Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F18392g58857929490.0
Scas_661.2862157927030.0
YDR037W (KRS1)59157926930.0
CAGL0K12012g59157926880.0
Kwal_27.1054159157926800.0
Sklu_2357.258857926780.0
AGR037C58957926590.0
KLLA0F04796g5174866386e-76
CAGL0J10230g5435096372e-75
Scas_633.285925036244e-73
Kwal_23.47175275186012e-70
AER362W5254905592e-64
YNL073W (MSK1)5764965605e-64
ADL039C5564842085e-17
YLL018C (DPS1)5574882032e-16
CAGL0D06556g5535341987e-16
Sklu_2189.35585061933e-15
Scas_347.35524821764e-13
KLLA0D03839g5554811764e-13
Kwal_27.122356502111755e-13
Sklu_1963.16552871514e-10
YHR019C (DED81)5544681462e-09
KLLA0E24486g6452651401e-08
KLLA0A11484g4743771372e-08
Sklu_2265.35604981362e-08
KLLA0A08426g5544741328e-08
YPL104W (MSD1)6581351328e-08
AGR206C6511291247e-07
Kwal_14.23034752501247e-07
AEL020W5523301103e-05
Scas_700.66581961103e-05
CAGL0H05907g6591471079e-05
Kwal_0.3754282791041e-04
Scas_607.145554811032e-04
CAGL0A02112g5485091023e-04
Scas_628.24487368900.008
YCR024C492434790.15
CAGL0K07656g49767740.69
AFR516W49971721.1
YNL077W (APJ1)52878721.2
Kwal_47.1799849969711.5
KLLA0F25234g49967711.5
Scas_707.1449967701.7
YFL022C (FRS2)50326701.9
CAGL0L08030g46741692.4
KLLA0B13090g1021137692.6
CAGL0J09900g283119674.0
KLLA0F24200g65256674.5
CAGL0J02486g123536659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18392g
         (579 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18392g 1693928..1695694 highly similar to sp|P15180 Saccha...  1140   0.0  
Scas_661.28                                                          1045   0.0  
YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase...  1041   0.0  
CAGL0K12012g 1159164..1160939 highly similar to sp|P15180 Saccha...  1040   0.0  
Kwal_27.10541                                                        1036   0.0  
Sklu_2357.2 YDR037W, Contig c2357 1101-2867                          1036   0.0  
AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH] (775332..77...  1028   0.0  
KLLA0F04796g complement(466476..468029) similar to sp|P32048 Sac...   250   6e-76
CAGL0J10230g complement(998449..1000080) similar to sp|P32048 Sa...   249   2e-75
Scas_633.28                                                           244   4e-73
Kwal_23.4717                                                          236   2e-70
AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH] complement(...   219   2e-64
YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA syntheta...   220   5e-64
ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH] (620628..62...    85   5e-17
YLL018C (DPS1) [3401] chr12 complement(109901..111574) Aspartyl-...    83   2e-16
CAGL0D06556g 623770..625431 highly similar to sp|P04802 Saccharo...    81   7e-16
Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement         79   3e-15
Scas_347.3                                                             72   4e-13
KLLA0D03839g 324274..325941 highly similar to sp|P04802 Saccharo...    72   4e-13
Kwal_27.12235                                                          72   5e-13
Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement         63   4e-10
YHR019C (DED81) [2305] chr8 complement(141886..143550) Asparagin...    61   2e-09
KLLA0E24486g complement(2173560..2175497) similar to sp|P15179 S...    59   1e-08
KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces c...    57   2e-08
Sklu_2265.3 YHR019C, Contig c2265 4970-6652                            57   2e-08
KLLA0A08426g complement(745048..746712) similar to sp|P38707 Sac...    55   8e-08
YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA synth...    55   8e-08
AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH] (1144536..1...    52   7e-07
Kwal_14.2303                                                           52   7e-07
AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH] complement...    47   3e-05
Scas_700.6                                                             47   3e-05
CAGL0H05907g complement(579444..581423) similar to sp|P15179 Sac...    46   9e-05
Kwal_0.375                                                             45   1e-04
Scas_607.14                                                            44   2e-04
CAGL0A02112g 216596..218242 highly similar to sp|P38707 Saccharo...    44   3e-04
Scas_628.24                                                            39   0.008
YCR024C (YCR024C) [558] chr3 complement(160739..162217) Asparagi...    35   0.15 
CAGL0K07656g 761388..762881 highly similar to sp|P15625 Saccharo...    33   0.69 
AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH] complement(...    32   1.1  
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    32   1.2  
Kwal_47.17998                                                          32   1.5  
KLLA0F25234g complement(2349192..2350691) highly similar to sp|P...    32   1.5  
Scas_707.14                                                            32   1.7  
YFL022C (FRS2) [1661] chr6 complement(93497..95008) Phenylalanyl...    32   1.9  
CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces c...    31   2.4  
KLLA0B13090g complement(1142698..1145763) similar to sp|P12868 S...    31   2.6  
CAGL0J09900g 966959..967810 highly similar to sp|P04840 Saccharo...    30   4.0  
KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces...    30   4.5  
CAGL0J02486g complement(239041..242748) similar to sp|P40318 Sac...    30   9.9  

>KLLA0F18392g 1693928..1695694 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 588

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/579 (96%), Positives = 558/579 (96%)

Query: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 60
           MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQV                   
Sbjct: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVEAKKAAKKATAKPTPEPKK 60

Query: 61  XXNTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120
             NTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET
Sbjct: 61  KANTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120

Query: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180
           LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD
Sbjct: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180

Query: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240
           IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI
Sbjct: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240

Query: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300
           MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY
Sbjct: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300

Query: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360
           MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360

Query: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420
           IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL
Sbjct: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420

Query: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480
           HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY
Sbjct: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480

Query: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540
           SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN
Sbjct: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540

Query: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK 579
           ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK
Sbjct: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK 579

>Scas_661.28
          Length = 621

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/579 (85%), Positives = 519/579 (89%)

Query: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 60
           MSQ   V    E VAN+HLDE TGEMVSKSELKKRIKQRQV                   
Sbjct: 31  MSQEEAVQKVAENVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPESKK 90

Query: 61  XXNTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120
             NTD FADLDPSQYFEARSRQI ELRKT SPNPYPHKF+VS++ PEFL KYA L+RGET
Sbjct: 91  KKNTDLFADLDPSQYFEARSRQIQELRKTQSPNPYPHKFKVSISNPEFLKKYAYLQRGET 150

Query: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180
           LP EKV+IAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY+ E+ YE DH L+KRGD
Sbjct: 151 LPNEKVAIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYNNEADYEKDHDLLKRGD 210

Query: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240
           IVGVEGYVGRT PKKGGEGEISVFVSRI+LLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 211 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 270

Query: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300
           MNKDAR RFI RS+II ++R+FLD R FIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY
Sbjct: 271 MNKDARGRFIKRSQIIRFIRRFLDQREFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 330

Query: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360
           MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 331 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 390

Query: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420
           +M SEMVKEITGSY+IKYHPDPN+  KE+ELNFTRPWKR+NMIEELE RF+VTFPAGDQL
Sbjct: 391 LMFSEMVKEITGSYIIKYHPDPNNPEKEMELNFTRPWKRMNMIEELEKRFNVTFPAGDQL 450

Query: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480
           HTAETGEFLKKVL DNKM+C PPLTNARMLDKLVGELED CINPTFIFGHPQMMSPLAKY
Sbjct: 451 HTAETGEFLKKVLADNKMECPPPLTNARMLDKLVGELEDVCINPTFIFGHPQMMSPLAKY 510

Query: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQLVDETFCN
Sbjct: 511 SRDTPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 570

Query: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK 579
           ALEYGLPPTGGWGCGIDRLAMFL DSNTIREVLLFPTLK
Sbjct: 571 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLK 609

>YDR037W (KRS1) [890] chr4 (525435..527210) Lysyl-tRNA synthetase,
           cytoplasmic [1776 bp, 591 aa]
          Length = 591

 Score = 1041 bits (2693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/579 (85%), Positives = 520/579 (89%), Gaps = 2/579 (0%)

Query: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 60
           MSQ   V AA E VAN+HLDE TGEMVSKSELKKRIKQRQV                   
Sbjct: 1   MSQQDNVKAAAEGVANLHLDEATGEMVSKSELKKRIKQRQVEAKKAAKKAAAQPKPASKK 60

Query: 61  XXNTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120
              TD FADLDPSQYFE RSRQI ELRKTH PNPYPHKF VS++ PEFL+KYA+LK+GET
Sbjct: 61  --KTDLFADLDPSQYFETRSRQIQELRKTHEPNPYPHKFHVSISNPEFLAKYAHLKKGET 118

Query: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180
           LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY    SYE DH L+KRGD
Sbjct: 119 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYCDPDSYEKDHDLLKRGD 178

Query: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240
           IVGVEGYVGRT PKKGGEGE+SVFVSR+QLLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 179 IVGVEGYVGRTQPKKGGEGEVSVFVSRVQLLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238

Query: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300
           MNKDARNRFITRS+II Y+R+FLD R FIEVETPMMNVIAGGATAKPF+THHNDLDMDMY
Sbjct: 239 MNKDARNRFITRSEIIRYIRRFLDQRKFIEVETPMMNVIAGGATAKPFITHHNDLDMDMY 298

Query: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360
           MRIAPELFLK+LVVGG+DRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 299 MRIAPELFLKQLVVGGLDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358

Query: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420
           +M SEMVKEITGSY+IKYHPDP D  KELELNF+RPWKRINMIEELE  F+V FP+GDQL
Sbjct: 359 LMFSEMVKEITGSYIIKYHPDPADPAKELELNFSRPWKRINMIEELEKVFNVKFPSGDQL 418

Query: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480
           HTAETGEFLKK+L DNK++C PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY
Sbjct: 419 HTAETGEFLKKILVDNKLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 478

Query: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540
           SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQLVDETFCN
Sbjct: 479 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 538

Query: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK 579
           ALEYGLPPTGGWGCGIDRLAMFL DSNTIREVLLFPTLK
Sbjct: 539 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLK 577

>CAGL0K12012g 1159164..1160939 highly similar to sp|P15180
           Saccharomyces cerevisiae YDR037w KRS1 lysyl-tRNA
           synthetase, start by similarity
          Length = 591

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/579 (85%), Positives = 520/579 (89%), Gaps = 1/579 (0%)

