Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18414g30129714230.0
Kwal_27.1054330329911351e-157
Sklu_2357.331530511191e-155
YBR061C (TRM7)31030610971e-152
CAGL0H10252g30930510881e-150
Scas_718.4630930510601e-146
AGR036W3063039561e-130
Kwal_33.130548302913233e-33
Scas_642.128392713209e-33
CAGL0B00484g8372123209e-33
AFR734C8452133191e-32
YCL054W (SPB1)8412123181e-32
KLLA0C00737g8332123092e-31
Sklu_2421.108492123074e-31
KLLA0B01980g2892471798e-15
CAGL0H08954g2812411391e-09
AFL117C3031051311e-08
Kwal_56.241583071061196e-07
Sklu_2160.23151421142e-06
YGL136C (MRM2)3201041072e-05
Scas_720.463211021062e-05
YPL103C46828644.8
Kwal_56.2317143862635.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18414g
         (297 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18414g complement(1695869..1696774) similar to sp|P38238 S...   552   0.0  
Kwal_27.10543                                                         441   e-157
Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement        435   e-155
YBR061C (TRM7) [252] chr2 complement(364747..365679) Methyltrans...   427   e-152
CAGL0H10252g complement(1002563..1003492) highly similar to sp|P...   423   e-150
Scas_718.46                                                           412   e-146
AGR036W [4346] [Homologous to ScYBR061C - SH] complement(774279....   372   e-130
Kwal_33.13054                                                         129   3e-33
Scas_642.12                                                           127   9e-33
CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomy...   127   9e-33
AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH] (1785487..1...   127   1e-32
YCL054W (SPB1) [493] chr3 (31449..33974) Putative S-adenosyl-met...   127   1e-32
KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces cer...   123   2e-31
Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement     122   4e-31
KLLA0B01980g complement(173710..174579) similar to sp|P53123 Sac...    74   8e-15
CAGL0H08954g complement(875104..875949) similar to sp|P53123 Sac...    58   1e-09
AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH] (218993..21...    55   1e-08
Kwal_56.24158                                                          50   6e-07
Sklu_2160.2 YGL136C, Contig c2160 1404-2351                            49   2e-06
YGL136C (MRM2) [1851] chr7 complement(252900..253862) Methyltran...    46   2e-05
Scas_720.46                                                            45   2e-05
YPL103C (YPL103C) [5341] chr16 complement(357995..359401) Protei...    29   4.8  
Kwal_56.23171                                                          29   5.7  

>KLLA0F18414g complement(1695869..1696774) similar to sp|P38238
           Saccharomyces cerevisiae YBR061c, start by similarity
          Length = 301

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/297 (90%), Positives = 270/297 (90%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQGYRARSA               AVRVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLDDDFHFLQQAVRVVDLCAAPGSWSQVLS 60

Query: 61  RRLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSD 120
           RRLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSD
Sbjct: 61  RRLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSD 120

Query: 121 GAPDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEK 180
           GAPDVTGLHDLDEYV            TCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEK
Sbjct: 121 GAPDVTGLHDLDEYVQQQLILSALQLSTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEK 180

Query: 181 VICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDKCPNY 240
           VICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDKCPNY
Sbjct: 181 VICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDKCPNY 240

Query: 241 HEEPRSIATFIACGGLSSFDSDATYHVDTSTPALDPVQSPTNPPYKKALELKRRGKM 297
           HEEPRSIATFIACGGLSSFDSDATYHVDTSTPALDPVQSPTNPPYKKALELKRRGKM
Sbjct: 241 HEEPRSIATFIACGGLSSFDSDATYHVDTSTPALDPVQSPTNPPYKKALELKRRGKM 297

>Kwal_27.10543
          Length = 303

 Score =  441 bits (1135), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 213/299 (71%), Positives = 240/299 (80%), Gaps = 2/299 (0%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKE+GYRARSA                 RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTRVVDLCAAPGSWSQVLS 60

Query: 61  RRLFPQSSDN-SDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICS 119
           RRLF + ++N   ++IV+VDLQPM PI+NV T+QADITHPKTL  I +LF+G+KADF+CS
Sbjct: 61  RRLFEKDTENKGSKRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEKADFVCS 120

Query: 120 DGAPDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFE 179
           DGAPDVTGLHDLDEYV            TCLLR+GG FVAKIFRGRDIDMLYSQL +LFE
Sbjct: 121 DGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQLSFLFE 180

