL079C50663631.5
KLLA0C15697g30442621.9
Scas_615.1333032612.6
Kwal_26.803066065612.6
KLLA0F25740g517100612.7
KLLA0C08756g42748603.2
AAR049C44349594.8
Scas_557.175645594.8
Sklu_1676.310124566.1
CAGL0G03553g21048569.4
AER390W316245610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18458g
         (138 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18458g complement(1697871..1698293) some similarities with...   258   2e-90
CAGL0H10274g complement(1003801..1004145) similar to sp|P38239 S...   124   2e-37
Kwal_27.10546                                                         122   7e-37
AGR034W [4344] [Homologous to ScYBR062C - SH] complement(772772....   116   5e-34
YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein ...   114   1e-33
Scas_560.6*                                                           104   8e-30
Scas_625.11                                                            63   1e-12
Kwal_56.23112                                                          43   1e-05
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    44   1e-05
Sklu_1684.1 YDL008W, Contig c1684 226-660                              42   2e-05
Kwal_27.12327                                                          43   3e-05
ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4...    41   9e-05
KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces...    41   1e-04
Scas_705.41                                                            40   3e-04
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              40   4e-04
YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protei...    39   9e-04
Kwal_56.22522                                                          38   0.001
YDL008W (APC11) [849] chr4 (433494..433991) Component of the ana...    37   0.002
Scas_696.17                                                            37   0.002
Kwal_14.1287                                                           37   0.002
Scas_713.45                                                            37   0.003
KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyce...    35   0.003
Scas_573.9                                                             37   0.003
Kwal_55.22054                                                          35   0.003
Sklu_2416.8 YOL133W, Contig c2416 15124-15456                          35   0.005
AER016C [2521] [Homologous to ScYDL008W (APC11) - SH] (659572..6...    35   0.005
ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH] (328044..32...    36   0.007
CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces c...    35   0.009
YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing ...    35   0.011
CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces c...    35   0.013
Scas_585.5*                                                            33   0.014
Scas_644.6                                                             35   0.014
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    35   0.014
KLLA0C05874g complement(520079..521740) weakly similar to sgd|S0...    35   0.015
Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement         35   0.016
YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the Cdc5...    33   0.016
CAGL0E02299g complement(219009..220646) similar to tr|Q08109 Sac...    35   0.018
Scas_625.4                                                             34   0.020
YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiqui...    34   0.028
ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH] complement(...    33   0.033
ABR104W [696] [Homologous to ScYPR093C - SH] complement(574067.....    33   0.046
KLLA0E03960g 369201..371315 some similarities with sp|P22470 Sac...    33   0.054
Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement         33   0.072
Scas_665.1                                                             32   0.087
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    33   0.089
KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces...    32   0.10 
KLLA0E17787g complement(1571018..1571506) similar to sgd|S000216...    32   0.11 
Kwal_26.8099                                                           32   0.11 
Sklu_2317.2 YDR143C, Contig c2317 4002-5483                            32   0.11 
Kwal_56.23900                                                          32   0.11 
Scas_720.89                                                            32   0.12 
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    32   0.12 
YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protei...    32   0.13 
Kwal_55.21206                                                          32   0.15 
Kwal_26.8090                                                           32   0.15 
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    32   0.21 
YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required...    31   0.21 
CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces c...    31   0.25 
CAGL0J03586g complement(341290..342525) similar to sp|P10862 Sac...    31   0.29 
YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein t...    31   0.31 
AGL217W [4095] [Homologous to ScYOL054W - SH] complement(290043....    31   0.33 
Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement          30   0.41 
YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogene...    30   0.47 
Kwal_27.10419                                                          30   0.52 
YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein tha...    30   0.52 
CAGL0M08690g complement(865182..866168) similar to sp|Q05568 Sac...    30   0.54 
CAGL0E01441g 135075..137228 weakly similar to sp|P22470 Saccharo...    30   0.61 
CAGL0K02563g complement(230983..232743) similar to sp|P38748 Sac...    30   0.69 
KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568 S...    29   0.84 
Kwal_55.19999                                                          29   0.91 
CAGL0I09988g complement(951368..952531) similar to tr|Q12161 Sac...    29   1.0  
AER208C [2710] [Homologous to ScYGR077C (PEX8) - SH] (1021972..1...    29   1.1  
Scas_718.77                                                            28   1.2  
AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH] complement...    29   1.4  
AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942) [...    29   1.5  
KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297 Sac...    28   1.9  
Scas_615.13                                                            28   2.6  
Kwal_26.8030                                                           28   2.6  
KLLA0F25740g complement(2389226..2390779) similar to sp|P38748 S...    28   2.7  
KLLA0C08756g complement(765847..767130) weakly similar to sp|P10...    28   3.2  
AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH] (428904..43...    27   4.8  
Scas_557.1                                                             27   4.8  
Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement         26   6.1  
CAGL0G03553g complement(345057..345689) weakly similar to sp|P40...    26   9.4  
AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH] complement...    26   10.0 

>KLLA0F18458g complement(1697871..1698293) some similarities with
           sp|P38239 Saccharomyces cerevisiae YBR062c singleton,
           hypothetical start
          Length = 140

 Score =  258 bits (659), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 126/138 (91%)

Query: 1   MSTPEQXXXXXXXXXXXXNEPVSVDSIAALQELLGSTLEFDQDDQQKGMSETYIDSLPRV 60
           MSTPEQ            NEPVSVDSIAALQELLGSTLEFDQDDQQKGMSETYIDSLPRV
Sbjct: 1   MSTPEQALRSLLRSAYLSNEPVSVDSIAALQELLGSTLEFDQDDQQKGMSETYIDSLPRV 60

Query: 61  PNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRS 120
           PNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRS
Sbjct: 61  PNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRS 120

Query: 121 KKVEIDTSQCELEEDFNM 138
           KKVEIDTSQCELEEDFNM
Sbjct: 121 KKVEIDTSQCELEEDFNM 138

>CAGL0H10274g complement(1003801..1004145) similar to sp|P38239
           Saccharomyces cerevisiae YBR062c, hypothetical start
          Length = 114

 Score =  124 bits (310), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (76%), Gaps = 2/95 (2%)

Query: 46  QKGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWL 105
           ++G S+T+IDSLPR+P  KLK++DTC IC  NF+ D YPLV ++P C HKFD EC+S+WL
Sbjct: 18  KQGCSDTFIDSLPRIPQKKLKSDDTCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWL 77