Query: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 60
           MSQ     AATE VAN+HLDE+TGEMVSKSELKKR+K RQV                   
Sbjct: 1   MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMKARQVEAKKAAKKASAQPKPEPKK 60

Query: 61  XXNTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120
             N D  ADLDPSQYFEARSRQI ELRKTHSPNPYPHKFQVS++ PEFL+KYA+LKRGET
Sbjct: 61  KKN-DLLADLDPSQYFEARSRQILELRKTHSPNPYPHKFQVSISNPEFLAKYAHLKRGET 119

Query: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180
           LP E VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDY    +YE+DH LIKRGD
Sbjct: 120 LPNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYADAEAYENDHDLIKRGD 179

Query: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240
           IVGVEGYVGRT PKKGGEGEISVFV RI+LLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 180 IVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 239

Query: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300
           MNKD+R RFITRSKII Y+RKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDLDMDM+
Sbjct: 240 MNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMF 299

Query: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360
           MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 300 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 359

Query: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420
           ++ SEMVKEI GSYVIKYHPDPN+  KE+ELNF RPWKRINMIEELE RF+VTFPAGDQL
Sbjct: 360 LLFSEMVKEINGSYVIKYHPDPNNPEKEMELNFARPWKRINMIEELEKRFNVTFPAGDQL 419

Query: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480
           HT ETGEFL+KVLKDN ++C PP+TNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY
Sbjct: 420 HTKETGEFLQKVLKDNNLECPPPITNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 479

Query: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540
           SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQL+DETFCN
Sbjct: 480 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCN 539

Query: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK 579
           ALEYGLPPTGGWGCGIDRLAMFL DSNTIREVLLFPTLK
Sbjct: 540 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLK 578

>Kwal_27.10541
          Length = 591

 Score = 1036 bits (2680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/579 (85%), Positives = 521/579 (89%), Gaps = 1/579 (0%)

Query: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 60
           MSQ   V +A +A+AN+HLDE TGEMVSKSELKKR KQRQV                   
Sbjct: 1   MSQEEAVKSANDAIANLHLDEATGEMVSKSELKKRAKQRQVEAKKAAKKASAQPKPEPKK 60

Query: 61  XXNTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120
             N DAFADLDPSQYFEARSRQI EL+KT SPNPYPHKF VS+ L EFL KYA+L+RGET
Sbjct: 61  KAN-DAFADLDPSQYFEARSRQIQELKKTQSPNPYPHKFHVSIGLSEFLQKYAHLQRGET 119

Query: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180
           LPEEKVSIAGR+HAKRESGSKLKFYVLHGDGVEVQ+MSQLQDY +ES+YE DH LIKRGD
Sbjct: 120 LPEEKVSIAGRVHAKRESGSKLKFYVLHGDGVEVQLMSQLQDYGSESAYEADHDLIKRGD 179

Query: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240
           I+GVEGYVGRT PKKGGEGEISVFVSRIQLLTPCLH+LP DHFGFKDQE RYRKRYLDLI
Sbjct: 180 IIGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILPADHFGFKDQETRYRKRYLDLI 239

Query: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300
           MNKDAR RFITRSKIISY+RKFLD RNFIEVETPMMNVIAGGATAKPFVTHHNDL+MDM+
Sbjct: 240 MNKDARPRFITRSKIISYIRKFLDERNFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF 299

Query: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360
           MRIAPELFLKELVVGGM+RVYEIGRQFRNEGIDMTHNPEFTTCEFYQA+ADVYDLMDMTE
Sbjct: 300 MRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTHNPEFTTCEFYQAFADVYDLMDMTE 359

Query: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420
           ++ SEMVKEITGSYVIKYHPDP D  KELELNF RPWKRINMIEELE R +V FPAGD+L
Sbjct: 360 VLFSEMVKEITGSYVIKYHPDPRDPAKELELNFARPWKRINMIEELEKRLNVKFPAGDEL 419

Query: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480
           HTAETGEFLK+VLK+N ++C PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAK 
Sbjct: 420 HTAETGEFLKRVLKENNLECPPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKK 479

Query: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQLVDETFCN
Sbjct: 480 SRDIPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLVDETFCN 539

Query: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK 579
           ALEYGLPPTGGWGCGIDRLAMFL DSNTIREVLLFPTLK
Sbjct: 540 ALEYGLPPTGGWGCGIDRLAMFLTDSNTIREVLLFPTLK 578

>Sklu_2357.2 YDR037W, Contig c2357 1101-2867
          Length = 588

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/579 (84%), Positives = 520/579 (89%), Gaps = 2/579 (0%)

Query: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 60
           MSQ     AATE+VAN+HLDE+TGE VSKSELKKRIKQRQ+                   
Sbjct: 1   MSQEEATKAATESVANLHLDEVTGEKVSKSELKKRIKQRQIEAKKAAKKANAQPKPETKK 60

Query: 61  XXNTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120
               D FADLDPSQYFEARSRQI ELRK+H PNPYPHKF VS++LP+FL KY NLKRGET
Sbjct: 61  --KVDTFADLDPSQYFEARSRQIQELRKSHLPNPYPHKFHVSISLPDFLKKYENLKRGET 118

Query: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180
           LP EKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYH+E +YE DH L+KRGD
Sbjct: 119 LPNEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHSEEAYEQDHGLLKRGD 178

Query: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240
           IVGVEGYVGRT PKKGGEGEISVFVSRI+LLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 179 IVGVEGYVGRTQPKKGGEGEISVFVSRIELLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238

Query: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300
           MNKDAR+RFITRSKII+++RKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDL+MDM+
Sbjct: 239 MNKDARSRFITRSKIITFIRKFLDERSFIEVETPMMNVIAGGATAKPFVTHHNDLNMDMF 298

Query: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360
           MRIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 299 MRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358

Query: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420
           ++ SEMVKEITGSYVIKYHP+P +   E+ELNF RPWKRINMIEELE RF+V FPAGDQL
Sbjct: 359 LLFSEMVKEITGSYVIKYHPNPQNPELEMELNFARPWKRINMIEELEKRFNVKFPAGDQL 418

Query: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480
           HTAETGEFLK +L +NKM+C PPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY
Sbjct: 419 HTAETGEFLKNILTENKMECTPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 478

Query: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540
           SRD PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDE QL+DETFCN
Sbjct: 479 SRDVPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEVQLIDETFCN 538

Query: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK 579
           ALEYGLPPTGGWGCG+DRLAMFL DSNTIREVLLFPTLK
Sbjct: 539 ALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLK 577

>AGR037C [4347] [Homologous to ScYDR037W (KRS1) - SH]
           (775332..777101) [1770 bp, 589 aa]
          Length = 589

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/579 (84%), Positives = 518/579 (89%), Gaps = 2/579 (0%)

Query: 1   MSQPHEVAAATEAVANMHLDELTGEMVSKSELKKRIKQRQVXXXXXXXXXXXXXXXXXXX 60
           MS+   V    E VAN+HLDE+TGEMVSKSELKKRIKQRQV                   
Sbjct: 1   MSEEAAVQQVAENVANLHLDEVTGEMVSKSELKKRIKQRQVEAKKAAKKATSKPKPEPKK 60

Query: 61  XXNTDAFADLDPSQYFEARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGET 120
               +  ADLDPS+YFEARSRQI ELRKT  PNPYPHKF V++ LP FL+KYA+L+RGET
Sbjct: 61  --KVENMADLDPSKYFEARSRQIQELRKTQEPNPYPHKFNVTIGLPAFLNKYAHLQRGET 118

Query: 121 LPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGD 180
           LPEE+VSIAGRIHAKRESGSKL+FYVLH DGVEVQVMSQLQDYH+E +YE DH L+KRGD
Sbjct: 119 LPEERVSIAGRIHAKRESGSKLRFYVLHADGVEVQVMSQLQDYHSEEAYEQDHGLLKRGD 178

Query: 181 IVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLI 240
           IVGVEGYVGRT PKKGGEGEISVFVSRIQLLTPCLHMLP DHFGFKDQE RYRKRYLDLI
Sbjct: 179 IVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHMLPADHFGFKDQETRYRKRYLDLI 238

Query: 241 MNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMY 300
           MNKDAR RFITRSKII+Y+RKFLD R+FIEVETPMMNVIAGGATAKPFVTHHNDLDM MY
Sbjct: 239 MNKDARGRFITRSKIITYIRKFLDNRDFIEVETPMMNVIAGGATAKPFVTHHNDLDMQMY 298

Query: 301 MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 360
           MRIAPELFLK+LVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE
Sbjct: 299 MRIAPELFLKQLVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTE 358

Query: 361 IMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL 420
           ++ SEMVKEITG Y IK+HPDPND +KE ++NF RPWKRINMIEELE RF+VTFPAGDQL
Sbjct: 359 LLFSEMVKEITGDYKIKFHPDPNDPSKEYDINFARPWKRINMIEELEKRFNVTFPAGDQL 418

Query: 421 HTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKY 480
           HTAETGEFLKK+L DNKMDC PPLTNARMLDKLVGELEDTCI+PTFIFGHPQMMSPLAK+
Sbjct: 419 HTAETGEFLKKILSDNKMDCPPPLTNARMLDKLVGELEDTCIDPTFIFGHPQMMSPLAKH 478

Query: 481 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCN 540
           SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQA QK QGDDEAQL+DETFCN
Sbjct: 479 SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQARQKDQGDDEAQLIDETFCN 538

Query: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTLK 579
           ALEYGLPPTGGWGCG+DRLAMFL DSNTIREVLLFPTLK
Sbjct: 539 ALEYGLPPTGGWGCGVDRLAMFLTDSNTIREVLLFPTLK 577

>KLLA0F04796g complement(466476..468029) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1 lysyl-tRNA
           synthetase, mitochondrial, hypothetical start
          Length = 517

 Score =  250 bits (638), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 165/486 (33%), Positives = 261/486 (53%), Gaps = 32/486 (6%)

Query: 102 SVTLPEFLSKYANLKRGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ 161
           ++ +  F+ +Y  LK  +       ++ G+I   R SG K+ F  L  D   +QV+  L 
Sbjct: 49  TIDVSRFIKEYDGLKVDDRSTTH--TLRGKITNMRFSGKKIGFINLLNDEKSLQVIVNLS 106

Query: 162 DY-HTESSYEDDHSLIKRGDIVGVEGYVGRTSPKKGGEGEISVFV-SRIQLLTPCLHMLP 219
           +   +   ++      K GD + V G+ G +      +G +S+ V S +++L+P    +P
Sbjct: 107 NLPMSVGEFQAHMRKFKIGDHIQVTGFPGVSQK----QGTLSLKVNSELKMLSPAQIPIP 162