Query: 180 KVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDKCPN 239
           +V+CAKPRSSRGTSLESFIVCLGY PP NW P LDVN SVEDFFQGCDIG+L L+DK P+
Sbjct: 181 RVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSLDDKLPD 240

Query: 240 YHEEPRSIATFIACGGLSSFDSDATYH-VDTSTPALDPVQSPTNPPYKKALELKRRGKM 297
           YH +PRS+A FI+CGGL SFDSDATYH V      L+PVQ PTNPPYK+ALELKR+GK+
Sbjct: 241 YHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELKRKGKL 299

>Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement
          Length = 315

 Score =  435 bits (1119), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 240/305 (78%), Gaps = 8/305 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQGYRARSA                 RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDNVTRVVDLCAAPGSWSQVLS 60

Query: 61  RRLFPQSSDNSDR---KIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFI 117
           R+LF    +N ++   KIVAVDLQPMSPID+V TLQADITHP TL  I ELF G KADF+
Sbjct: 61  RKLFDNELENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDKADFV 120

Query: 118 CSDGAPDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYL 177
           CSDGAPDVTGLHDLDEYV            TCLL++GG FVAKIFRGRD+DMLYSQLGYL
Sbjct: 121 CSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQLGYL 180

Query: 178 FEKVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDKC 237
           FE+V+CAKPRSSRG+SLESFIVCLGY PP NW P LDVN S+EDFF+GCD+G+L L+D  
Sbjct: 181 FERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTLQDNL 240

Query: 238 PNYHEEPRSIATFIACGGLSSFDSDATYH-VD----TSTPALDPVQSPTNPPYKKALELK 292
             +++EPR+IA F++CGGL SFDSDATYH V+    TS  ALDPVQ+PTNPPYKKALELK
Sbjct: 241 VEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKALELK 300

Query: 293 RRGKM 297
           R GK+
Sbjct: 301 RSGKL 305

>YBR061C (TRM7) [252] chr2 complement(364747..365679)
           Methyltransferase that methylates 2-prime-O-riboses in
           tRNA anticodon loop, required for optimal protein
           synthesis activity, member of the 2-prime-O-RNA
           methyltransferase family which includes Spb1p, Mrm2p,
           and E. coli FtsJ protein [933 bp, 310 aa]
          Length = 310

 Score =  427 bits (1097), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 213/306 (69%), Positives = 241/306 (78%), Gaps = 9/306 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXX--XAVRVVDLCAAPGSWSQV 58
           MGKSSKDKRDLYYRKAKEQGYRARSA                   RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 59  LSRRLFPQS--SDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADF 116
           LSR+LF +S  SD  DRKIV+VDLQPMSPI +V TLQADITHPKTL  I +LF  +KADF
Sbjct: 61  LSRKLFDESPSSDKEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEKADF 120

Query: 117 ICSDGAPDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGY 176
           +CSDGAPDVTGLHDLDEYV             C+L+KGG FVAKIFRGRDIDMLYSQLGY
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQLGY 180

Query: 177 LFEKVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDK 236
           LF+K++CAKPRSSRGTSLE+FIVCLGYNPP+NW PKLDVN+SV++FFQGC + KL + DK
Sbjct: 181 LFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCISDK 240

Query: 237 CPNYHEEPRSIATFIACGGLSSFDSDATYH-----VDTSTPALDPVQSPTNPPYKKALEL 291
             +++EE R+IA F+ACG L SFDSDATYH     V  ++ +LDPVQSPTNPPYKKALEL
Sbjct: 241 LSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKALEL 300

Query: 292 KRRGKM 297
           KR GK+
Sbjct: 301 KRSGKL 306

>CAGL0H10252g complement(1002563..1003492) highly similar to
           sp|P38238 Saccharomyces cerevisiae YBR061c, start by
           similarity
          Length = 309

 Score =  423 bits (1088), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/305 (68%), Positives = 239/305 (78%), Gaps = 8/305 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXX--XAVRVVDLCAAPGSWSQV 58
           MGKSSKDKRDLYYRKAKE+GYRARSA                   RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60

Query: 59  LSRRLFPQ-----SSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKK 113
           LSR+LF +          DRKI+AVDLQPMSPID+VITLQADITHP+TL+ I ELF  +K
Sbjct: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120