Query: 106 QNNHTCPMCRDDLRSKK--VEIDTSQCELEEDFNM 138
             N TCPMCRDD+  KK   E+DTS+ ELEED+ M
Sbjct: 78  TKNTTCPMCRDDVTHKKELPELDTSKVELEEDWGM 112

>Kwal_27.10546
          Length = 104

 Score =  122 bits (305), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 72/95 (75%)

Query: 44  DQQKGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSI 103
           ++Q+G  +TYIDSLPRV   KLK  + C+IC CN+ DD YPLV ++P CNH+FDLEC+++
Sbjct: 8   EKQEGCPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAV 67

Query: 104 WLQNNHTCPMCRDDLRSKKVEIDTSQCELEEDFNM 138
           WL  + TCP+CRDD+ S K  +D SQ E+E+D+ M
Sbjct: 68  WLSKSRTCPLCRDDVLSHKPNVDVSQVEMEDDWGM 102

>AGR034W [4344] [Homologous to ScYBR062C - SH]
           complement(772772..773251) [480 bp, 159 aa]
          Length = 159

 Score =  116 bits (291), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 65/91 (71%)

Query: 48  GMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQN 107
           G+ + Y+D+LPRVP  +L   D CAIC C +L+D YPLV ++P C H FDL+C+S+WL  
Sbjct: 67  GVPDGYMDTLPRVPKKRLAEGDNCAICCCGYLEDEYPLVVELPNCGHTFDLQCVSVWLSR 126

Query: 108 NHTCPMCRDDLRSKKVEIDTSQCELEEDFNM 138
           + TCPMCR D+  +K EID S  ELEED+ M
Sbjct: 127 STTCPMCRSDVLVRKPEIDGSAAELEEDWGM 157

>YBR062C (YBR062C) [253] chr2 complement(365936..366283) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.8878p
           [348 bp, 115 aa]
          Length = 115

 Score =  114 bits (284), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (72%), Gaps = 2/96 (2%)

Query: 45  QQKGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIW 104
           +  G  +T+  SLPR+   KLKA D C+IC  N+L+D YPLV ++P C+HKFDLECLS+W
Sbjct: 18  KSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVW 77

Query: 105 LQNNHTCPMCRDDLRSKKV--EIDTSQCELEEDFNM 138
           L  + TCP+CRD++   ++  EIDT++ ELEED+ M
Sbjct: 78  LSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGM 113

>Scas_560.6*
          Length = 118

 Score =  104 bits (260), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 71/101 (70%), Gaps = 4/101 (3%)

Query: 40  FDQDDQQ--KGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFD 97
           F+Q D++  K  SE +I SLPRV  SK K  D C IC C F +D YPL+ ++PRCNH+FD
Sbjct: 18  FEQMDEKNKKHCSEEFIASLPRV-KSKHK-NDECPICCCKFSEDKYPLIVELPRCNHRFD 75

Query: 98  LECLSIWLQNNHTCPMCRDDLRSKKVEIDTSQCELEEDFNM 138
           LEC+S+WL  + TCP+CRD++   K+ IDTS+ E EE + M
Sbjct: 76  LECISVWLSKSVTCPLCRDNVLEHKLNIDTSKTEFEEGWGM 116

>Scas_625.11
          Length = 274

 Score = 63.2 bits (152), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 3/85 (3%)

Query: 53  YIDSLPRVPNSKL-KAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTC 111
           +I+ LPR   ++L  + D C IC+  + DD    +  +P C+H F  EC+ +WLQ N  C
Sbjct: 191 FIEQLPRTNCAELSNSSDECPICRIAYSDDFETEITCLPNCSHHFHFECIKLWLQKNSLC 250

Query: 112 PMCRDDLRSKKVEIDTSQCELEEDF 136
           P+CRD++   K E  T++ +LE D 
Sbjct: 251 PLCRDNVMECKAE--TTEEDLEWDL 273

>Kwal_56.23112
          Length = 135

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 15/84 (17%)

Query: 62  NSKLKAEDTCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWLQN---NH 109
           + ++  ED C IC+         C F  D  PLV  +  CNH F + C+  WL+      
Sbjct: 25  DKEIGDEDLCGICRVSYNGTCPGCRFPGDNCPLV--IGECNHNFHVHCIQQWLETATAKG 82

Query: 110 TCPMCRDDLRSKKVEIDTSQCELE 133
            CPMCR     K+  +  ++C+++
Sbjct: 83  LCPMCRQQFSLKR-GVAINECQMD 105

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 40/72 (55%), Gaps = 7/72 (9%)

Query: 53   YIDSLPRVPNSKLKAED-TCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTC 111
            Y+D+L ++  +    E+ +CA+C      D Y     + +C H F  +C++ W + N +C
Sbjct: 1189 YLDTLGQLKTAIANGENISCAVCYS----DIY--TGSILKCGHFFCKDCVTHWFKKNTSC 1242

Query: 112  PMCRDDLRSKKV 123
            PMC++ + S +V
Sbjct: 1243 PMCKNRMSSSEV 1254

>Sklu_1684.1 YDL008W, Contig c1684 226-660
          Length = 144

 Score = 42.0 bits (97), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 35/75 (46%), Gaps = 15/75 (20%)

Query: 68  EDTCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWL---QNNHTCPMCR 115
           ED C IC+         C +  D  PLV  V  CNH F + C+  WL    +   CPMCR
Sbjct: 33  EDVCGICRVSYNGTCPSCKYPGDECPLV--VGECNHNFHVHCIVQWLDTATSRGLCPMCR 90

Query: 116 DDLRSKK-VEIDTSQ 129
                K+ V I+ SQ
Sbjct: 91  QLFSLKRGVAINDSQ 105

>Kwal_27.12327
          Length = 1574

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 48   GMSETYIDSL---PRVPNSKLKAEDTCAICQCNFLDDPYPLVAKV-PRCNHKFDLECLSI 103
            GM+ + +DSL    +  N      + CAIC          L +KV P CN++F   CL  
Sbjct: 1494 GMNGSVMDSLELFTKNVNLHFSGFEECAICYSILHAVDRKLPSKVCPTCNNRFHGACLYK 1553

Query: 104  WLQ--NNHTCPMCRDDL 118
            W +   N+TCP+CR ++
Sbjct: 1554 WFRSSGNNTCPLCRSEI 1570

>ABL058C [534] [Homologous to ScYMR247C - SH] (288355..292995) [4641
            bp, 1546 aa]
          Length = 1546

