Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18436g20720410911e-154
Sklu_2357.42042006212e-82
Kwal_27.105452022126003e-79
YDR041W (RSM10)2032065882e-77
AGR035C2071745804e-76
CAGL0K12056g2351745652e-73
Scas_569.12411835183e-66
Scas_703.4089964860.005
Kwal_33.1303333276623.5
KLLA0E07370g58852616.5
KLLA0A09141g76044607.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18436g
         (204 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomy...   424   e-154
Sklu_2357.4 YDR041W, Contig c2357 5034-5648                           243   2e-82
Kwal_27.10545                                                         235   3e-79
YDR041W (RSM10) [894] chr4 (539798..540409) Component of the mit...   231   2e-77
AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH] (773294..7...   228   4e-76
CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces...   222   2e-73
Scas_569.1                                                            204   3e-66
Scas_703.40                                                            38   0.005
Kwal_33.13033                                                          28   3.5  
KLLA0E07370g complement(669201..670967) similar to sp|P42846 Sac...    28   6.5  
KLLA0A09141g 801373..803655 weakly similar to sp|P38863 Saccharo...    28   7.0  

>KLLA0F18436g 1697109..1697732 similar to sgd|S0002448 Saccharomyces
           cerevisiae YDR041w RSM10 component of the mitochondrial
           ribosomal small subunit, hypothetical start
          Length = 207

 Score =  424 bits (1091), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 204/204 (100%), Positives = 204/204 (100%)

Query: 1   MNMFRQAVRSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIADIQ 60
           MNMFRQAVRSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIADIQ
Sbjct: 1   MNMFRQAVRSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIADIQ 60

Query: 61  LRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFERHT 120
           LRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFERHT
Sbjct: 61  LRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFERHT 120

Query: 121 HARLIRLYDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDGPELENIDISS 180
           HARLIRLYDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDGPELENIDISS
Sbjct: 121 HARLIRLYDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDGPELENIDISS 180

Query: 181 QLQGLDDVVGAKVVELLNNPEFKK 204
           QLQGLDDVVGAKVVELLNNPEFKK
Sbjct: 181 QLQGLDDVVGAKVVELLNNPEFKK 204

>Sklu_2357.4 YDR041W, Contig c2357 5034-5648
          Length = 204

 Score =  243 bits (621), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 121/200 (60%), Positives = 146/200 (73%), Gaps = 18/200 (9%)

Query: 8   VRSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNE 67
           +R F R+QST +  P   P N         V AVYHAPLK+  TH DL+AD+QLRSYDNE
Sbjct: 18  LRQFTRFQSTVA-PPNAFPIN---------VTAVYHAPLKLPITHGDLVADLQLRSYDNE 67

Query: 68  NLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFERHTHARLIRL 127
           NLDFFS F+LRAG+YLG+P+ GPKPLPT+R+RWTVIR+PF  AKSKENFERHTH RLIR+
Sbjct: 68  NLDFFSDFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFERHTHKRLIRV 127

Query: 128 YDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDG---PELENIDISSQLQG 184
           +D N E++E  LSY++KH I GVGIKCN+YQRE + L    D    PELE        + 
Sbjct: 128 WDTNPEVIELWLSYLTKHSIPGVGIKCNVYQREGVRLSDSIDTSVLPELE-----GNTKT 182

Query: 185 LDDVVGAKVVELLNNPEFKK 204
           LD+ VG +VVELLN+PEFKK
Sbjct: 183 LDEAVGERVVELLNDPEFKK 202

>Kwal_27.10545
          Length = 202

 Score =  235 bits (600), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 155/212 (73%), Gaps = 22/212 (10%)

Query: 3   MFRQAV----RSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIAD 58
           MFR ++    R F R+QST+  +    P  AK+ PI   VEAVY+APL+I  TH DLIAD
Sbjct: 1   MFRPSLLAPLRHFARFQSTSVASEA--PNVAKKLPI--NVEAVYYAPLRIPITHGDLIAD 56

Query: 59  IQLRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFER 118
           +QLRSYD+ENLDFF+ F+LRAG+YLG+P+ GPKPLPT+R+RWTVIR+PF  AKSKENFER
Sbjct: 57  LQLRSYDHENLDFFADFILRAGFYLGMPLTGPKPLPTRRERWTVIRSPFAQAKSKENFER 116

Query: 119 HTHARLIRLYDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDGPELENIDI 178
           HTH RLIR++D N E+VE  LSYISKH I GVGIKCNL+Q+E + L         +N++ 
Sbjct: 117 HTHKRLIRVWDTNPEVVELWLSYISKHSIPGVGIKCNLFQKEGLQLS--------QNLEQ 168