Query: 114 ADFICSDGAPDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQ 173
           ADF+CSDGAPDVTGLHDLDEY+            TC+L++GG FVAKIFRGRDIDMLYSQ
Sbjct: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180

Query: 174 LGYLFEKVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRL 233
           LGYLFEK++CAKPRSSRGTSLE+FIVC+GYNPPA WEPKLDVNSSV +FF  CD+GKL +
Sbjct: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240

Query: 234 EDKCPNYHEEPRSIATFIACGGLSSFDSDATYH-VDTSTPALDPVQSPTNPPYKKALELK 292
           +D    + ++PRSIA F+ACG LSS+DSDATYH +     ALDPVQ+PTNPPYK+ALELK
Sbjct: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYKRALELK 300

Query: 293 RRGKM 297
           R GK+
Sbjct: 301 RDGKL 305

>Scas_718.46
          Length = 309

 Score =  412 bits (1060), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 203/305 (66%), Positives = 237/305 (77%), Gaps = 8/305 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXX--XAVRVVDLCAAPGSWSQV 58
           MGK+SKDKRD+YYRKAKEQG+RARSA                   RVVDLCAAPGSWSQV
Sbjct: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 59  LSRRLF--PQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADF 116
           LS++LF    + +  DRKIVAVDLQPMSPI++V TLQADITHPKTL+ I +LF  +KADF
Sbjct: 61  LSQKLFDGKTAEEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEKADF 120

Query: 117 ICSDGAPDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGY 176
           +CSDGAPDVTGLHDLDEYV             C+L+KGG FVAKIFRGRDIDMLYSQLGY
Sbjct: 121 VCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQLGY 180

Query: 177 LFEKVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDK 236
           LF+KV+CAKP+SSRGTSLE+FIVC+GYNPP++W   LDVNSSVE+FF GC + KL + DK
Sbjct: 181 LFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSIHDK 240

Query: 237 CPNYHEEPRSIATFIACGGLSSFDSDATYHVDTS----TPALDPVQSPTNPPYKKALELK 292
            P++ E+ R+IA F++CG L SFDSDATYH+D        +LDPVQSPTNPPYKKALELK
Sbjct: 241 LPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKALELK 300

Query: 293 RRGKM 297
           R GK+
Sbjct: 301 RSGKL 305

>AGR036W [4346] [Homologous to ScYBR061C - SH]
           complement(774279..775199) [921 bp, 306 aa]
          Length = 306

 Score =  372 bits (956), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 221/303 (72%), Gaps = 7/303 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVVDLCAAPGSWSQVLS 60
           MGKSSKDKRDLYYRKAKEQG+RARSA                 RVVDLCAAPGSWSQVLS
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDGVQRVVDLCAAPGSWSQVLS 60

Query: 61  RRLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSD 120
           R LFP    N+ ++IVAVDLQPMS I++V TLQADITHP+TL  I ELF+G+KADF+CSD
Sbjct: 61  RELFPDGK-NTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEKADFVCSD 119

Query: 121 GAPDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEK 180
           GAPDVTGLHDLDEYV              LL  GG FVAKIFRGRDIDMLYSQLG LF+K
Sbjct: 120 GAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQLGLLFDK 179

Query: 181 VICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSV----EDFFQGCDIGK-LRLED 235
           V CAKPRSSRGTSLESFIVC GY PP +W P ++ N SV    E+FFQ   I + L    
Sbjct: 180 VTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVEEFFEEFFQNWSIQQPLTPGR 239

Query: 236 KCPNYHEEPRSIATFIACGGLSSFDSDATYH-VDTSTPALDPVQSPTNPPYKKALELKRR 294
             P Y E  R IA FI+CGGL SFDSDATYH +  S  ALDPVQSPTNPPYK+ALELKR 
Sbjct: 240 PLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYKRALELKRS 299

Query: 295 GKM 297
           GK+
Sbjct: 300 GKL 302

>Kwal_33.13054
          Length = 830

 Score =  129 bits (323), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 133/291 (45%), Gaps = 34/291 (11%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVV-DLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+                 +VV DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFMEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  RLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSDG 121
            L P +S      I+ VD+ PM P+ NVIT Q+DIT       +    +  KAD +  DG
Sbjct: 67  -LCPVNS-----LIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDG 120

Query: 122 APDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKV 181
           AP+V      D +                L  GG FV KIFR +D + L      LF+KV
Sbjct: 121 APNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFSQLFDKV 180