 Score = 41.2 bits (95), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 10/79 (12%)

Query: 48   GMSETYIDSLPRVP-NSKLKAEDT--CAICQ--CNFLDDPYPLVAKV-PRCNHKFDLECL 101
            GM+ + +DSL     N +L+  D   CAIC    + +D   P  +KV P C+++F   CL
Sbjct: 1466 GMNGSVVDSLELFTKNVRLQFADFEECAICYSILHVVDRKLP--SKVCPTCSNRFHGACL 1523

Query: 102  SIWLQ--NNHTCPMCRDDL 118
              W +   N+TCP+CR ++
Sbjct: 1524 YKWFKSSGNNTCPLCRGEI 1542

>KLLA0C14344g 1245226..1249782 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c singleton, start by similarity
          Length = 1518

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 48   GMSETYIDSLPRVP-NSKLK--AEDTCAICQCNFLDDPYPLVAKV-PRCNHKFDLECLSI 103
             M+ + +DSL  +  N KL+    + CAIC          L  KV P CN++F   CL  
Sbjct: 1438 NMNGSVVDSLELLSKNVKLQFSGFEECAICYYVLHAIDRKLPTKVCPTCNNRFHGACLYK 1497

Query: 104  WLQN--NHTCPMCRDDLRSKK 122
            W ++  N+TCP+CR +   +K
Sbjct: 1498 WFKSSGNNTCPLCRGEFNLRK 1518

>Scas_705.41
          Length = 428

 Score = 39.7 bits (91), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 60  VPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIW--LQNNHTCPMCR 115
           + +S L+ ++ C IC  + L+D   L  K+  CNHK+  +C+  W    +N  CP+CR
Sbjct: 1   MKSSALEGDNICPIC-FDDLNDTDILQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 6/56 (10%)

Query: 68   EDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRSKKV 123
            E +CA+C           V  V +C H F   C+  WL+ ++TCP+C+ ++   +V
Sbjct: 1162 ELSCAVCFNEIF------VGSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNVTPSEV 1211

>YMR247C (YMR247C) [4203] chr13 complement(763350..768038) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.3079p [4689 bp, 1562 aa]
          Length = 1562

 Score = 38.5 bits (88), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 48   GMSETYIDSLPRVPNS---KLKAEDTCAICQCNFLDDPYPLVAKV-PRCNHKFDLECLSI 103
            GM+ + +DSL     +   +    + CAIC          L +K  P C +KF   CL  
Sbjct: 1482 GMNGSVLDSLELFTKNVHLQFSGFEECAICYSILHAVDRKLPSKTCPTCKNKFHGACLYK 1541

Query: 104  WLQ--NNHTCPMCRDDL 118
            W +   N+TCP+CR ++
Sbjct: 1542 WFRSSGNNTCPLCRSEI 1558

>Kwal_56.22522
          Length = 513

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 55  DSLPRVPNSKLKAED--TCAICQCNFLDDPYPLVAK-VPR---CNHKFDLECLSIWLQNN 108
           + LP V  ++L A D   C +C  + L       AK  P+   CNH   L CL  W++ +
Sbjct: 298 EKLPDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERS 357

Query: 109 HTCPMCRDDLRSKK 122
            TCP+CR  +  KK
Sbjct: 358 QTCPICRVPVFDKK 371

>YDL008W (APC11) [849] chr4 (433494..433991) Component of the
           anaphase-promoting complex (APC), has ubiquitin ligase
           activity and is required for the metaphase-anaphase
           transition [498 bp, 165 aa]
          Length = 165

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 30/67 (44%), Gaps = 14/67 (20%)

Query: 68  EDTCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWL---QNNHTCPMCR 115
           ED C IC+         C F  D  PLV  +  C+H F   C+  WL    +   CPMCR
Sbjct: 38  EDVCGICRASYNGTCPSCKFPGDQCPLVIGL--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95

Query: 116 DDLRSKK 122
              + +K
Sbjct: 96  QTFQLQK 102

>Scas_696.17
          Length = 1564

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 48   GMSETYIDSL---PRVPNSKLKAEDTCAICQ--CNFLDDPYPLVAKVPRCNHKFDLECLS 102
             M+ + +DSL    +  N +    + CAIC    + +D   P     P C +KF   CL 
Sbjct: 1484 AMNGSVLDSLELFSKNVNLQFSGFEECAICYSILHAVDRKLP-TKTCPTCKNKFHGACLY 1542

Query: 103  IWLQN--NHTCPMCRDDL 118
             W ++  N+TCP+CR ++
Sbjct: 1543 KWFRSSGNNTCPLCRSEI 1560

>Kwal_14.1287
          Length = 1518

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 53   YIDSLPRVP-NSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTC 111
            Y+++L R+  N   + + +C IC    L + Y  +  V +C H F  +C+  WL+N+ +C
Sbjct: 1170 YLETLLRLKENLNGEHKFSCTIC----LGEIY--MGSVIKCGHFFCQDCICSWLKNHSSC 1223

Query: 112  PMCR 115
            P+C+
Sbjct: 1224 PLCK 1227

>Scas_713.45
          Length = 570

 Score = 37.0 bits (84), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 5/47 (10%)

Query: 88  KVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRSKKVEIDTSQCELEE 134
           K+P C H F  ECL  W +  +TCP+CR  +     E+DT+Q + ++
Sbjct: 232 KLP-CGHIFGRECLYRWCKLENTCPLCRHVI----AEVDTTQHQAQD 273

>KLLA0E07139g 651474..651806 similar to sgd|S0005493 Saccharomyces
           cerevisiae YOL133w HRT1, start by similarity
          Length = 110

 Score = 35.4 bits (80), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 14/58 (24%)

Query: 69  DTCAICQCNFLDDP-------------YPLVAKVPRCNHKFDLECLSIWLQNNHTCPM 113
           D CAIC+ N + +P             +  VA    CNH F L C++ W+++ + CP+
Sbjct: 42  DNCAICR-NHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPL 98

>Scas_573.9
          Length = 1502

 Score = 37.0 bits (84), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 86   VAKVPRCNHKFDLECLSIWLQNNHTCPMCR----------DDLRSKKVEIDTSQCELEED 135
            +  + +C H F   C++ WL+N   CPMC+             + +K+E DTSQ  + ED
Sbjct: 1200 LGSMLKCGHFFCKRCITSWLKNKKNCPMCKMVTTASEIYNFKFKEEKLEGDTSQ--MNED 1257