Query: 220 TDHFGFKDQELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVI 279
                  D   R   + LD ++N         R  +   +R++L  + FIEVETP+++  
Sbjct: 163 PKLL---DSSKRNSNKTLDYLVN--GTEAIYIRHLVTKRIREWLYKQEFIEVETPIISSK 217

Query: 280 AGGATAKPFVTHHNDLDMD--MYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHN 337
           + GA AKPF+TH   +D +    +RIAPEL+LK L +GGM++++EIG+ FRNEGID THN
Sbjct: 218 SNGANAKPFITHCTAIDKEQPFELRIAPELWLKRLCIGGMNKIFEIGKVFRNEGIDSTHN 277

Query: 338 PEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPW 397
           PEFTT EFYQ Y ++  L++M+E ++  + + I         P   +   +++ N  + +
Sbjct: 278 PEFTTLEFYQCYINMEQLIEMSESLLIYVCQGID-------KPKAQELLDQIKANNGK-F 329

Query: 398 KRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDCA-PPLTNARMLDKLVGE 456
           KR+  +  L  +  + F   D        E LK+ L+   +  +   ++  ++LD+L G+
Sbjct: 330 KRLEFLPTLTQKTGIDFDNMD----LNNAELLKEKLRKANISISESSVSPQQILDELCGK 385

Query: 457 -LEDTC--INPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQ 513
            +E  C  + PT I+ HP ++SPLAK   +   + +RFE+F+  KE  NAY E N P  Q
Sbjct: 386 YIESQCDTLLPTIIYHHPTVLSPLAKTDSNNVQITKRFEIFINRKEYMNAYEEENCPDLQ 445

Query: 514 RARFEEQANQKAQ-GDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREV 572
             +F  Q   K Q  DDE   VD  +  A++YG+PP GG+G GIDRL M LAD+  I EV
Sbjct: 446 LEKFTNQLASKTQFKDDEMMAVDLPYVQAMKYGMPPIGGFGLGIDRLCMLLADTQRIEEV 505

Query: 573 LLFPTL 578
           L F TL
Sbjct: 506 LSFGTL 511

>CAGL0J10230g complement(998449..1000080) similar to sp|P32048
           Saccharomyces cerevisiae YNL073w MSK1, hypothetical
           start
          Length = 543

 Score =  249 bits (637), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 168/509 (33%), Positives = 273/509 (53%), Gaps = 24/509 (4%)

Query: 84  NELRKTHSPNPYPHKFQVS----VTLPEFLSKYANLKRGE-TLPEEKVSIAGRIHAKRES 138
           NEL  +     YP    +     V++  FL KY +    +     +K+S+ GRI + R S
Sbjct: 39  NELVLSSLDRYYPSMSSIERGNLVSIDIFLKKYGSTSEDQLNKINQKISLCGRIKSIRFS 98

Query: 139 GSKLKFYVLHGDGVE-VQVMSQLQDYHTESSYEDDHSLIKRGDIVGVEGYVGRTSPKKGG 197
           G K+ F  L  DG+  +Q++   ++    +++E + S +++GD V   G + R S  K  
Sbjct: 99  GKKMAFIDLV-DGIHGIQLILNCREIGNSATFESELSFLRKGDYVMTTG-LPRLS--KSR 154

Query: 198 EGEISVFVSRIQLLTPCLHM-LPTDHFGFKDQELRYRKRYLDLIMNKDARNRFITRSKII 256
              IS+  + +  +     M LP       D       + +D  +N     R   RS I+
Sbjct: 155 MKNISLRCTDLPKILSVAQMPLPPKLI---DTVKSNSNKVVDYQINGFQNIRI--RSSIL 209

Query: 257 SYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGG 316
             +R FL+ R+FIEVETP+++  + GA AKPF++   D D  + +R+APEL+LK L++ G
Sbjct: 210 KSIRNFLEERDFIEVETPILSSKSNGAVAKPFMSSSKDFD-KLMLRVAPELWLKRLIISG 268

Query: 317 MDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVI 376
            ++V+EIG+ FRNEGID +HNPEFTT EFYQ+Y  + DL+ + E +  +++ ++T +  I
Sbjct: 269 CNKVFEIGKSFRNEGIDGSHNPEFTTLEFYQSYLTMEDLIKLNEDLFKKIITDLTNNLTI 328

Query: 377 K-YHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKD 435
           K Y P+   E +++  +    +KR+  +  L     V         + +  E + +  K 
Sbjct: 329 KQYLPESLLELEDILKSNNWKFKRVEFLPTLSKELGVDLSQVKIEDSKQLLEVIPQKYKG 388

Query: 436 NKMDCAPPLTNARMLDKLVGEL--EDTC--INPTFIFGHPQMMSPLAKYSRDQPGLCERF 491
                +   +++++L++L  EL  E  C   +PT I+ HP ++SPLAK + D     +RF
Sbjct: 389 QFFGKSSSYSSSQILNRLCSELIEEKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRF 448

Query: 492 EVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQL--VDETFCNALEYGLPPT 549
           E+F+  +E  NAY E N P  Q  +FE+QA  K    D   L  +D+ + NA+++G+PP 
Sbjct: 449 ELFIKGREYSNAYEEENCPQVQLEKFEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPI 508

Query: 550 GGWGCGIDRLAMFLADSNTIREVLLFPTL 578
           GG+G GIDRL M +     I +VL F TL
Sbjct: 509 GGFGLGIDRLCMLITGCQRIEQVLPFGTL 537

>Scas_633.28
          Length = 592

 Score =  244 bits (624), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 178/503 (35%), Positives = 270/503 (53%), Gaps = 49/503 (9%)

Query: 103 VTLPEFLSKY-ANLKR--GETLPEEKVSIAGRIHAKRESGSKLKFYVLHGD--GVEVQVM 157
           +T+ +FL  +  N +R  GE   +  + + GRI   R SG K+ F  L      V++QV+
Sbjct: 100 ITVKKFLDTFEKNPQRLNGEDDYKSFLQLNGRIKNIRYSGKKIAFIDLFDSRYNVKIQVI 159

Query: 158 SQLQDYHTESS---YEDDHSLIKRGDIV---GVEGYVGRTSPKKGGEG-EISVFVSRIQL 210
             L     E+S   +++   L+K+GD +   G+ G+    S     +G ++ V +S  Q 
Sbjct: 160 LNLNKLKQETSEERFQEVVQLLKKGDYIKAFGIPGFSESRSHTLSLKGTKLPVLLSAAQ- 218

Query: 211 LTPCLHMLPTDHFGFKDQELRYRK-RYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFI 269
                + LP+     KD EL+ RK R LD  +N    +  + RS II  +R FLD + FI
Sbjct: 219 -----YPLPSQ---LKD-ELKARKNRVLDYQVN--GVSSLLLRSNIIRLLRSFLDKQEFI 267

Query: 270 EVETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRN 329
           EVETP+++  + GA A+PF+T    L+ ++ +RIAPEL+LK L++ G+DRVYEIG+ FRN
Sbjct: 268 EVETPILSSKSNGANARPFITKSGSLNENLELRIAPELWLKRLIISGLDRVYEIGKVFRN 327

Query: 330 EGIDMTHNPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVIK---YHPDP--ND 384
           EG+D THNPEFT  EFY+ Y  + DL++ +E    ++ K I  +  +K   YH  P  ++
Sbjct: 328 EGVDSTHNPEFTLLEFYERYLSMTDLIEKSE----DLFKHILVNLELKKSEYHFSPAFDN 383

Query: 385 ETKELELNFTRPWK--RINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDCAP 442
             + LE      WK  RI  +  L    ++ F   D     +  E L    +    +  P
Sbjct: 384 LYRTLE---QANWKFRRIEFLPTLSQELNIDFSLIDLNDAEKLLESLPAHSRKELFENVP 440

Query: 443 P--LTNARMLDKLVGELEDT----CINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVA 496
           P  L++ ++L+KL     ++     I+PT IF HP+++SPLAK       + +RFE+F+ 
Sbjct: 441 PGELSSQQILNKLCSFYLESRYCDTIHPTIIFHHPRIISPLAKAHPSNQQITKRFEMFIN 500

Query: 497 TKEICNAYTELNDPFDQRARFEEQA----NQKAQGDDEAQLVDETFCNALEYGLPPTGGW 552
            KE  NAY E N P  Q   F+ Q       K + +DE    DE F NA++ G+PP GG+
Sbjct: 501 GKEYINAYEEENCPQLQEKNFQLQQFSKETIKNKENDELISPDEGFINAMKSGMPPVGGF 560

Query: 553 GCGIDRLAMFLADSNTIREVLLF 575
           G G+DRL M L +   I +VL F
Sbjct: 561 GLGVDRLCMLLMNKGRIEDVLPF 583

>Kwal_23.4717
          Length = 527

 Score =  236 bits (601), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 169/518 (32%), Positives = 269/518 (51%), Gaps = 50/518 (9%)

Query: 84  NELRKTHSPNPYPHKFQVS---VTLPEFLSKYANLKRGETLPEEKVSIAGRIHAKRESGS 140
           NE   + +   YP   ++S    T+ EF  KY  L   E  P+    +  RI + R SG 
Sbjct: 31  NEAVASRASCYYPSLSKISPATTTVSEFKQKYQALH--EDQPQSSEVLRARIDSVRISGK 88

Query: 141 KLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSL-----------IKRGDIVGVEGYVG 189
            + F  +      VQ+   + +Y+   +     +L           ++ GD +   G+ G
Sbjct: 89  NMCFVDVSNARNSVQL---ILNYNVMKTAMPSSALTREQFFQHVQDLRPGDHIQACGFPG 145

Query: 190 RTSPKKGGEGEISVFVSRI-QLLTPCLHMLPTDHFGFKDQELRYRKRYLDLIMNKDARNR 248
            +      E  +S+  +++ ++L P L  +P       D   R   R LD ++N      
Sbjct: 146 LSQ----RERTLSLKCTKLTEILAPALLAVPPK---LTDPAKRNTNRVLDYLVN--GHET 196

Query: 249 FITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELF 308
            + R ++ + +R+FL+ R F+EVETP+++  A GA A+PF T     + ++ +R+APEL+
Sbjct: 197 LVVRHQVNTAIREFLNMRGFLEVETPVLSSKANGAAAEPFSTRTKATNAELELRVAPELW 256