Query: 179 SSQLQ------GLDDVVGAKVVELLNNPEFKK 204
           +S LQ       LD+ VG +V+ELLN+  FKK
Sbjct: 169 NSLLQSPGKSNSLDEAVGERVLELLNSENFKK 200

>YDR041W (RSM10) [894] chr4 (539798..540409) Component of the
           mitochondrial ribosomal small subunit [612 bp, 203 aa]
          Length = 203

 Score =  231 bits (588), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 117/206 (56%), Positives = 146/206 (70%), Gaps = 22/206 (10%)

Query: 7   AVRSFVRYQSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDN 66
           A+RSF+R QST               P P  VEAVY+APLK+   + DL+ADIQLRSYDN
Sbjct: 7   ALRSFIRTQSTR--------------PYPVNVEAVYYAPLKLPIKYGDLVADIQLRSYDN 52

Query: 67  ENLDFFSSFVLRAGYYLGIPMKGPKPLPTKRKRWTVIRAPFVMAKSKENFERHTHARLIR 126
           ENLDF+S F+LR GYYLGIP+ GPKPLPT+R+RWTVI++PFV AKSKENFERHTH RLIR
Sbjct: 53  ENLDFYSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPFVHAKSKENFERHTHKRLIR 112

Query: 127 LYDCNTELVETLLSYISKHGISGVGIKCNLYQREPIDLDSKKDGPELE----NIDISSQL 182
            +D N E+++ L++YI+KH ++GVG+KCN +QR  I LD   D   LE    NID    L
Sbjct: 113 AWDTNPEVLQMLIAYITKHSMAGVGMKCNFFQRSEISLDLGSDANGLEKSLSNIDELYSL 172

Query: 183 QGLD----DVVGAKVVELLNNPEFKK 204
           +  D      VG KV+ELL++P+FKK
Sbjct: 173 RNDDKAQTSAVGQKVLELLDSPDFKK 198

>AGR035C [4345] [Homologous to ScYDR041W (RSM10) - SH]
           (773294..773917) [624 bp, 207 aa]
          Length = 207

 Score =  228 bits (580), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 104/174 (59%), Positives = 135/174 (77%), Gaps = 6/174 (3%)

Query: 32  TPIPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNENLDFFSSFVLRAGYYLGIPMKGPK 91
           + +PK V A+Y  PLK+   H DL+AD+QLR++DN++LDFF++F LR GYYLGIPM GPK
Sbjct: 37  SALPKSVHALYFQPLKLPVKHHDLVADLQLRAFDNQSLDFFANFALRVGYYLGIPMTGPK 96

Query: 92  PLPTKRKRWTVIRAPFVMAKSKENFERHTHARLIRLYDCNTELVETLLSYISKHGISGVG 151
           PLPT+R+RWTVIRAPF  AKSKENFERHTH RL+RL+D N E+VE  LSYI+KH ++GVG
Sbjct: 97  PLPTRRERWTVIRAPFAHAKSKENFERHTHKRLLRLWDANPEVVEMFLSYITKHSMAGVG 156

Query: 152 IKCNLYQREPIDLDSKKDGPELENIDIS-SQLQGLDDVVGAKVVELLNNPEFKK 204
           +KCN++QRE + L       EL ++ ++    Q  D+VVGAKV EL+ +PEFKK
Sbjct: 157 MKCNMFQRESVQL-----AQELADVPLAPGAPQTADEVVGAKVAELMQSPEFKK 205

>CAGL0K12056g 1166627..1167334 similar to tr|Q03201 Saccharomyces
           cerevisiae YDR041w RSM10, hypothetical start
          Length = 235

 Score =  222 bits (565), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 133/174 (76%), Gaps = 3/174 (1%)

Query: 34  IPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPL 93
           +P  VEA+Y+APLK   TH  L+AD+QLR+YDNENLDFF  F+LRAGYYLG+PM GPKPL
Sbjct: 57  LPVNVEALYYAPLKNPVTHGHLVADLQLRAYDNENLDFFCDFILRAGYYLGLPMTGPKPL 116

Query: 94  PTKRKRWTVIRAPFVMAKSKENFERHTHARLIRLYDCNTELVETLLSYISKHGISGVGIK 153
           PT+R+RWTVIR+PFV AKSKENFERHTH RLIR++D N E+V+ L+ YI+K+ I+GVG+K
Sbjct: 117 PTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMLVDYITKNSIAGVGLK 176

Query: 154 CNLYQREPIDLDSKKDGPELENIDISSQLQ---GLDDVVGAKVVELLNNPEFKK 204
           C  YQR  +D  S K    +E I+ +  +      ++ +GAKVVELLN P FKK
Sbjct: 177 CTTYQRTTVDAKSGKISDAIEEINSTHNINPSLKENEEIGAKVVELLNTPTFKK 230

>Scas_569.1
          Length = 241

 Score =  204 bits (518), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 100/183 (54%), Positives = 132/183 (72%), Gaps = 14/183 (7%)

Query: 34  IPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNENLDFFSSFVLRAGYYLGIPMKGPKPL 93
           +P  ++AVYHAPL+    + DL+A+IQLRSYDNENLDF+S F LR G+YLGIP+ GPKPL
Sbjct: 59  VPINIKAVYHAPLRNPIKYGDLVAEIQLRSYDNENLDFYSDFALRVGFYLGIPLTGPKPL 118

Query: 94  PTKRKRWTVIRAPFVMAKSKENFERHTHARLIRLYDCNTELVETLLSYISKHGISGVGIK 153
           PT+R+RWTVI++PFV AKSKENFERHTH R+I+++D N+EL+E  +SYI+KH ++GVG+K
Sbjct: 119 PTRRERWTVIKSPFVHAKSKENFERHTHKRIIKVWDTNSELIEMWISYITKHAMAGVGMK 178

Query: 154 CNLYQREPIDLDSKKDGPE-----LENIDISSQLQGLDDV-------VGAKVVELLNNPE 201
           C ++QR PI   SK+D          +  + S +   DDV       V  K+VELL   E
Sbjct: 179 CTVFQRSPI--ASKEDATNGVSSSDSSSVLKSIVNQKDDVKLTDNDLVNEKIVELLGREE 236

Query: 202 FKK 204
           FKK
Sbjct: 237 FKK 239

>Scas_703.40
          Length = 899

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 141 YISKHGIS--GVGIKCNLYQREPIDLDSKKDGPELENIDISSQLQGLDDVVGAKVVELLN 198
           Y+ KHG    G     N+   E  +L+  +DG EL+ + I   +Q L++ + + +V  +N
Sbjct: 721 YMMKHGFGYDGEAKNENITDEEDNELEDNQDGEELQTVHIRHIMQALNETINSNIVNFIN 780

Query: 199 NPEF 202
              F
Sbjct: 781 RSSF 784

>Kwal_33.13033
          Length = 332

 Score = 28.5 bits (62), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 88  KGPKPLPTKRKRWTVIRAPFVMAKSKENFERHTHA------RLIRLYDCNTELVETLLSY 141
           +   P  T R+R +V R+PFV+AKS  + E  T        + +  +  N  +  TLL  
Sbjct: 28  RAGSPSCTSRRR-SVPRSPFVLAKSSGSAEEDTACDSDFAKKPVVHFKSNPAVSATLLEA 86

Query: 142 ISKHGISGVGIKCNLY 157
           +SK+  S +  + +++
Sbjct: 87  VSKYSDSEMDSENDIH 102

>KLLA0E07370g complement(669201..670967) similar to sp|P42846
           Saccharomyces cerevisiae YNL308c KRI1 singleton, start
           by similarity
          Length = 588

 Score = 28.1 bits (61), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%)

Query: 20  LNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIADIQLRSYDNENLDF 71
           LNP +  F   E  + K  +   H P+ ++  HR  + +  + + D+E+L+F
Sbjct: 107 LNPGVKFFEEPEKAVEKLAKTEKHKPVYLKDYHRMNLLNGNVNADDDEDLEF 158

>KLLA0A09141g 801373..803655 weakly similar to sp|P38863
          Saccharomyces cerevisiae YHR172w SPC97 spindle pole
          body component singleton, hypothetical start
          Length = 760

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 20/44 (45%)

Query: 15 QSTTSLNPKILPFNAKETPIPKCVEAVYHAPLKIEPTHRDLIAD 58
          +S   LN K+ PF  +  P P C E +      IE T  D + +
Sbjct: 8  ESVFLLNDKVGPFGRRVNPAPLCSEEIKVRTYPIEKTSNDRVQE 51

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,978,101
Number of extensions: 304858
Number of successful extensions: 794
Number of sequences better than 10.0: 14
Number of HSP's gapped: 788
Number of HSP's successfully gapped: 14
Length of query: 204
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 107
Effective length of database: 13,238,163
Effective search space: 1416483441
Effective search space used: 1416483441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)