Query: 182 ICAKPRSSRGTSLESFIVCLGYNPPANWEPK-LDVNSSVEDFFQGCDIGKLRL---EDKC 237
              KP +SR  S E F+VC G+  P   +P+ LD     E+   G    + ++   E K 
Sbjct: 181 EATKPPASRNVSAEIFVVCKGFKAPKKLDPRLLDAKEVFEELPDGPQNNEAKIYNPEKKV 240

Query: 238 PN-----------YHEEPRSIATFIAC-------GGLSSF---DSDATYHV 267
                        YH +P  I  F+ C       G L+ F   D+D+ + +
Sbjct: 241 RKRQGYEEGDYLLYHHKP--IMDFVRCEDPIEMLGSLNKFTVDDNDSEWKI 289

>Scas_642.12
          Length = 839

 Score =  127 bits (320), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 126/271 (46%), Gaps = 10/271 (3%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVV-DLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+                 +VV DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  RLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSDG 121
            L P +S      I+ VD+ PM P++N IT Q+DIT       +    +  KAD +  DG
Sbjct: 67  -LCPVNS-----LIIGVDIVPMKPMNNCITFQSDITTEDCRSKLRGYMKTWKADTVLHDG 120

Query: 122 APDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKV 181
           AP+V      D +                L  GG FV K+FR +D + L      LF+KV
Sbjct: 121 APNVGLGWVQDAFTQSQLTLQALKLAAENLVVGGTFVTKVFRSKDYNKLIWVFQQLFDKV 180

Query: 182 ICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRLEDKCPNYH 241
              KP +SR  S E F+VC G+  P   +P+L      ++ F+    G   +E K  N  
Sbjct: 181 EATKPPASRNVSAEIFVVCKGFKAPKRLDPRL---LDPKEVFEELPDGPQNMESKIYNPE 237

Query: 242 EEPRSIATFIACGGLSSFDSDATYHVDTSTP 272
           ++ R    +     L   + D    V T  P
Sbjct: 238 KKVRKRQGYEEGDNLLYHEKDIIEFVKTEDP 268

>CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1, start by similarity
          Length = 837

 Score =  127 bits (320), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 106/212 (50%), Gaps = 7/212 (3%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVV-DLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+                 +VV DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  RLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSDG 121
            L P +S      I+ VD+ PM P+ NVIT Q+DIT       +    +  KAD +  DG
Sbjct: 67  -LCPVNS-----LIIGVDIVPMKPMPNVITFQSDITTEDCRSRLRGYMKTWKADTVLHDG 120

Query: 122 APDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKV 181
           AP+V      D +                L   G FV KIFR +D + L      LFEKV
Sbjct: 121 APNVGLGWAQDAFTQSHLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEKV 180

Query: 182 ICAKPRSSRGTSLESFIVCLGYNPPANWEPKL 213
              KP +SR  S E F+VC G+  P   +P+L
Sbjct: 181 EATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH]
           (1785487..1788024) [2538 bp, 845 aa]
          Length = 845

 Score =  127 bits (319), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 85/213 (39%), Positives = 110/213 (51%), Gaps = 9/213 (4%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVV-DLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+                 +VV DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  RLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSDG 121
            L P +S      I+ VD+ PM P+ NVIT Q+DIT       +    +  KAD +  DG
Sbjct: 67  -LCPVNS-----LIIGVDIVPMQPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDG 120

Query: 122 APDVTGLHDL-DEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEK 180
           AP+V GL+ + D +                L  GG FV KIFR +D + L      LF+K
Sbjct: 121 APNV-GLNWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLMWVFQQLFDK 179

Query: 181 VICAKPRSSRGTSLESFIVCLGYNPPANWEPKL 213
           V   KP +SR  S E F+VC G+  P   +P+L
Sbjct: 180 VEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>YCL054W (SPB1) [493] chr3 (31449..33974) Putative
           S-adenosyl-methionine-dependent methyltransferase
           required for synthesis of the 60S ribosomal subunit,
           member of the 2-prime-O-RNA methyltransferase family,
           which includes Trm7p, Mrm2p, and E. coli FtsJ protein
           [2526 bp, 841 aa]
          Length = 841

 Score =  127 bits (318), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 106/212 (50%), Gaps = 7/212 (3%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVV-DLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+                 +VV DLCAAPGSW QV S+
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASK 66