Query: 309 LKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEIMISEMVK 368
           LK LVV G++RVYE+G+ FRNEG+D THNPEFTT EFYQ+YA + +L++++E +   ++ 
Sbjct: 257 LKRLVVAGVNRVYELGKVFRNEGVDATHNPEFTTLEFYQSYASMDELIELSEQLYLHVLN 316

Query: 369 EITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQLHTAETGEF 428
            +   +          E K   L     +KR+  +  L     V F   D LH +   + 
Sbjct: 317 RVDNRFA--------RELKNELLANAGKFKRVEFLPTLLRETGVDFTQID-LHNS---DL 364

Query: 429 LKKVL--KDNKMDCAPPLTNARMLDKLVGELEDT--CIN--PTFIFGHPQMMSPLAKYSR 482
           + + L  K+  MD     +  ++LD L G   +   C +  PT I+ HP +MSPLAK + 
Sbjct: 365 ISRALIAKNIHMDTTGK-SPQQILDMLCGRFIENKYCTSSLPTVIYHHPTVMSPLAKGNP 423

Query: 483 DQPGL-CERFEVFVATKEICNAYTELNDPFDQRARFE-EQANQKAQGDDEAQLVDETFCN 540
           D   L  +RFEVF+  KE  NAY E N P +Q  +FE +++ Q+  GD E+  VD ++  
Sbjct: 424 DDNMLTTKRFEVFINGKEYINAYEEENCPQEQLQKFELQKSAQETYGDRESLAVDYSYVE 483

Query: 541 ALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFPTL 578
           A+++G+PP GG+G GIDRL M L  +  I  VL F T+
Sbjct: 484 AMKWGMPPIGGFGLGIDRLCMLLTGNKRIERVLSFGTI 521

>AER362W [2863] [Homologous to ScYNL073W (MSK1) - SH]
           complement(1309431..1311008) [1578 bp, 525 aa]
          Length = 525

 Score =  219 bits (559), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 158/490 (32%), Positives = 247/490 (50%), Gaps = 39/490 (7%)

Query: 102 SVTLPEFLSKYANLKRGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ 161
           + ++ EF ++Y   K     PE    I G+I   R  G  + F  L   G  +Q+M    
Sbjct: 56  TASIAEFNNRYVG-KLSNDEPERTYVINGQIRGIRVVGRSMCFVDLQQQGSALQLMVNHS 114

Query: 162 DYHTE----SSYEDDHSLIKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRI-QLLTPCLH 216
               +      +++  + ++ GD V   G+ G +  ++     +S+   ++ ++L     
Sbjct: 115 LVRAQLVAKRPFQNAIAGLRLGDHVQPTGFPGLSKTER----TLSLKCRKVPRMLAAAQI 170

Query: 217 MLPTDHFGFKDQELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMM 276
            +P       D+  R + R LD ++N      F  R K ++ +R +L+ R F+EVETPM+
Sbjct: 171 AIPQR---LTDRVKRQQNRTLDYLVNGLKVLEF--RHKALTALRAYLNRRGFLEVETPML 225

Query: 277 NVIAGGATAKPFVTHHNDLDMD-MYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT 335
           +  + GA A PFVTH    D   + +RIAPEL+LK L VGG  RVYEIG+ FRNEGID T
Sbjct: 226 SAKSSGANATPFVTHLRGQDKQALELRIAPELWLKRLCVGGAQRVYEIGKVFRNEGIDAT 285

Query: 336 HNPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVIKYHPDPNDETKELELNFTR 395
           HNPEFTT E YQ YA + +L+++ ++++ ++   +         P       E+  N   
Sbjct: 286 HNPEFTTLELYQCYAPLDELLELAQVLLRDICVAVD-------TPVSRQLLAEMAQNGG- 337

Query: 396 PWKRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDCAPPLTN-ARMLDKLV 454
            ++R+  +  L     V + A D   +      ++  L    +D    + +  ++L+KL 
Sbjct: 338 AFRRVEFLPTLSRETGVDWAAVDLADSTA----IRVALSGAGIDVPESIVSPQQILNKLC 393

Query: 455 GE-LED---TCINPTFIFGHPQMMSPLAKYSRDQPGL-CERFEVFVATKEICNAYTELND 509
            + +ED     + PT I  HP +MSPLAK +    GL   RFE+FV  +E+ NAY E N 
Sbjct: 394 ADYIEDRYCQSLLPTAILHHPAVMSPLAKSA----GLVANRFELFVCGRELINAYEEENC 449

Query: 510 PFDQRARFEEQANQKAQ-GDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNT 568
           P +Q  + + Q   + Q  D E+  +D  +  A++YG+PP GG G GIDRL M L     
Sbjct: 450 PQEQLKKMQLQQRHREQFHDQESMQIDHHYIEAMKYGMPPIGGLGLGIDRLCMLLLAKAR 509

Query: 569 IREVLLFPTL 578
           I EVL F  L
Sbjct: 510 IEEVLPFGCL 519

>YNL073W (MSK1) [4517] chr14 (488385..490115) Lysyl-tRNA synthetase,
           mitochondrial [1731 bp, 576 aa]
          Length = 576

 Score =  220 bits (560), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 161/496 (32%), Positives = 249/496 (50%), Gaps = 40/496 (8%)

Query: 108 FLSKYANLKRGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ---DYH 164
           FL   A L   E  P   +SI GRI + R SG K+ F  L+     ++  +QLQ   +Y+
Sbjct: 84  FLGNPATLHH-EDNPNLLLSINGRIKSIRFSGQKIVFIDLYNGSSGLKNDTQLQLIVNYN 142

Query: 165 T-------ESSYEDDHSLIKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHM 217
                   ++++ +  + +K+GD +   GY G +  +      +S+  +++ ++     +
Sbjct: 143 KIGGSSEDKANFSEYMNFLKKGDYIKALGYPGFSQSR---VKMLSLICNKLPIVLSVSQL 199

Query: 218 -LPTDHFGFKDQELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMM 276
            LP+      D+      R +D  +N       + R++II  +RKFLD RNF+EVETP++
Sbjct: 200 PLPSR---LNDETKIKSNRVVDYQLN--GTQTLLVRARIIKLLRKFLDDRNFVEVETPIL 254

Query: 277 NVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTH 336
           +  + GA AKPF+T   D D  + +RIAPEL+LK L++ G+ +VYEIG+ FRNEGID TH
Sbjct: 255 SSKSNGAMAKPFITSSKDFD-HLELRIAPELWLKRLIISGLQKVYEIGKVFRNEGIDSTH 313

Query: 337 NPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVIKYHPDPNDETKELELNFT-R 395
           N EF+T EFY+ Y  + D++  TE +   ++  +   +     P P   + EL L  +  
Sbjct: 314 NAEFSTLEFYETYMSMDDIVTRTEDLFKFLITNLQKFFQDTRLPVPKTFS-ELHLALSEN 372

Query: 396 PWK--RINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDCAPPLTNARMLDKL 453
            WK  ++  +  L     +       L   +  E LK + KD      P   N   L  L
Sbjct: 373 NWKFRKVEFLPTLNKELGIDL-MNSGLDINKPSELLKALPKDIAKKYFPSADNTGQLSSL 431

Query: 454 --VGELEDTCIN--------PTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNA 503
             + +L D  +         PT I+  P ++SPLAK       + +RFEVF+  KE  NA
Sbjct: 432 QILNKLSDVFLEQRHCQSTLPTVIYHQPAILSPLAKTDPQNKQVTKRFEVFIKGKEYINA 491

Query: 504 YTELNDPFDQRARFEEQA--NQKAQGDDE--AQLVDETFCNALEYGLPPTGGWGCGIDRL 559
           Y E N P  Q  +F +Q   N+      E  + ++D  +   ++YG+PP GG+G GIDRL
Sbjct: 492 YEEENCPQLQLQKFLQQKQINELTGNKTETLSPVIDYQYVETMKYGMPPVGGFGLGIDRL 551

Query: 560 AMFLADSNTIREVLLF 575
            M   D   I EVL F
Sbjct: 552 CMLFCDKKRIEEVLPF 567

>ADL039C [1702] [Homologous to ScYLL018C (DPS1) - SH]
           (620628..622298) [1671 bp, 556 aa]
          Length = 556

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 113/484 (23%), Positives = 191/484 (39%), Gaps = 72/484 (14%)

Query: 124 EKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTES--------SYEDDHSL 175
           ++V +  R+H  R+ G+ L F +L      +Q + +     T S        S   +  +
Sbjct: 106 KEVLLRSRVHTVRQQGATLAFLMLRQRSSLIQALVKANAEGTVSKQMVKWAGSLNLESIV 165

Query: 176 IKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLP------------TDHF 223
           + RG +  VE  V     K     +  + ++++  ++     LP             +  
Sbjct: 166 LVRGVVRKVEEPV-----KSATVQDFEIQITQLHTISETPQQLPILIEDASRSEAEAEAA 220

Query: 224 GFK--DQELRYRKRYLDLIMNKDARNRFITRSK--IISYVRKFLDTRNFIEVETPMMNVI 279
           G    + + R   R +DL   +   N+ I R K  +    R+F  +RNF E+ TP +   
Sbjct: 221 GLPVVNLDTRLDARVIDL---RTVTNQAIFRIKAGVCGLFREFFQSRNFTEIHTPKLLAS 277

Query: 280 AGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNP 338
                A  F   +     + Y+  +P+ + ++L+    +RV+E+   FR E  +   H  
Sbjct: 278 PSEGGANVFEVKY--FKGNAYLAQSPQFYKQQLIAADFERVFEVAPVFRAENSNTHRHMT 335

Query: 339 EFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWK 398
           EFT  +   A+ + Y   ++ E+M  EM   +                 EL+  F R   
Sbjct: 336 EFTGVDLEMAFEEHYH--EVIEVM-GEMFMFVF---------------TELKKRFAREIA 377

Query: 399 RINMIEELENRFHVTFPAGDQ---LHTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVG 455
           ++     +E      FPA  +   LH  E    L++  K+          N R L KLV 
Sbjct: 378 QVRKQYPVEE---FKFPADGKMVILHYKEGIAMLREAGKEIGDFDDLSTENERFLGKLVR 434

Query: 456 ELEDTCINPTFIFGHPQMMSPLAKYSRDQPG---LCERFEVFVATKEICNAYTELNDPFD 512
           E  DT       F  P  + P   Y+   P        ++ F+  +EI +    ++DP  
Sbjct: 435 EKYDTDFYILDKF--PAELRPF--YTMPDPADPRYSNSYDFFMRGEEIMSGAQRIHDPEL 490