Query: 136  FN 137
             N
Sbjct: 1258 LN 1259

>Kwal_55.22054
          Length = 111

 Score = 35.4 bits (80), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 12/59 (20%)

Query: 67  AEDTCAICQCNFLD-----DPYPL-------VAKVPRCNHKFDLECLSIWLQNNHTCPM 113
           A + CAIC+ + ++      P  +       VA    CNH F L C++ WLQ  + CP+
Sbjct: 41  AVENCAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPL 99

>Sklu_2416.8 YOL133W, Contig c2416 15124-15456
          Length = 110

 Score = 35.0 bits (79), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 86  VAKVPRCNHKFDLECLSIWLQNNHTCPM 113
           VA    CNH F L C++ WLQ  + CP+
Sbjct: 71  VAAWGTCNHAFHLHCINKWLQTRNACPL 98

>AER016C [2521] [Homologous to ScYDL008W (APC11) - SH]
           (659572..660015) [444 bp, 147 aa]
          Length = 147

 Score = 35.4 bits (80), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 14/60 (23%)

Query: 68  EDTCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHT---CPMCR 115
           ED C IC+         C    +  PL+  V  C+H F + C+  WL  + +   CPMCR
Sbjct: 35  EDVCGICRGSYNGTCPNCKLPGETCPLI--VGSCHHNFHVHCIYQWLNTSTSKGLCPMCR 92

>ACL019C [1030] [Homologous to ScYOL013C (HRD1) - SH]
           (328044..329771) [1728 bp, 575 aa]
          Length = 575

 Score = 35.8 bits (81), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 12/53 (22%)

Query: 71  CAICQCNFLDDPYPLV--------AKVPRCNHKFDLECLSIWLQNNHTCPMCR 115
           C IC    +DD  P          AK+  C H     CL  W++ + TCP+CR
Sbjct: 320 CIIC----MDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPICR 368

>CAGL0I04576g 408872..409321 similar to tr|Q12157 Saccharomyces
           cerevisiae YDL008w APC11 subunit of the anaphase
           promoting complex, start by similarity
          Length = 149

 Score = 34.7 bits (78), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 14/64 (21%)

Query: 68  EDTCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWL---QNNHTCPMCR 115
           ED C IC+         C +  +   +V  + RC H F + C+S W+    +   CPMCR
Sbjct: 34  EDVCGICRASYHAPCPNCRYPGESCAIV--LGRCGHNFHVHCISRWVDTPTSKGLCPMCR 91

Query: 116 DDLR 119
              +
Sbjct: 92  QKFQ 95

>YKL034W (TUL1) [3222] chr11 (371472..373748) Protein containing a
           C3HC4 type (RING) zinc finger, which may mediate
           protein-protein interactions, has low similarity to
           uncharacterized C. albicans Orf6.5365p [2277 bp, 758 aa]
          Length = 758

 Score = 35.0 bits (79), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 11/63 (17%)

Query: 67  AEDT--CAICQCN--FLDDPYPLVAKVPR-------CNHKFDLECLSIWLQNNHTCPMCR 115
           AE T  CAIC  +     +  P   KV +       CNH F   CL  W+     CP+CR
Sbjct: 693 AEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCR 752

Query: 116 DDL 118
             L
Sbjct: 753 SPL 755

>CAGL0H02651g 238495..243129 similar to sp|Q04781 Saccharomyces
            cerevisiae YMR247c, start by similarity
          Length = 1544

 Score = 35.0 bits (79), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 22/89 (24%)

Query: 48   GMSETYIDSLPRVPNS---KLKAEDTCAICQCNFLDDPYPLVAKVPR---------CNHK 95
            GM+ +  DSL     +   +    + CAIC        Y ++  V R         C +K
Sbjct: 1464 GMNGSVQDSLELFTKNVGLQFSGFEECAIC--------YSILHAVDRKLPTKTCSTCKNK 1515

Query: 96   FDLECLSIWLQ--NNHTCPMCRDDLRSKK 122
            F   CL  W +   N+TCP+CR ++  ++
Sbjct: 1516 FHGACLYKWFRSSGNNTCPLCRSEINFRR 1544

>Scas_585.5*
          Length = 109

 Score = 33.5 bits (75), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 12/59 (20%)

Query: 67  AEDTCAICQCNFL------------DDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPM 113
           A D CAIC+ + +            D     VA    CNH F L C++ W++    CP+
Sbjct: 39  AVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPL 97

>Scas_644.6
          Length = 510

 Score = 34.7 bits (78), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 67  AEDTCAICQCNFLDDPYPLV-AKVPRCNHKFDLECLSIWLQNNHTCPMCR 115
           +++ C +C  + L + +    AK   C H   L CL  W++ + TCP+CR
Sbjct: 349 SDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 35.0 bits (79), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 71   CAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRSKKV 123
            C IC C+  D      A + R  H +  EC+S WL+   +CP+C+   +S ++
Sbjct: 1219 CTICLCDICDG-----AIIGR-GHFYCQECISSWLETKQSCPLCKTQTKSSEL 1265

>KLLA0C05874g complement(520079..521740) weakly similar to
           sgd|S0005373 Saccharomyces cerevisiae YOL013c HRD1
           involved in degradation of HMG2P, start by similarity
          Length = 553

 Score = 34.7 bits (78), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 8/53 (15%)

Query: 69  DTCAICQCNFL------DDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCR 115
           D C +C  +FL       D   +  K+  C H   L CL  W+  + TCP+CR
Sbjct: 351 DICIVCMEDFLPSHQRKSDGKKV--KILPCTHALHLSCLKNWIARSPTCPICR 401

>Sklu_1785.3 YOL054W, Contig c1785 2663-3658 reverse complement
          Length = 331

 Score = 34.7 bits (78), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 4/35 (11%)

Query: 85  LVAKVPRCNHKFDLECLSIWLQNNH----TCPMCR 115
           LV  +  C H +  +C+S WL NN+    TCP CR
Sbjct: 2   LVPVMTSCGHNYCYDCISNWLNNNNATELTCPQCR 36

>YOL133W (HRT1) [4690] chr15 (70324..70689) Activator of the
           Cdc53p-containing SCF-Cdc4p ubiquitin ligase required
           for ubiquitination of Sic1p and for the G1 to S cell
           cycle transition; RING-box protein [366 bp, 121 aa]
          Length = 121