Query: 62  RLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSDG 121
            L P +S      I+ VD+ PM P+ NVIT Q+DIT       +    +  KAD +  DG
Sbjct: 67  -LCPVNS-----LIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDG 120

Query: 122 APDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKV 181
           AP+V      D +                L   G FV KIFR +D + L      LFEKV
Sbjct: 121 APNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEKV 180

Query: 182 ICAKPRSSRGTSLESFIVCLGYNPPANWEPKL 213
              KP +SR  S E F+VC G+  P   +P+L
Sbjct: 181 EATKPPASRNVSAEIFVVCKGFKAPKRLDPRL 212

>KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1 required for ribosome synthesis,
           putative methylase, start by similarity
          Length = 833

 Score =  123 bits (309), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 104/212 (49%), Gaps = 7/212 (3%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVV-DLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+                 +VV DLCAAPGSW QV S 
Sbjct: 8   KNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASN 67

Query: 62  RLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSDG 121
            L P +S      I+ VD+ PM  + NVIT Q+DIT       +    +  KAD +  DG
Sbjct: 68  -LCPVNS-----LIIGVDIVPMKTMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDG 121

Query: 122 APDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKV 181
           AP+V      D +                L  GG FV KIFR +D + L      LFEKV
Sbjct: 122 APNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVFQQLFEKV 181

Query: 182 ICAKPRSSRGTSLESFIVCLGYNPPANWEPKL 213
              KP +SR  S E F+VC  +  P   +P+L
Sbjct: 182 EATKPPASRNVSAEIFVVCKNFKAPKKLDPRL 213

>Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement
          Length = 849

 Score =  122 bits (307), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 105/212 (49%), Gaps = 7/212 (3%)

Query: 3   KSSKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVV-DLCAAPGSWSQVLSR 61
           K+SK + D YY  AKE+GYRARS+                 +VV DLCAAPGSW QV S 
Sbjct: 7   KNSKGRLDRYYFLAKEKGYRARSSFKIIQINEKFGHFLEKSKVVIDLCAAPGSWCQVASN 66

Query: 62  RLFPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKKADFICSDG 121
            L P +S      I+ VD+ PM  + NVIT Q+DIT       +    +  KAD +  DG
Sbjct: 67  -LCPVNS-----LIIGVDIVPMKSMPNVITFQSDITTEDCRSRLRGYMKTWKADTVLHDG 120

Query: 122 APDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKV 181
           AP+V      D +                L  GG FV K+FR +D + L      LFE+V
Sbjct: 121 APNVGLGWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKVFRSKDYNKLIWLFQQLFERV 180

Query: 182 ICAKPRSSRGTSLESFIVCLGYNPPANWEPKL 213
              KP +SR  S E F+VC G+  P   +P+L
Sbjct: 181 EATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>KLLA0B01980g complement(173710..174579) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c singleton, start by
           similarity
          Length = 289

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 97/247 (39%), Gaps = 55/247 (22%)

Query: 5   SKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVVDLCAAPGSWSQVLSRRLF 64
           ++ K D + + AKEQ +R+R+A                 +V+DL  APG+WSQV  +R+ 
Sbjct: 35  ARQKNDHFTKAAKEQQFRSRAAFKLMDIDDKYRFFKQNQKVLDLGFAPGAWSQVARKRI- 93

Query: 65  PQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTI------------------- 105
                 S   I+ VDL   +P   V +LQA+I   KT + I                   
Sbjct: 94  -----GSGGMIMGVDLLRCTPPKGVYSLQANILSKKTHELIRLCFARHIQLNKHDQLHKD 148

Query: 106 ---------------------TELF---------EGKKADFICSDGAPDVTGLHDLDEYV 135
                                 ELF         E    D + SD   + TG+   D Y+
Sbjct: 149 HGYLQHMLEEELNHLKETEEYKELFSQTDISQNIERYPVDVVLSDMMANTTGIQSKDHYM 208

Query: 136 XXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKVICAKPRSSRGTSLE 195
                         LL+ GG+F  K++ G +  +L  +L  +F+KV   KP +SR  S E
Sbjct: 209 SMDLCDAALIVAIDLLKPGGSFTCKLYAGSEDTLLEKRLKKVFKKVDRFKPNASRNESKE 268