Query: 513 QRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREV 572
            R R +    Q     ++A   D  +C+A  YG PP  G G G++R+ MF  D   IR  
Sbjct: 491 LRERMKHHGLQP----EDAGFKD--YCDAFTYGCPPHAGGGIGLERIVMFYLDLKNIRRA 544

Query: 573 LLFP 576
            LFP
Sbjct: 545 TLFP 548

>YLL018C (DPS1) [3401] chr12 complement(109901..111574)
           Aspartyl-tRNA synthetase, cytoplasmic [1674 bp, 557 aa]
          Length = 557

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 116/488 (23%), Positives = 196/488 (40%), Gaps = 78/488 (15%)

Query: 123 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRG--- 179
           +++V    R+H  R+ G+ L F  L      +Q + +     T S      +++K     
Sbjct: 106 DKEVLFRARVHNTRQQGATLAFLTLRQQASLIQGLVKANKEGTISK-----NMVKWAGSL 160

Query: 180 ---DIVGVEGYVGRTSP--KKGGEGEISVFVSRIQLLTPCLHMLP------------TDH 222
               IV V G V +     K      + + +++I  ++     LP             + 
Sbjct: 161 NLESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPILLEDASRSEAEAEA 220

Query: 223 FGFK----DQELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETP-MMN 277
            G      D  L YR   L  + N+     F  ++ +    R++L T+ F EV TP ++ 
Sbjct: 221 AGLPVVNLDTRLDYRVIDLRTVTNQAI---FRIQAGVCELFREYLATKKFTEVHTPKLLG 277

Query: 278 VIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-TH 336
             + G ++   VT+        Y+  +P+   ++L+V   +RVYEIG  FR E  +   H
Sbjct: 278 APSEGGSSVFEVTYFKG---KAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRH 334

Query: 337 NPEFTTCE----FYQAYADVYD-LMDMTEIMISEMVKEITGS--YVIKYHPDPNDETKEL 389
             EFT  +    F + Y +V D L ++   + SE+ K        V K +P      +E 
Sbjct: 335 MTEFTGLDMEMAFEEHYHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYP-----VEEF 389

Query: 390 ELNFTRPWKRINMIEELENRFHVTFPAGD-QLHTAETGEFLKKVLKDNKMDCAPPLTNAR 448
           +L       R+   E +E         GD +  + E  +FL K+++D K D     T+  
Sbjct: 390 KLPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSTENEKFLGKLVRD-KYD-----TDFY 443

Query: 449 MLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELN 508
           +LDK   E     I P +    P             P     ++ F+  +EI +    ++
Sbjct: 444 ILDKFPLE-----IRPFYTMPDPA-----------NPKYSNSYDFFMRGEEILSGAQRIH 487

Query: 509 DPFDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNT 568
           D     A  +E+        ++  L D  +C+   YG PP  G G G++R+ MF  D   
Sbjct: 488 D----HALLQERMKAHGLSPEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFYLDLKN 541

Query: 569 IREVLLFP 576
           IR   LFP
Sbjct: 542 IRRASLFP 549

>CAGL0D06556g 623770..625431 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1, start by
           similarity
          Length = 553

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 120/534 (22%), Positives = 216/534 (40%), Gaps = 82/534 (15%)

Query: 77  EARSRQINELRKTHSPNPYPHKFQVSVTLPEFLSKYANLKRGETLPEEKVSIAGRIHAKR 136
           +A++ +++   + + P P+    Q      E   K+ +L + +   +++V    R+H  R
Sbjct: 60  QAKANEVDHSAENYGPAPF---VQSQFRTGEKRVKFEDLSKEDA--DKEVLFRARVHNTR 114

Query: 137 ESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRG------DIVGVEGYVGR 190
           + G+ L F  L      +Q + +      + S     +++K         IV V G V  
Sbjct: 115 QQGATLAFLTLRQQSSLIQALVKADKAGEKIS----KNMVKWAGSLNLESIVLVRGIVKV 170

Query: 191 TSP--KKGGEGEISVFVSRIQLLTPCLHMLP------------TDHFGFK--DQELRYRK 234
                K     ++ + V++I  ++     LP             +  G    + + R   
Sbjct: 171 VDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEAAGLPVVNLDTRLDN 230

Query: 235 RYLDLIMNKDARNRFITRSK--IISYVRKFLDTRNFIEVETPMMNVIAGGATAKPF-VTH 291
           R +DL   +   N+ I R +  + +  R+FL  + F+EV TP M   A    A  F VT+
Sbjct: 231 RVIDL---RTVTNQAIFRIQHGVCALFREFLANKKFVEVHTPKMLGAASEGGANVFEVTY 287

Query: 292 HNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCEFYQAYA 350
                   Y+  +P+   ++L+V   ++V+EIG  FR E  +   H  EFT  +   A+ 
Sbjct: 288 FKG---KAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEFTGLDMEMAFE 344

Query: 351 DVY-DLMDMTEIMISEMVKEITGSY------VIKYHPDPNDETKELELNFTRPWKRINMI 403
           + Y +++D+   +   +  E+   Y      V K +P      +E +L       RI   
Sbjct: 345 EHYHEVLDVLSELFVFLFTELKKRYAKEIELVRKQYP-----VEEFKLPKDGKMVRITYK 399

Query: 404 EELENRFHVTFPAGD-QLHTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCI 462
           E ++         GD +  + E  +FL K++++ K D     T+  +LDK   E     I
Sbjct: 400 EGIQMLKEAGKDIGDFEDLSTENEKFLGKLVRE-KYD-----TDFYILDKFPLE-----I 448

Query: 463 NPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQAN 522
            P +    P+            P     ++ F+  +EI +    ++D    +   E    
Sbjct: 449 RPFYTMPDPE-----------DPRYSNSYDFFMRGEEILSGAQRIHD---HKMLME---R 491

Query: 523 QKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
            K  G D      + +C+   YG PP  G G G++R+ MF  D   IR   LFP
Sbjct: 492 MKVHGLDPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFP 545

>Sklu_2189.3 YLL018C, Contig c2189 5672-7348 reverse complement
          Length = 558

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 118/506 (23%), Positives = 204/506 (40%), Gaps = 92/506 (18%)

Query: 111 KYANLKRGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYE 170
           K+A+L   +   E  V    R+H  R+ G+ L F  L      +Q + +     T S   
Sbjct: 97  KFADLSENDDGKE--VVFRARVHNSRQQGATLNFLTLRQQAELIQALVKSNKEGTVSKQM 154

Query: 171 DDH-SLIKRGDIVGVEGYVGRTSP--KKGGEGEISVFVSRIQLLTPCLHMLP-------- 219
               S I    IV V G V +     K      + + +++I  ++     +P        
Sbjct: 155 VKWTSSINLESIVLVHGIVRKVEEPIKSATVQNLEIHITKIFTISETPQQMPILLEDASR 214

Query: 220 ----TDHFGFK--DQELRYRKRYLDL--IMNKDARNRFITRSKIISYVRKFLDTRNFIEV 271
                +  G    + + R   R +DL  + N+     F  +S +    R+FL  R+F E+
Sbjct: 215 SEAEAEAAGLPVVNLDTRLDARVIDLRTVTNQAI---FKIQSGVCELFREFLRNRDFTEI 271

Query: 272 ETPMMNVIAGGATAKPF-VTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNE 330
            TP +        A  F VT+      + Y+  +P+++ +EL+    +RV+E+G  FR E
Sbjct: 272 HTPKLLGSPSEGGANVFEVTYFKG---NSYLAQSPQIYKQELIAADFERVFEVGPVFRAE 328

Query: 331 GIDM-THNPEFTTCEFYQAYADVYD-LMDMTEIMISEMVKEITGSY------VIKYHPD- 381
             +   H  EFT  +   A+ + YD ++D+   +   +  E+   Y      V K +P  
Sbjct: 329 NSNTHRHMTEFTGLDLEMAFEEHYDEVLDVLSELFVFIFTELKSRYSKEIALVRKQYPVE 388

Query: 382 ----PNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQLH-----TAETGEFLKKV 432
               P D  K + L+F      I M+ E          AG Q+      + E  + L K+
Sbjct: 389 DFKLPKD-GKMVRLHFK---DGIAMLRE----------AGKQVDDFEDLSTENEKLLGKL 434

Query: 433 LKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFE 492
           +++ K D     T+  +LDK         + P +    P+     ++YS         ++
Sbjct: 435 VRE-KYD-----TDFYILDKF-----PLAVRPFYTMPDPED----SRYSNS-------YD 472

Query: 493 VFVATKEICNAYTELNDP--FDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTG 550
            F+  +EI +    ++D     +R +  E + +     D        +C+A  YG PP  
Sbjct: 473 FFMRGEEILSGAQRIHDSEFLKERMKVHELSPEDPGLKD--------YCDAFTYGCPPHA 524

Query: 551 GWGCGIDRLAMFLADSNTIREVLLFP 576
           G G G++R+ MF  D   IR   LFP
Sbjct: 525 GGGIGLERVVMFYLDLKNIRRASLFP 550

>Scas_347.3
          Length = 552

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 111/482 (23%), Positives = 192/482 (39%), Gaps = 68/482 (14%)

Query: 124 EKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ-DYHTESSYEDDHSLIKRGDIV 182
           ++V    R+H  R+ G+ L F         +Q + ++Q D             +    IV
Sbjct: 102 KEVVFRARVHNTRQQGATLSFLTFRQQHDLIQGLVKVQKDGSVSKQMVKWAGSLNLESIV 161

Query: 183 GVEGYVGRTSP--KKGGEGEISVFVSRIQLLTPCLHMLP------------TDHFGFK-- 226
            V+G V R     K     ++ + ++ I  ++     LP             +  G    
Sbjct: 162 VVKGIVKRVEEPIKSATVQDLEIHITDIHSISETPETLPILLEDASRSEAEAEAAGLPVV 221

Query: 227 DQELRYRKRYLDL--IMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGAT 284
           + + R   R +DL  + N+     F  +S +    R++L    F EV TP +        
Sbjct: 222 NLDTRLDARVIDLRTVTNQAI---FKIQSGVCQLFREYLSGLKFTEVHTPKLLGAPSEGG 278

Query: 285 AKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTC 343
           A  F   +       Y+  +P+   ++L+V   ++V+EIG  FR E  +   H  EFT  
Sbjct: 279 ASVFEVSY--FKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEFTGL 336