 Score = 33.5 bits (75), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 12/59 (20%)

Query: 67  AEDTCAICQCNFL------------DDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPM 113
           A D CAIC+ + +            D     VA    CNH F L C++ W++    CP+
Sbjct: 51  AVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPL 109

>CAGL0E02299g complement(219009..220646) similar to tr|Q08109
           Saccharomyces cerevisiae YOL013c HRD1, start by
           similarity
          Length = 545

 Score = 34.7 bits (78), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 88  KVPRCNHKFDLECLSIWLQNNHTCPMCR 115
           K+P C H   L CL  W++ + TCP+CR
Sbjct: 374 KLP-CGHVLHLSCLKNWMERSQTCPICR 400

>Scas_625.4
          Length = 761

 Score = 34.3 bits (77), Expect = 0.020,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 9/62 (14%)

Query: 57  LPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRD 116
           +  VP    +AE+T  I Q +++  P         C+H F  +CL  W+     CP+CR 
Sbjct: 706 MSEVPVYIEEAEETHNIDQHSYMVTP---------CDHIFHTDCLENWMGYKLQCPVCRT 756

Query: 117 DL 118
            L
Sbjct: 757 PL 758

>YOL013C (HRD1) [4803] chr15 complement(301380..303035) E3 ubiquitin
           ligase required for endoplasmic reticulum-associated
           degradation of misfolded luminal and integral membrane
           proteins [1656 bp, 551 aa]
          Length = 551

 Score = 33.9 bits (76), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 68  EDTCAICQCNFLDDP----YPLVAKVPR---CNHKFDLECLSIWLQNNHTCPMCR 115
           ++ C IC    +  P    +    K P+   C H   L CL  W++ + TCP+CR
Sbjct: 346 DNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICR 400

>ADL181W [1560] [Homologous to ScYOL133W (HRT1) - SH]
           complement(379684..380010) [327 bp, 108 aa]
          Length = 108

 Score = 32.7 bits (73), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 71  CAICQCNFLDDP-YPLVAKVPRCNHKFDLECLSIWLQNNHTCPM 113
           C  CQ N + D     VA    CNH F L C++ WL   + CP+
Sbjct: 53  CIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPL 96

>ABR104W [696] [Homologous to ScYPR093C - SH]
           complement(574067..575053) [987 bp, 328 aa]
          Length = 328

 Score = 33.1 bits (74), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 12/79 (15%)

Query: 68  EDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQ---NNHTCPMCRDDLR----- 119
           +D C+IC     +     V ++  C H++ L C+  W      N +CP+CR +       
Sbjct: 15  QDECSIC----WESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCRTEASVLVDT 70

Query: 120 SKKVEIDTSQCELEEDFNM 138
             +V+ID S  +L + + +
Sbjct: 71  DHEVKIDLSVGQLLDFYGL 89

>KLLA0E03960g 369201..371315 some similarities with sp|P22470
           Saccharomyces cerevisiae YDR143c SAN1 mating-type
           regulation protein singleton, hypothetical start
          Length = 704

 Score = 33.1 bits (74), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 83  YPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRSKK 122
           Y   A V  C H F  ECL  W   +++CP+CR  + S++
Sbjct: 210 YGHSATVLPCGHVFGRECLYKWTTEHNSCPICRAPILSEE 249

>Sklu_2337.2 YPR093C, Contig c2337 3730-4698 reverse complement
          Length = 322

 Score = 32.7 bits (73), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 10/50 (20%)

Query: 70  TCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHT----CPMCR 115
           TC+IC    L+     + ++  C H++ LEC+  W  +NH+    CP CR
Sbjct: 5   TCSIC----LEALGQNIGRLVTCQHEYHLECIREW--HNHSQDFKCPTCR 48

>Scas_665.1
          Length = 392

 Score = 32.3 bits (72), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 29/77 (37%), Gaps = 13/77 (16%)

Query: 49  MSETYIDSLPRVPNS---KLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWL 105
           +S+  +D   +  N    KL     C IC        Y  V  +  C H +   CL  W+
Sbjct: 5   LSKLVVDRSSKTKNKLIIKLLESAICTICS------EYMFVPMMTSCGHNYCYGCLKSWI 58

Query: 106 QNNH----TCPMCRDDL 118
             N      CP CR D+
Sbjct: 59  STNSKKELACPQCRSDI 75

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 32.7 bits (73), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 92   CNHKFDLECLSIWLQNNHTCPMCR 115
            C H F   C+  WL+N  TCP+C+
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCK 1202

>KLLA0F25674g 2384293..2386566 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w singleton, start by similarity
          Length = 757

 Score = 32.3 bits (72), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 39/100 (39%), Gaps = 14/100 (14%)

Query: 31  QELLGSTLEFDQDDQQKGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPL----- 85
           Q+LLGS     Q     G    Y   +P+    +  +++ C +C    +D P  +     
Sbjct: 657 QDLLGSRWFLPQHVIPDGYH--YHRPVPQSILMEYGSQNNCFVCPICMVDVPVYVEETEE 714

Query: 86  -------VAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDL 118
                     +  C+H F  ECL  W+     CP+CR  L
Sbjct: 715 THKIDAQSYMITPCSHIFHTECLENWMSYKLQCPVCRAPL 754

>KLLA0E17787g complement(1571018..1571506) similar to sgd|S0002166
           Saccharomyces cerevisiae YDL008w APC11 subunit of the
           anaphase promoting complex, start by similarity
          Length = 162

 Score = 31.6 bits (70), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 14/64 (21%)

Query: 70  TCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHT---CPMCRDD 117
            C IC+         C++     P+V  +  CNH F + C+  WL    +   CP+CR  
Sbjct: 58  VCGICRNRYDATCPSCDYPGSGCPIVLGL--CNHNFHVHCIKQWLSTETSKGLCPLCRQG 115

Query: 118 LRSK 121
            + +
Sbjct: 116 FQLR 119

>Kwal_26.8099
          Length = 750

 Score = 32.3 bits (72), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 11/58 (18%)

Query: 71  CAICQCN---FLDDPYPLVAKVPR-------CNHKFDLECLSIWLQNNHTCPMCRDDL 118
           CAIC      ++DD  P   KV +       C+H F  +CL  W+     CP+CR  L
Sbjct: 691 CAICMSEVAVYVDD-IPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 747