Query: 196 SFIVCLG 202
            + V  G
Sbjct: 269 LYFVARG 275

>CAGL0H08954g complement(875104..875949) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c, hypothetical start
          Length = 281

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 90/241 (37%), Gaps = 53/241 (21%)

Query: 6   KDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAV--RVVDLCAAPGSWSQVLSRRL 63
           + K+D Y R++K    R+R+                +V  R++DL  APG+WSQV  +R 
Sbjct: 32  RQKQDFYTRESKLDNLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKRT 91

Query: 64  FPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGK----------- 112
            P      D  ++ VD+ P  P   V ++QA+I   +T Q I + F  +           
Sbjct: 92  HP------DSIVLGVDILPCDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDSQVESM 145

Query: 113 -------------KADFICSDG---------------------APDVTGLHDLDEYVXXX 138
                          + I SD                        + +GL+  D      
Sbjct: 146 ARNDSDTEQQPQFPVNIILSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDHLNSID 205

Query: 139 XXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKVICAKPRSSRGTSLESFI 198
                      LL   G+F+ K F G +  +   ++  +F++V   KP +SR  S E + 
Sbjct: 206 LCDAALITAVDLLEPAGSFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDESKEIYF 265

Query: 199 V 199
           +
Sbjct: 266 I 266

>AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH]
           (218993..219904) [912 bp, 303 aa]
          Length = 303

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (48%), Gaps = 6/105 (5%)

Query: 5   SKDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVRVVDLCAAPGSWSQVLSRRLF 64
           S+ +RD Y R+AK Q  R+R+A                 RV+DL  APG+WSQV  +R  
Sbjct: 32  SRQRRDPYTREAKVQELRSRAAFKLIEIDEQFRLFRAGQRVLDLGFAPGAWSQVAQQRTQ 91

Query: 65  PQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELF 109
           P        K++ VD+ P  P   V ++QA+    KT + +   F
Sbjct: 92  PGG------KVMGVDVLPCKPPTGVSSIQANALSRKTHELVRLYF 130

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 152 RKGGNFVAKIFRGRDIDMLYSQLGYLFEKVICAKPRSSRGTSLESFIVCL 201
           R GG+FV K++ G++  +L  +L  +F KV   KP + R  S E + V L
Sbjct: 240 RPGGSFVCKLYTGKEDQLLERRLRKVFTKVRRFKPEACRSESKELYFVGL 289

>Kwal_56.24158
          Length = 307

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 50/106 (47%), Gaps = 8/106 (7%)

Query: 6   KDKRDLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXAVR--VVDLCAAPGSWSQVLSRRL 63
           + K D + R AK QG R+R+A                 R  V+DL  APG+WSQV   R 
Sbjct: 35  RQKNDSFTRDAKVQGLRSRAAFKLMQIDDKVHLFRKNARQNVLDLGYAPGAWSQVAFDRT 94

Query: 64  FPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELF 109
            P      D  I+ VD+ P +P   V ++QA+I   KT + I   F
Sbjct: 95  GP------DGVILGVDILPCAPPRGVSSIQANILSRKTHELIRLFF 134

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%)

Query: 120 DGAPDVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFE 179
           D   + +G+   D Y               LL+ GG+FV K++ G++  +L ++L  +F 
Sbjct: 210 DRMANTSGVAIKDHYASMDLCDAALVAAIDLLKPGGSFVCKLYTGKEDRILENRLKQVFN 269

Query: 180 KVICAKPRSSRGTSLESFIVCL 201
           +V   KP +SR  S E + V L
Sbjct: 270 EVQRFKPTASRDESKELYFVGL 291

>Sklu_2160.2 YGL136C, Contig c2160 1404-2351
          Length = 315

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 62/142 (43%), Gaps = 19/142 (13%)

Query: 6   KDKRDLYYRKAKEQGYRARSAXXXXXX--XXXXXXXXXAVRVVDLCAAPGSWSQVLSRRL 63
           + + D Y ++AK Q  R+R+A                 + RV+DL  APG+WSQV   R 
Sbjct: 36  RQRNDFYTKEAKNQDLRSRAAFKLIELDDRFKFFLKNKSQRVLDLGFAPGAWSQVAFDRT 95

Query: 64  FPQSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTI----TELFEGKKADFICS 119
            P         ++ VD+ P  P   V ++QA+I   KT + I    ++ F+  + D +  
Sbjct: 96  KPNGM------VLGVDILPCKPPRGVSSIQANILSRKTHELIRLFFSKHFQINRHDELHE 149