Query: 344 E----FYQAYADVYDLM-DMTEIMISEMVKEITGSYVI--KYHPDPNDETKELELNFTRP 396
           +    F + Y +V D++ D+   + +E+ K  +    I  K +P      ++ +L     
Sbjct: 337 DMEMAFEEHYHEVLDVLSDLFVFIFTELKKRFSKEIEIVRKQYP-----VEDFKLPADGK 391

Query: 397 WKRINMIEELENRFHVTFPAG--DQLHTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLV 454
             RI   E ++         G  D L T E  +FL K++++ K D     T+  +LDK  
Sbjct: 392 MVRIQYKEGIQMLKDAGKEIGDFDDLST-ENEKFLGKLVRE-KYD-----TDFYILDKF- 443

Query: 455 GELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELNDPFDQR 514
                  I P +    P    P  +YS         ++ F+  +EI +    ++D     
Sbjct: 444 ----PLAIRPFYTM--PDAEDP--RYSNS-------YDFFMRGEEILSGAQRIHD----H 484

Query: 515 ARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLL 574
           A  +E+        ++  L D  +C+   YG PP  G G G++R+ MF  D   IR   L
Sbjct: 485 ALLQERMKVHGLSSEDPGLKD--YCDGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASL 542

Query: 575 FP 576
           FP
Sbjct: 543 FP 544

>KLLA0D03839g 324274..325941 highly similar to sp|P04802
           Saccharomyces cerevisiae YLL018c DPS1 aspartyl-tRNA
           synthetase, cytosolic, start by similarity
          Length = 555

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 110/481 (22%), Positives = 189/481 (39%), Gaps = 68/481 (14%)

Query: 125 KVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDH-SLIKRGDIVG 183
           +V    R+H  R+ G+ L F  L      +Q + +     T S         I    IV 
Sbjct: 106 EVVFRARVHNSRQQGATLAFLTLRQQAELIQGLVKANKEGTVSKQMVKWVGSINLESIVV 165

Query: 184 VEGYVGRTSP--KKGGEGEISVFVSRIQLLTPCLHMLP------------TDHFGFK--D 227
           V G V +     K      + V +++I  ++     LP             +  G    +
Sbjct: 166 VHGIVKKVEEPIKSATVQNLEVHITKIYTISETPEQLPILIEDASRSEAEAEAAGLPVVN 225

Query: 228 QELRYRKRYLDLIMNKDARNRFITR--SKIISYVRKFLDTRNFIEVETP-MMNVIAGGAT 284
            + R   R +DL   +   N+ I R  S + +  R+FL  + F EV TP ++   + G +
Sbjct: 226 LDTRLDSRVIDL---RTVTNQAIFRIQSGVCALFREFLTNKKFTEVHTPKLLGAPSEGGS 282

Query: 285 AKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTC 343
               VT+        Y+  +P+L+ ++L+    +RV+E+   FR E  +   H  EFT  
Sbjct: 283 NVFEVTYFKG---KSYLAQSPQLYKQQLIAADFERVFEVAPVFRAENSNTHRHMTEFTGL 339

Query: 344 EFYQAYADVYDLMDMTEIMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMI 403
           +   A+ + YD          E+V  +   +V  +        KE+ L      ++   +
Sbjct: 340 DLEMAFEEHYD----------EVVDTLAELFVFIFSQLKTRYAKEIAL-----VRKQYPV 384

Query: 404 EELE-----NRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDCAPPLT--NARMLDKLVGE 456
           EE +         + F  G  L        L++  KD  +D    L+  N ++L KLV +
Sbjct: 385 EEFKLPKDGKMVRIPFKEGIAL--------LREAGKD--VDDFEDLSTENEKLLGKLVRD 434

Query: 457 LEDTCINPTFIFGHPQMMSPLAKY-SRDQPGLCERFEVFVATKEICNAYTELNDPFDQRA 515
             +T      +   P  + P       + P     ++ F+  +EI +    ++D      
Sbjct: 435 KYETDF--YILDKFPLAIRPFYTMPDAEDPRYSNSYDFFMRGEEILSGAQRIHDA----D 488

Query: 516 RFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLF 575
             +E+ N      ++  L D  +C A  YG PP  G G G++R+ MF  D   IR   LF
Sbjct: 489 LLKERMNAHEVHPEDPGLKD--YCEAFTYGCPPHAGGGIGLERVVMFYLDLKNIRRASLF 546

Query: 576 P 576
           P
Sbjct: 547 P 547

>Kwal_27.12235
          Length = 650

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 102/211 (48%), Gaps = 10/211 (4%)

Query: 171 DDHSLIKRG---DIVGVEGYVG-RTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGFK 226
           D  SL+K     D+V +EG +  + + ++    E  + +S+++ L       P+    FK
Sbjct: 84  DSQSLLKAANVEDVVQIEGQLSLKRAKQESSAPEYEIKLSKLRTLNKAGKK-PSQLLHFK 142

Query: 227 DQ-ELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATA 285
           +Q       RYL L + K  +     R +I +Y+RK L+++ F E+ETP++         
Sbjct: 143 EQGNYPPEHRYLQLRLPK-YQTYLRKRHEIATYIRKHLNSKMFSEIETPILFKSTPEGAR 201

Query: 286 KPFVTHHNDL-DMDMYMRI--APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTT 342
           +  V   N L D   +  +  +P+ + + L+ GG+ R Y++ R FR+E +     PEFT 
Sbjct: 202 EFLVPARNKLSDKPTFYALPQSPQQYKQLLMAGGVSRYYQLARCFRDEDLRSDRQPEFTQ 261

Query: 343 CEFYQAYADVYDLMDMTEIMISEMVKEITGS 373
            +   A+A    +MD+ E  I+     ++ S
Sbjct: 262 VDLEMAFASGSQVMDVVESTITNTWNSLSSS 292

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 48/111 (43%), Gaps = 9/111 (8%)

Query: 470 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKA 525
           HP  M  L   S+    P LC  + ++  V   E+    T ++DP  Q   F     +  
Sbjct: 514 HPFTMVQLKDLSKLSSNPLLCTGQHYDFVVNGTELGGGSTRIHDPELQNFIF-----KNI 568

Query: 526 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
               E + + E    A E G PP  G+  G DRL   +  ++ IR+V+ FP
Sbjct: 569 LKISEPEKLFEHLLTAFESGTPPHAGFAIGFDRLCAMICGTDNIRDVIAFP 619

>Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement
          Length = 655

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 124/287 (43%), Gaps = 32/287 (11%)

Query: 104 TLPEFLSKYANLKRGETLPE-------EKVSIAGRIHAK-RESGSKLKFYVLH-GDGVEV 154
           T     SK+   K  ET+           V+I G I  K +  G  L F  L   +G  +
Sbjct: 21  TFESVYSKFTFSKNSETIENLLKHPVNTSVTINGWIDRKPKRVGKNLIFGTLRDSNGDVI 80

Query: 155 QVMSQLQDYHTESSYEDDHSLIKRGDIVGVEGYVGRTSPKK----GGEGEISVFVSRIQL 210
           Q++             D +SL+   ++  V    G  +PKK      E E  + ++ +++
Sbjct: 81  QIV-------------DSNSLLASSNVEDVIQIKGELAPKKMRDPSFEQEFEIKLNELKI 127

Query: 211 LTPCLHMLPTDHFGFKDQ-ELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFI 269
           L    +  P+    +K         RYL L + K  +N   TR +    +RK LDT  F 
Sbjct: 128 LNSA-NKKPSQLQDYKASGNYPPEYRYLQLRLPK-YQNFLRTRYEASKLIRKDLDTYRFT 185

Query: 270 EVETPMM-NVIAGGATAKPFVTHHNDLDMDMYMRI--APELFLKELVVGGMDRVYEIGRQ 326
           EVETPM+      GA      T  ++     +  +  +P+ + + L+  G+ R ++I R 
Sbjct: 186 EVETPMLFKSTPEGAREFLVPTRRSESKHPTFYALPQSPQQYKQLLMASGVHRYFQIARC 245

Query: 327 FRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGS 373
           FR+E +     PEFT  +   A+A   ++MD+ E M+++    ++ +
Sbjct: 246 FRDEDLRSDRQPEFTQVDLEMAFASGNEVMDVVEDMVTKAWSNLSSN 292

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 9/111 (8%)

Query: 470 HPQMMSPLAKYSRDQ----PGLCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKA 525
           HP  M  L  Y +        L + +++ V+  E+    T ++DP  Q   F+E      
Sbjct: 519 HPFTMVKLDDYKKLSNEAISCLGQHYDLVVSGVELGGGSTRIHDPELQNYIFKEILKIH- 577

Query: 526 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
               + + +      A E G PP  G+  G DR+   +  + +IR+V+ FP
Sbjct: 578 ----QPERLFGHLLTAFEMGTPPHAGFAIGFDRMCAMMCGTESIRDVIAFP 624

>YHR019C (DED81) [2305] chr8 complement(141886..143550)
           Asparaginyl-tRNA synthetase, cytoplasmic [1665 bp, 554
           aa]
          Length = 554

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 117/468 (25%), Positives = 191/468 (40%), Gaps = 66/468 (14%)

Query: 124 EKVSIAGRIHAKRESGSKLKFYVLH-GDGVEVQVMS-------QLQDYHTESSYEDDHSL 175
           ++V ++G IH  R S  K+ F VL  G G    V+S       Q  D   ES+     ++
Sbjct: 130 QRVKVSGWIHRLR-SNKKVIFVVLRDGSGFIQCVLSGDLALAQQTLDLTLESTVTLYGTI 188

Query: 176 IKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFG-FKDQELRYRK 234
           +K  +        G+T+P   G  E++V    +  L P      T+      D  L   +
Sbjct: 189 VKLPE--------GKTAP---GGVELNVDYYEVVGLAPGGEDSFTNKIAEGSDPSLLLDQ 237

Query: 235 RYLDLIMNKDARNRFI-TRSKIISYVRKFLDTRNFIEVETPMM--NVIAGGATAKPFVTH 291
           R+L L    DA +  +  R+ ++  VR+  D  +  EV  P M    + GG+T    +  
Sbjct: 238 RHLAL--RGDALSAVMKVRAALLKSVRRVYDEEHLTEVTPPCMVQTQVEGGST----LFK 291