>Sklu_2317.2 YDR143C, Contig c2317 4002-5483
          Length = 493

 Score = 32.3 bits (72), Expect = 0.11,   Method: Composition-based stats.
 Identities = 12/46 (26%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 80  DDPYPLVAKVP---RCNHKFDLECLSIWLQNNHTCPMCRDDLRSKK 122
           + P P     P   +C H+F   C+  W + +++CP+CR ++  ++
Sbjct: 126 EKPSPEYKHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGRE 171

>Kwal_56.23900
          Length = 589

 Score = 32.3 bits (72), Expect = 0.11,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 92  CNHKFDLECLSIWLQNNHTCPMCRDDL 118
           C+H F  EC+  W   ++TCP+CR ++
Sbjct: 227 CSHVFGRECIRQWTNLHNTCPICRANI 253

>Scas_720.89
          Length = 469

 Score = 32.0 bits (71), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 9/59 (15%)

Query: 64  KLKAEDT---CAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLR 119
           KL+  DT   C IC+ +FL  P      +  C+H F   C+  +L++N  CP+C ++LR
Sbjct: 18  KLQEIDTLLRCHICK-DFLKVPV-----LTPCSHTFCSLCIREYLKDNSKCPLCLNELR 70

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
           complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 32.0 bits (71), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 10/82 (12%)

Query: 47  KGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKV-PRCNHKFDLECLSIWL 105
           +GM +   D   + PNS    +  C+IC C  +    PL + V  RC H F   CL  ++
Sbjct: 808 EGMPDFIEDFKTKYPNSDALKDLECSICTCEAIS---PLTSVVFTRCGHPFCESCLLEYI 864

Query: 106 Q------NNHTCPMCRDDLRSK 121
           Q      +   CP CR  + S+
Sbjct: 865 QFQNKKGSETICPNCRAAVESR 886

>YPR093C (YPR093C) [5516] chr16 complement(719554..720420) Protein
           containing a C3HC4 type (RING) zinc finger, which may
           mediate protein-protein interactions [867 bp, 288 aa]
          Length = 288

 Score = 31.6 bits (70), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 92  CNHKFDLECLSIWLQN--NHTCPMCRDDLRSKKVEIDTSQCELEEDFNM 138
           C HKF L C+  W +   N  CP+CR  + S  +E+   Q  L  +  M
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICR--VESTHLEVGEGQHALSINLKM 69

>Kwal_55.21206
          Length = 275

 Score = 31.6 bits (70), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 8/52 (15%)

Query: 67  AEDTCAICQCNF--LDDPYPLVAKVPRCNHKFDLECLSIWL-QNNHTCPMCR 115
           +  TCAICQ +F  L++   L      CNH F   C+  W+ +N+  CP+C+
Sbjct: 116 SRTTCAICQEDFNKLNNVCLL-----GCNHVFHTYCIDQWICRNSACCPLCK 162

>Kwal_26.8090
          Length = 520

 Score = 31.6 bits (70), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 70  TCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCR 115
           TC +C    LD     +A +P C H F   CL+ W  N   CP+CR
Sbjct: 226 TCPVC-LERLDSEVTGLATIP-CQHTFHCVCLNKWGDNR--CPVCR 267

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 31.6 bits (70), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 43/90 (47%), Gaps = 9/90 (10%)

Query: 27   IAALQELLGSTLEFDQDDQQKGMSETYIDSLPRVPNSKLKAED-TCAICQCNFLDDPYPL 85
            I  + + LG TL+   ++ +  +   Y+ +L R+ ++    +  +C+IC           
Sbjct: 1196 IRTINKSLGGTLDAKINNIESRL--IYLKNLSRLKDTLNDNQILSCSICLGEVE------ 1247

Query: 86   VAKVPRCNHKFDLECLSIWLQNNHTCPMCR 115
            +  + +C H F   C+  WL+ +  CP+C+
Sbjct: 1248 IGAIIKCGHYFCKSCILTWLRAHSKCPICK 1277

>YOL054W (YOL054W) [4765] chr15 (228612..229832) Protein required
           for normal resistance to NaCl and for normal mating
           efficiency of MATa cells, contains a C3HC4-type zinc
           finger [1221 bp, 406 aa]
          Length = 406

 Score = 31.2 bits (69), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 10/52 (19%)

Query: 71  CAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNH----TCPMCRDDL 118
           C+IC        Y  V  +  C H +   CL+ W  +N      CP CR D+
Sbjct: 30  CSICH------DYMFVPMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDI 75

>CAGL0L01947g 225999..228272 similar to sp|P36096 Saccharomyces
           cerevisiae YKL034w, start by similarity
          Length = 757

 Score = 31.2 bits (69), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 40/104 (38%), Gaps = 11/104 (10%)

Query: 26  SIAALQELLGSTLEFDQDDQQKGMSETYIDSLPRVPNSKLKAEDT--CAICQCNF--LDD 81
           S+   Q++LGS     +    +  S   + SL  +         T  CAIC   F    +
Sbjct: 651 SVLYSQDILGSRWFLPKHSIPEEYSYHRVVSLQHLMEHGGSENHTVDCAICMAEFPVYVE 710

Query: 82  PYPLVAKVPR-------CNHKFDLECLSIWLQNNHTCPMCRDDL 118
             P   +V +       C+H F   CL  W+     CP+CR  L
Sbjct: 711 ELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCRSPL 754

>CAGL0J03586g complement(341290..342525) similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein, hypothetical start
          Length = 411

 Score = 30.8 bits (68), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 71  CAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRSKKVEIDTSQC 130
           C IC+ +FL +P      +  C H F   C+  +L N   CP+C  +LR   +  +    
Sbjct: 27  CHICK-DFLKNPV-----LTPCGHTFCSLCIRGYLSNEPKCPLCLHELRESMLRSEYLVN 80

Query: 131 ELEEDF 136
           E+ E +
Sbjct: 81  EITETY 86

>YHL010C (YHL010C) [2276] chr8 complement(81959..83716) Protein that
           binds in vitro to proteins containing canonical nuclear
           localization signal, has similarity to human BRAP2
           breast cancer-associated protein which may regulate
           protein import into the nucleus [1758 bp, 585 aa]
          Length = 585

 Score = 30.8 bits (68), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 70  TCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCR 115
           TC +C    +D     +  +P C H F  +CL+ W   N  CP+CR
Sbjct: 239 TCPVC-LERMDSETTGLVTIP-CQHTFHCQCLNKW--KNSRCPVCR 280