Query: 120 DGA-------PDVTGLHDLDEY 134
           D          D+  L   DEY
Sbjct: 150 DHGYFQHMLEEDLKNLKQTDEY 171

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 39/79 (49%)

Query: 124 DVTGLHDLDEYVXXXXXXXXXXXXTCLLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKVIC 183
           + TG+   D Y+              LLR GG+F  K++ G++  +L  ++  +F KV  
Sbjct: 224 NTTGVAIKDHYMSMDLCDAALVVAIDLLRPGGSFACKVYTGKEDKLLEKRMKMVFSKVCR 283

Query: 184 AKPRSSRGTSLESFIVCLG 202
            KP SSR  S E + V LG
Sbjct: 284 FKPDSSRNESKELYFVGLG 302

>YGL136C (MRM2) [1851] chr7 complement(252900..253862)
           Methyltransferase that methylates mitochondrial 21S rRNA
           at nucleotide U2791, member of the 2-prime-O-RNA
           methyltransferase family, which includes Trm7p, Spb1p,
           and E. coli FtsJ protein [963 bp, 320 aa]
          Length = 320

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 9/104 (8%)

Query: 9   RDLYYRKAKEQGYRARSAXXXXX---XXXXXXXXXXAVRVVDLCAAPGSWSQVLSRRLFP 65
           +D Y ++AK Q  R+R+A                    R++DL  APG+WSQV  +R  P
Sbjct: 37  KDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQRSSP 96

Query: 66  QSSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELF 109
            S       I+ VD+ P  P   V ++QA+I   +T   I   F
Sbjct: 97  NS------MILGVDILPCEPPHGVNSIQANILAKRTHDLIRLFF 134

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 150 LLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKVICAKPRSSRGTSLESFIVCL 201
           LLR  G+FV K++ G + ++   ++  +F  V   KP +SR  S E++ + L
Sbjct: 254 LLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHKFKPDASRDESKETYYIGL 305

>Scas_720.46
          Length = 321

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 46/102 (45%), Gaps = 8/102 (7%)

Query: 10  DLYYRKAKEQGYRARSAXXXXXXXXXXXXXXXA--VRVVDLCAAPGSWSQVLSRRLFPQS 67
           D Y R+AK   +R+R+A               +   RV+DL  APG+WSQV   R   +S
Sbjct: 42  DPYTREAKINNFRSRAAFKLTEIDDKFHIFNKSKIQRVLDLGFAPGAWSQVARERTSKES 101

Query: 68  SDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELF 109
                  I+ VD+ P  P   V  +QA+I   KT   I   F
Sbjct: 102 M------ILGVDILPCDPPHGVSAIQANILSKKTQMLIRLYF 137

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 150 LLRKGGNFVAKIFRGRDIDMLYSQLGYLFEKVICAKPRSSRGTSLESFIVCL 201
           LLR  G+FV K+F G +  +   ++  +F+K I  KP+SSR  S E +I+ +
Sbjct: 256 LLRPKGSFVCKLFTGVEDKLFEKRVKMVFKKTIRFKPKSSRNESKEVYIIGM 307

>YPL103C (YPL103C) [5341] chr16 complement(357995..359401) Protein
           of unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.7605p [1407 bp, 468 aa]
          Length = 468

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 220 EDFFQGCDIGKLRLEDKCPNYHEEPRSI 247
           E F +GC +  L     CP +H++PR I
Sbjct: 377 ERFGKGCKLALLPCGQYCPEWHQKPRHI 404

>Kwal_56.23171
          Length = 438

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 68  SDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEG-KKADFICSDGAPDVT 126
           ++    K V +D++P  PI+  + L  +  H + L   +EL E   K  FI  DG   + 
Sbjct: 99  TEEGKEKKVTIDIEPYKPINTSLYLCDNKFHTEVL---SELLEADDKFGFIVMDGQGTLF 155

Query: 127 GL 128
           GL
Sbjct: 156 GL 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,175,999
Number of extensions: 357143
Number of successful extensions: 931
Number of sequences better than 10.0: 24
Number of HSP's gapped: 881
Number of HSP's successfully gapped: 31
Length of query: 297
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 196
Effective length of database: 13,099,691
Effective search space: 2567539436
Effective search space used: 2567539436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)