Query: 292 HNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYA 350
            N    + Y+  + +L+L E  +  +  VY I   FR E      H  E+T  E   A+ 
Sbjct: 292 MNYYGEEAYLTQSSQLYL-ETCLASLGDVYTIQESFRAEKSHTRRHLSEYTHIEAELAFL 350

Query: 351 DVYDLMDMTEIMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRF 410
              DL+   E +I + V+     YV++  P      K+L  NF  P K   M   L+ + 
Sbjct: 351 TFDDLLQHIETLIVKSVQ-----YVLE-DPIAGPLVKQLNPNFKAP-KAPFM--RLQYKD 401

Query: 411 HVTFPAGDQLHTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGH 470
            +T+     +   E  +F      D+  + A              ++ DT   P F+   
Sbjct: 402 AITWLNEHDIKNEEGEDF---KFGDDIAEAAER------------KMTDTIGVPIFLTRF 446

Query: 471 P-QMMSPLAKYSRDQPGLCERFEVFVA-TKEICNAYTELNDPFDQRARFEEQANQKAQGD 528
           P ++ S   K   D P + E  +V +    EI      ++D  +  A F      K +G 
Sbjct: 447 PVEIKSFYMKRCSDDPRVTESVDVLMPNVGEITGGSMRIDDMDELMAGF------KREGI 500

Query: 529 DEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
           D        F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 501 DTDAYY--WFIDQRKYGTCPHGGYGIGTERILAWLCDRFTVRDCSLYP 546

>KLLA0E24486g complement(2173560..2175497) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1 aspartate--tRNA
           ligase, mitochondrial, start by similarity
          Length = 645

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 111/265 (41%), Gaps = 35/265 (13%)

Query: 125 KVSIAGRIHAK-RESGSKLKFYVLHG-DGVEVQVMSQLQDYHTESSYEDDHSLIKRGDIV 182
           KV + G I AK ++ G  L F  L   +G ++Q++             D  S +K   + 
Sbjct: 46  KVVLNGWIDAKPKKVGKNLIFGTLRDPNGEKIQLV-------------DSQSFLKESQVE 92

Query: 183 GVEGYVGRTSPKKGGEG-----EISVFVSRIQLLTPC------LHMLPTDHFGFKDQELR 231
            V   +G  S KK  +      E  + +  +Q L         L  L  D   F  +   
Sbjct: 93  DVVQIIGELSEKKQTQQSTVNIEYELKIIELQKLNQANKKPSQLQDLKADDGAFPPE--- 149

Query: 232 YRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVTH 291
              RYL L + K  +N    R +    VR  LD+ NF EVETP++         +  V  
Sbjct: 150 --YRYLQLRLPK-YQNNLKLRYEASKNVRTVLDSLNFTEVETPLLFKSTPEGAREFLVPT 206

Query: 292 HNDLDMDMYMRI---APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQA 348
              +D +        +P+ + + L+  G++R +++ R FR+E +     PEFT  +   A
Sbjct: 207 RGKIDGEASFYALPQSPQQYKQLLIASGVNRYFQVARCFRDEDLRSDRQPEFTQVDLEMA 266

Query: 349 YADVYDLMDMTEIMISEMVKEITGS 373
           ++   D+ ++ E +I+    ++  S
Sbjct: 267 FSSGKDVREVVEKVITSTWNKLHAS 291

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 470 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKA 525
           HP  M  L  Y++    P  C  E +++ V   E+    T ++DP  Q   F E  N K 
Sbjct: 511 HPFTMVNLRDYNKLESDPLSCHGEHYDLVVNGVELGGGSTRIHDPELQNYIFHEILNIKN 570

Query: 526 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
             D    L+     NA + G PP  G+  G DR+   L  S +IR+V+ FP
Sbjct: 571 PEDLFGHLL-----NAFKMGTPPHAGFAIGFDRMCAMLCGSESIRDVIAFP 616

>KLLA0A11484g 992734..994158 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, mitochondrial,
           start by similarity
          Length = 474

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 89/377 (23%), Positives = 147/377 (38%), Gaps = 56/377 (14%)

Query: 205 VSRIQLLTPCLHMLPTDHFGFKDQELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLD 264
           V   Q   P L  LP         E ++R  YL  ++      RF  R K+ S + K LD
Sbjct: 139 VQNKQTSLPTLRKLP---------EFKHRTTYLSNLL------RF--RHKVESQLTKTLD 181

Query: 265 TRNFIEVETPMMNVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIG 324
             +F  V  P++  I      + F    +  D  + + ++ +L L E+++ G+ RVY + 
Sbjct: 182 GLDFTMVRPPILTSIDCEGAGEMFNLKQDHWDEIVNLTVSSQLHL-EVLMMGLGRVYCLQ 240

Query: 325 RQFRNEGIDMT-HNPEFTTCEFYQAYADVYD-LMDMTEIMISEMVKEITGSYVI-KYHP- 380
             FR E  D   H  EF   E   ++ D  + LMD+ E+M+  +V  ++ +  + KY P 
Sbjct: 241 PCFRAEKSDTNRHLCEFWMLEVEASFVDKNESLMDLVELMVKSVVLSLSETKDLPKYFPV 300

Query: 381 DPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQL-HTAETGEFLKKVLKDNKMD 439
             N +         + WKRI   + +E        +G +  H    G+ L          
Sbjct: 301 GCNIDITSRWAKLLQDWKRITYTDAVE----ALLSSGVKFEHDLAWGKDLNS-------- 348

Query: 440 CAPPLTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEV-FVATK 498
                 + R L    G        P F+  +P+         R      E F++ F    
Sbjct: 349 -----EHERWLCDHFG-------GPVFVTNYPRDCKAFYMKLRPDGTTVECFDLLFPEIG 396

Query: 499 EICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDR 558
           EI       +D         +   Q+ +  D A    + + N  + G  P GG+G GI+R
Sbjct: 397 EIVGGSVREDD--------YDTLKQEIERRDMASNQLDWYLNLRKEGTVPHGGFGIGIER 448

Query: 559 LAMFLADSNTIREVLLF 575
           L  +L  +  IR+ + F
Sbjct: 449 LVSYLYGNPNIRDSIPF 465

>Sklu_2265.3 YHR019C, Contig c2265 4970-6652
          Length = 560

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 117/498 (23%), Positives = 193/498 (38%), Gaps = 78/498 (15%)

Query: 99  FQVSVTLPEFLSKYANLKRGETLPEEKVSIAGRIHAKRESGSKLKFYVLH-GDG-VEVQV 156
            Q   +LP+  ++   + +  T    ++ ++G IH  R S   L F VL  G G ++  +
Sbjct: 113 IQEDTSLPK--AEKVKISKSYTTIGSRIKVSGWIHRLR-SNKSLCFVVLRDGTGFLQAVL 169

Query: 157 MSQLQDYHTESSYEDDHSLIKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLH 216
              L   +  S+   + ++   G I  +    G+T+P   G  E++V    I  L P   
Sbjct: 170 AGDLAKAYQTSTLTLESTVTLYGTISKLPE--GKTAP---GGVELAVDYYEIVSLAPS-- 222

Query: 217 MLPTDHFGFKDQE-----LRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEV 271
               D F  K QE     L   +R+L L   +        R+ ++  +R+  +     EV
Sbjct: 223 --GEDAFTNKVQEGADPSLLLDQRHLAL-RGETLSAVMKVRASLLRAIRRAYEEEQLTEV 279

Query: 272 ETPMM--NVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRN 329
             P M    + GG+T      +  +     Y+  + +L+L E  +  +  VY I   FR 
Sbjct: 280 TPPCMVQTQVEGGSTLFKLDYYGEE----AYLTQSSQLYL-ETCLASLGDVYCIQESFRA 334

Query: 330 EGIDMT-HNPEFTTCEFYQAYADVYDLMDMTEIMISEMVK-----EITGSYVIKYHPD-- 381
           E      H  E+T  E    + D  DL+   E +I++ V+      I G  + + +PD  
Sbjct: 335 EKSHTRRHLSEYTHIEAELCFLDFDDLLSHIERVITKSVQYVLEDPIAGPLIKQLNPDFQ 394

Query: 382 -PNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDC 440
            P    K LE      W + + I+   N     F  GD +  AE  E             
Sbjct: 395 APQLPFKRLEYKDAIEWLKEHGIK---NEDGEEFKFGDDI--AEAAE------------- 436

Query: 441 APPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLAKYSRDQPGLCERFEVFVAT-K 498
                          ++ DT   P  +   P ++ S   K   D P + E  +V + T  
Sbjct: 437 --------------RKMTDTIGVPILLTRFPVEIKSFYMKRCTDDPSVTESVDVLMPTVG 482

Query: 499 EICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDR 558
           EI      ++   +  A F      K +G D A      F +   YG  P GG+G G +R
Sbjct: 483 EITGGSMRIDSIEELMAGF------KREGIDPAAYY--WFIDQRRYGSCPHGGYGLGTER 534

Query: 559 LAMFLADSNTIREVLLFP 576
           +  +L D  T+R+  L+P
Sbjct: 535 ILAWLCDRFTVRDCSLYP 552

>KLLA0A08426g complement(745048..746712) similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, start by similarity
          Length = 554

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 99/474 (20%), Positives = 184/474 (38%), Gaps = 76/474 (16%)

Query: 123 EEKVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHSLIKRGDIV 182
           +++V ++G +H  R + S +   +  G G    V++         SY+  +  ++    +
Sbjct: 129 DKRVKVSGWVHRLRNNKSVVFIILRDGTGFLQTVLTG----DLARSYQIVNLTLE--TTI 182

Query: 183 GVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGF-------KDQELRYRKR 235
            + G +      K   G + +FV   +++ P     P+    F        D  +   +R
Sbjct: 183 TLYGTIKVVPESKSAPGGVELFVDYFEIVGPA----PSGENAFTNRVQENADPSILLDQR 238

Query: 236 YLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMM--NVIAGGATAKPFVTHHN 293
           +L ++  +        R+ ++  +R+  D     EV  P M    + GG+T      +  
Sbjct: 239 HL-MLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPPCMVQTQVEGGSTLFKLDYYGE 297

Query: 294 DLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADV 352
           +     ++  + +L+L E  +  +  VY I   FR E      H  E+T  E    + D 
Sbjct: 298 E----AFLTQSSQLYL-ETCLAALGDVYCIQESFRAEKSHTRRHLSEYTHIEAELCFLDF 352