>AGL217W [4095] [Homologous to ScYOL054W - SH]
           complement(290043..291287) [1245 bp, 414 aa]
          Length = 414

 Score = 30.8 bits (68), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 10/61 (16%)

Query: 64  KLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHT----CPMCRDDLR 119
           KL     C IC        Y  V  +  C H +   C+S WL N  +    CP CR  + 
Sbjct: 31  KLLETTICTICH------DYMYVPVMTGCGHNYCYFCISNWLNNTSSTELNCPQCRSSIT 84

Query: 120 S 120
           S
Sbjct: 85  S 85

>Sklu_2102.1 YKL034W, Contig c2102 417-2672 reverse complement
          Length = 751

 Score = 30.4 bits (67), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 89  VPRCNHKFDLECLSIWLQNNHTCPMCRDDL 118
           V  C H F  +CL  W+     CP+CR  L
Sbjct: 719 VTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>YDR265W (PEX10) [1098] chr4 (998856..999869) Peroxisomal biogenesis
           protein (peroxin) [1014 bp, 337 aa]
          Length = 337

 Score = 30.0 bits (66), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 10/61 (16%)

Query: 55  DSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMC 114
           + LP +P    +A   C +C  N + DP         C H F   CL  W +    CP+C
Sbjct: 274 NQLPFIP----EASRKCILCLMN-MSDP-----SCAPCGHLFCWSCLMSWCKERPECPLC 323

Query: 115 R 115
           R
Sbjct: 324 R 324

>Kwal_27.10419
          Length = 300

 Score = 30.0 bits (66), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 4/32 (12%)

Query: 92  CNHKFDLECLSIWLQNNH----TCPMCRDDLR 119
           C H +  +C+S WL +N+    TCP CR  L+
Sbjct: 9   CGHNYCYDCISNWLVSNNANELTCPQCRSPLK 40

>YDR143C (SAN1) [988] chr4 complement(742036..743868) Protein that
           may antagonize the function of Spt16p and Sir4p [1833
           bp, 610 aa]
          Length = 610

 Score = 30.0 bits (66), Expect = 0.52,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 88  KVPRCNHKFDLECLSIWLQNNHTCPMCRDDL 118
           K+P C H F  EC+  W +  ++CP+CR  +
Sbjct: 254 KLP-CGHIFGRECIYKWSRLENSCPLCRQKI 283

>CAGL0M08690g complement(865182..866168) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w peroxisomal assembly
           protein - peroxin, hypothetical start
          Length = 328

 Score = 30.0 bits (66), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 92  CNHKFDLECLSIWLQNNHTCPMCR 115
           C H F  +C++ W + N  CP+CR
Sbjct: 292 CGHVFCWDCITDWTKENPECPLCR 315

>CAGL0E01441g 135075..137228 weakly similar to sp|P22470
           Saccharomyces cerevisiae YDR143c mating-type regulation
           protein, hypothetical start
          Length = 717

 Score = 30.0 bits (66), Expect = 0.61,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 88  KVPRCNHKFDLECLSIWLQNNHTCPMCRDDL 118
           K+P C H F   CL  W +  ++CP+CR  +
Sbjct: 292 KIP-CGHIFGRSCLYEWTRLENSCPLCRKKI 321

 Score = 27.7 bits (60), Expect = 4.1,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 44  DQQKGMSETYIDSLPRVPNSKL--KAEDTCAICQCNFLDDP 82
           ++ KG++      LP +   +L  K E TC+IC   F+D+P
Sbjct: 146 NRPKGITNEAFKELPVIKIEELPDKTETTCSICYDKFVDEP 186

>CAGL0K02563g complement(230983..232743) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c, hypothetical start
          Length = 586

 Score = 29.6 bits (65), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 70  TCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRSKKVEIDT 127
           TC +C    +D     +  +P C H F  +CL  W   N  CP+CR  L S ++  DT
Sbjct: 246 TCPVC-LERMDSETTGLITIP-CQHTFHCQCLDKW--KNSKCPVCR--LSSFRLSRDT 297

>KLLA0E16720g complement(1481372..1482289) similar to sp|Q05568
           Saccharomyces cerevisiae YDR265w PAS4 peroxisomal
           assembly protein - peroxin singleton, start by
           similarity
          Length = 305

 Score = 29.3 bits (64), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 71  CAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCR 115
           C +C  N++ DP    +  P C H F  +C+  W      CP+CR
Sbjct: 255 CVLC-LNYMLDP----SATP-CGHLFCWDCIMEWTLERQECPLCR 293

>Kwal_55.19999
          Length = 152

 Score = 28.9 bits (63), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 33/88 (37%), Gaps = 10/88 (11%)

Query: 36  STLEFDQDDQQKGMSETYIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHK 95
           ST     D Q + +       +  +P+   K    C +C   F+ DP         C H 
Sbjct: 71  STAGLPTDSQVEHIGLEQASEMSFIPSDSRK----CILCL-GFMLDP-----SCAPCGHV 120

Query: 96  FDLECLSIWLQNNHTCPMCRDDLRSKKV 123
           F  +CL  W      CP+CR    ++ V
Sbjct: 121 FCWKCLLSWCNERPECPLCRQTCHAQNV 148

>CAGL0I09988g complement(951368..952531) similar to tr|Q12161
           Saccharomyces cerevisiae YOL054w, start by similarity
          Length = 387

 Score = 29.3 bits (64), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 21/58 (36%), Gaps = 11/58 (18%)

Query: 63  SKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWL-----QNNHTCPMCR 115
           SKL     C+IC        Y  V     C H +   CL  W      +   +CP CR
Sbjct: 22  SKLLDTTICSICH------DYMFVPMTTECGHSYCYTCLKTWFSSDTNRGGLSCPECR 73

>AER208C [2710] [Homologous to ScYGR077C (PEX8) - SH]
           (1021972..1023663) [1692 bp, 563 aa]
          Length = 563

 Score = 29.3 bits (64), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 11/50 (22%)

Query: 54  IDSLPRVPNSKLKAEDTCAICQCNFLDDPY---------PLVAKVPRCNH 94
           I   P++P   +  E  C I QC F+ D Y          L+A++P+  H
Sbjct: 484 ILQFPKIPTKAVLCE--CLILQCQFVKDKYLSGWLDNCLELIAEIPQPQH 531

>Scas_718.77
          Length = 128

 Score = 28.5 bits (62), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 3/33 (9%)

Query: 89  VPRCNHKFDLECLSIWLQN---NHTCPMCRDDL 118
           V  C H F + C+  WL        CPMCR   
Sbjct: 71  VGTCQHAFHVHCVVPWLATAAARGACPMCRQPF 103

>AFR275W [3467] [Homologous to ScYKL034W (TUL1) - NSH]
           complement(928488..930749) [2262 bp, 753 aa]
          Length = 753

 Score = 28.9 bits (63), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 89  VPRCNHKFDLECLSIWLQNNHTCPMCRDDL 118
           V  C+H F   CL  W+     CP+CR  L
Sbjct: 721 VTPCSHLFHTGCLENWMSYKLQCPVCRAPL 750

>AGL079C [4232] [Homologous to ScYHL010C - SH] (557422..558942)
           [1521 bp, 506 aa]
          Length = 506

 Score = 28.9 bits (63), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 25/63 (39%), Gaps = 4/63 (6%)

Query: 53  YIDSLPRVPNSKLKAEDTCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCP 112
           Y+   P    S +    TC +C      D   L+     C H F  +CL  W   +  CP
Sbjct: 194 YLLRDPFTNGSGMVELPTCPVCLERMDSDTTGLITTA--CQHTFHCQCLDKW--KDGRCP 249

Query: 113 MCR 115
           +CR
Sbjct: 250 VCR 252

>KLLA0C15697g 1360289..1361203 weakly similar to sgd|S0006297
           Saccharomyces cerevisiae YPR093c, start by similarity
          Length = 304

 Score = 28.5 bits (62), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 7/42 (16%)

Query: 92  CNHKFDLECLSIW--LQNNHTCPMCRDDLRSKK-----VEID 126
           C H++ + C+  W    N+  CP CR + +S +     +EID
Sbjct: 23  CEHRYHVSCIRKWHLYSNDFKCPTCRKESKSLRRKHDDIEID 64

>Scas_615.13
          Length = 330

 Score = 28.1 bits (61), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 92  CNHKFDLECLSIWLQNNHTCPMCRDDLRSKKV 123
           C H F  EC+  W +    CP+CR + + +++
Sbjct: 295 CGHIFCWECILDWCKERPECPLCRQECQIQQI 326

>Kwal_26.8030
          Length = 660

 Score = 28.1 bits (61), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 1/65 (1%)

Query: 70  TCAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLRSKKVEIDTSQ 129
           +C IC         P+V   P C H     C   + ++++ CP C+  + + + +     
Sbjct: 385 SCPICGDFMFTSVKPVVYMSP-CGHAIHQHCFDEYTKHSYKCPSCQVSVLNMEAQFRVLD 443

Query: 130 CELEE 134
            E+EE
Sbjct: 444 KEIEE 448

>KLLA0F25740g complement(2389226..2390779) similar to sp|P38748
           Saccharomyces cerevisiae YHL010c singleton, start by
           similarity
          Length = 517

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 41/100 (41%), Gaps = 25/100 (25%)

Query: 27  IAALQELLGSTLEFDQDDQQKGMSETYIDSLP---RVPNSKLKAEDT--------CAICQ 75
           + A++EL+     F +D           D+LP   + P ++  +E +        C +C 
Sbjct: 170 VVAIKELIFHQGMFSEDK----------DALPYMLKYPFTQSSSEQSDGLIELPMCPVC- 218

Query: 76  CNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCR 115
              LD     +   P C H F  +CL  W   N  CP+CR
Sbjct: 219 LEKLDSEVTGLVTTP-CQHTFHCKCLDQW--KNGNCPVCR 255

>KLLA0C08756g complement(765847..767130) weakly similar to sp|P10862
           Saccharomyces cerevisiae YCR066w RAD18 DNA repair
           protein singleton, start by similarity
          Length = 427

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 6/48 (12%)

Query: 71  CAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDL 118
           C IC+ +FL       + +  C H F   C+  +LQ    CP+C  DL
Sbjct: 32  CHICK-DFLK-----ASVLTPCGHSFCSICIRKYLQKESKCPLCLSDL 73

>AAR049C [235] [Homologous to ScYCR066W (RAD18) - SH]
           (428904..430235) [1332 bp, 443 aa]
          Length = 443

 Score = 27.3 bits (59), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 71  CAICQCNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHTCPMCRDDLR 119
           C IC+ + L  P      + +C H F   C+  +L     CP+C  +LR
Sbjct: 32  CHICK-DMLQTPV-----LTQCGHTFCSLCIREYLNKESRCPLCLAELR 74

>Scas_557.1
          Length = 756

 Score = 27.3 bits (59), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 26  SIAALQELLGSTLEFD---QDDQQKGMSETYIDSLPRVPNSKLKA 67
           S+A LQ +L S ++      +D+Q  + ET+   L RV N KL+ 
Sbjct: 367 SVATLQLVLKSFIDIGILYLEDEQYNLRETFSPPLKRVRNGKLRV 411

>Sklu_1676.3 YDR265W, Contig c1676 2766-3071 reverse complement
          Length = 101

 Score = 26.2 bits (56), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 12/24 (50%)

Query: 92  CNHKFDLECLSIWLQNNHTCPMCR 115
           C H F   C+  W +    CP+CR
Sbjct: 66  CGHIFCWNCIINWCKERSECPLCR 89

>CAGL0G03553g complement(345057..345689) weakly similar to sp|P40072
           Saccharomyces cerevisiae YER116c YEU6, hypothetical
           start
          Length = 210

 Score = 26.2 bits (56), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 84  PLVAKVPRCNHKFDLECLSIWLQNNHT------CPMCRDDLRSKKVEI 125
           P VA +  C H F  ECL   + N+ T      C +CR  +  K++++
Sbjct: 153 PDVAIMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQIKM 200

>AER390W [2890] [Homologous to ScYDR265W (PEX10) - SH]
           complement(1370316..1370364,1370423..1371324) [951 bp,
           316 aa]
          Length = 316

 Score = 26.2 bits (56), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 12/24 (50%)

Query: 92  CNHKFDLECLSIWLQNNHTCPMCR 115
           C H F   C+  W    + CP+CR
Sbjct: 281 CGHMFCWACVMQWCNERNECPLCR 304

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,562,987
Number of extensions: 181040
Number of successful extensions: 536
Number of sequences better than 10.0: 95
Number of HSP's gapped: 528
Number of HSP's successfully gapped: 96
Length of query: 138
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 47
Effective length of database: 13,445,871
Effective search space: 631955937
Effective search space used: 631955937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)