Query: 353 YDLMDMTEIMISEMVK-----EITGSYVIKYHPD---PNDETKELELNFTRPWKRINMIE 404
            DL+   E +I++ ++      + G  V K +P+   P    K +E      W + + I+
Sbjct: 353 DDLLSHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQLPFKRMEYKDAIEWLKEHGIK 412

Query: 405 ELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINP 464
             E++    F  GD +  AE  E                            ++ DT   P
Sbjct: 413 NEEDK---EFQFGDDI--AEAAE---------------------------RKMTDTIGVP 440

Query: 465 TFIFGHP-QMMSPLAKYSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRARFEEQAN 522
             +   P ++ S   K   D   + E  +V + T  EI      ++D  +  A F     
Sbjct: 441 ILLTRFPLEIKSFYMKRCDDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGF----- 495

Query: 523 QKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
            K +G D A      F +  +YG  P GG+G G +R+  +L D  T+R+  L+P
Sbjct: 496 -KREGIDPAPYY--WFIDQRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYP 546

>YPL104W (MSD1) [5340] chr16 (355695..357671) Aspartyl-tRNA
           synthetase, mitochondrial [1977 bp, 658 aa]
          Length = 658

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 7/135 (5%)

Query: 235 RYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFV----T 290
           RYL L  N   ++    RS I   +R   +  +F EVETPM+   A    A+ F+    T
Sbjct: 152 RYLQL-RNPKYQDFLKKRSSISKEIRNSFNNFDFTEVETPML-FKATPEGAREFLVPTRT 209

Query: 291 HHNDLDMDMY-MRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAY 349
             +D     Y +  +P+ + + L+  G+++ Y++ R FR+E +     PEFT  +   A+
Sbjct: 210 KRSDGKPSFYALDQSPQQYKQLLMASGVNKYYQMARCFRDEDLRADRQPEFTQVDMEMAF 269

Query: 350 ADVYDLMDMTEIMIS 364
           A+  D+M + E  +S
Sbjct: 270 ANSEDVMKIIEKTVS 284

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 470 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKA 525
           HP  M  L  Y +    P  C    +++ V   E+    T ++DP  Q   FE+      
Sbjct: 520 HPFTMVKLKDYEKLEKTPEKCLGRHYDLVVNGVELGGGSTRIHDPRLQDYIFEDILKI-- 577

Query: 526 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
              D A  +     NA + G PP  G+  G DR+   + ++ +IR+V+ FP
Sbjct: 578 ---DNAYELFGHLLNAFDMGTPPHAGFAIGFDRMCAMICETESIRDVIAFP 625

>AGR206C [4517] [Homologous to ScYPL104W (MSD1) - SH]
           (1144536..1146491) [1956 bp, 651 aa]
          Length = 651

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (46%), Gaps = 3/129 (2%)

Query: 248 RFITRSKIISYVRKFLDTRNFIEVETPMM-NVIAGGATAKPFVTHHNDLDMDMYMRI--A 304
           R   R      VR  L+   F+EVETP++      GA      T H      ++  +  +
Sbjct: 164 RMKMRHNASKTVRASLEKLGFMEVETPLLFKSTPEGAREFLVPTRHKQGKDPLFYALPQS 223

Query: 305 PELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEIMIS 364
           P+ + + L+ GG+ + Y++ R FR+E +     PEFT  +   A+A+  D+M + E  + 
Sbjct: 224 PQQYKQLLMAGGVSKYYQLARCFRDEDLRSDRQPEFTQVDLEMAFANGDDVMRVVESTVL 283

Query: 365 EMVKEITGS 373
               E+  S
Sbjct: 284 NTWNEVALS 292

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 470 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKA 525
           HP  M  L  Y +  ++P  C  + ++  V   E+    T ++DP  QR  F    NQ  
Sbjct: 513 HPFTMVRLQDYQKLSEKPLSCLGQHYDFVVNGVELGGGSTRVHDPVLQRYIF----NQIL 568

Query: 526 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
           + ++E Q+       A   G PP  G+  G DR+   +    +IR+V+ FP
Sbjct: 569 KINNEDQVFGH-LLEAFSMGTPPHAGFAIGFDRMVAMMCAKESIRDVIAFP 618

>Kwal_14.2303
          Length = 475

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 100/250 (40%), Gaps = 27/250 (10%)

Query: 126 VSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQDYHTESSYEDDHS-LIKRGDIVGV 184
           V +  R+H  R+ G+ L F  L      +Q + +     T S      +  I    IV V
Sbjct: 121 VVLRARVHNSRQQGATLVFLTLRQQANLIQALVKSNAEGTISKQMVKWTGSISPESIVLV 180

Query: 185 EGYVGRTSP--KKGGEGEISVFVSRIQLLTPCLHMLPT--DHFGFKDQEL---------- 230
            G V +     K      + + +++I  ++     LP   +     D E           
Sbjct: 181 HGVVKKVEEPIKSATVQNLEIHITQIFTISEAPQQLPILIEDASRSDAEAEAAGLPVVNL 240

Query: 231 --RYRKRYLDLIMNKDARNRFITR--SKIISYVRKFLDTRNFIEVETPMMNVIAGGATAK 286
             R   R +DL   + A N+ I R  S +    R+FL  R F+E+ TP +        A 
Sbjct: 241 DTRLDARVIDL---RTATNQAIFRIQSGVCELFREFLTQRKFVEIHTPKLLGAPSEGGAN 297

Query: 287 PF-VTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDM-THNPEFTTCE 344
            F VT+        Y+  +P+ + +EL+    +RV+E+   FR E  +   H  EFT  +
Sbjct: 298 VFEVTYFKG---KSYLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFTGLD 354

Query: 345 FYQAYADVYD 354
              A+ + YD
Sbjct: 355 LEMAFEEHYD 364

>AEL020W [2486] [Homologous to ScYHR019C (DED81) - SH]
           complement(598366..600024) [1659 bp, 552 aa]
          Length = 552

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 130/330 (39%), Gaps = 40/330 (12%)

Query: 251 TRSKIISYVRKFLDTRNFIEVETPMM--NVIAGGATAKPFVTHHNDLDMDMYMRIAPELF 308
            R+  +  +R+  +    +EV  P M    + GG+T    +   +    + ++  + +L+
Sbjct: 251 VRAAFLRAIRRVYEDEGLLEVTPPCMVQTQVEGGST----LFKLDYYGEEAFLTQSSQLY 306

Query: 309 LKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTEIMISEMV 367
           L E  +  +  V+ I   FR E      H  E+T  E    + D   L+  TE +I+ +V
Sbjct: 307 L-ETCLPALGDVFCIQESFRAEKSHTRRHLSEYTHIEAELGFVDFDQLLRHTERVITSLV 365

Query: 368 KEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQLHTAETGE 427
           +     YV++  P      K+L  +F  P         LE +  +T+     +   E  E
Sbjct: 366 R-----YVLE-DPVAGPLVKQLNPDFVPPQMPFM---RLEYKDAITWLNEHGIKNEEGEE 416

Query: 428 FLKKVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLAKYSRDQPG 486
           F      D+  + A              ++ DT   P F+   P ++ S   K   D P 
Sbjct: 417 F---KFGDDIAEAAER------------KMTDTIGKPIFLTRFPLELKSFYMKRCADDPR 461

Query: 487 LCERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGL 546
           + E F+V + T       +   D  D     E  A  K +G +        F +   YG 
Sbjct: 462 VTESFDVLMPTVGEVTGGSMRIDSLD-----ELMAGFKREGVNPEPYY--WFSDQRRYGS 514

Query: 547 PPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
            P GG+G G +R+  +L +   +R+  L+P
Sbjct: 515 CPHGGYGLGTERILAWLCNRYPVRDCSLYP 544

>Scas_700.6
          Length = 658

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 88/196 (44%), Gaps = 10/196 (5%)

Query: 176 IKRGDIVGVEGYVGRTSPKKGGEGE----ISVFVSRIQLLTPCLHMLPTDHFGFKDQELR 231
           + R D++ V G + +   K     E      + V +I +L    +  P+    FK ++  
Sbjct: 99  LNREDVIQVNGTLMKKKEKSVSSAENIFEYEIQVEKISVLNSS-NEKPSQLHEFK-KDGN 156

Query: 232 YRKRYLDLIMNKDARNRFI-TRSKIISYVRKFLDTRNFIEVETPMM-NVIAGGAT--AKP 287
           Y   Y  L +       F+  R +I   +R+ L+   F+E+ETP++      GA     P
Sbjct: 157 YPPEYRFLQLRHHKYQEFLRKRYQISCKLRQLLNEEEFLEIETPILFKPTPEGAREFLVP 216

Query: 288 FVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTTCEFYQ 347
             T  N       +  +P+ + + L+  G+ + +++ R FR+E +     PEFT  +   
Sbjct: 217 TRTKENSTPSFYSLTQSPQQYKQLLMASGVFKYFQVARCFRDEDLRADRQPEFTQIDMEM 276

Query: 348 AYADVYDLMDMTEIMI 363
           ++++  D+M + E ++
Sbjct: 277 SFSNGEDVMALLERLV 292

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 49/111 (44%), Gaps = 9/111 (8%)

Query: 470 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKA 525
           HP  M  L  Y +    P  C  + +++ +   E+    T ++DP  Q   FE       
Sbjct: 522 HPFTMVQLQDYEKLNSNPSQCRGQHYDLVINGVELGGGSTRVHDPILQDYIFENILKI-- 579

Query: 526 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
              + A+ +      A E G PP  G+  G DR+   L+ + +IR+V+ FP
Sbjct: 580 ---ENAEELFGHLLRAFEMGTPPHAGFAIGFDRMCAMLSGTESIRDVIAFP 627

>CAGL0H05907g complement(579444..581423) similar to sp|P15179
           Saccharomyces cerevisiae YPL104w MSD1, hypothetical
           start
          Length = 659

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 70/147 (47%), Gaps = 16/147 (10%)

Query: 235 RYLDLIMNKDAR--NRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAKPFVT-- 290
           RY+ L   + AR  N   TR ++   +R+ LD   F E+ETP +   A    A+ F+   
Sbjct: 151 RYIQL---RTARYQNYLRTRYEVSKTLRQILDQDGFTEIETPTL-FKATPEGAREFMVPT 206

Query: 291 ------HHNDLDMDMYMRI--APELFLKELVVGGMDRVYEIGRQFRNEGIDMTHNPEFTT 342
                    D  + M+  +  +P+ + + L+  G+ + ++  R +R+E +     PEFT 
Sbjct: 207 RVSAKIKQVDKIVPMFYALTQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQ 266

Query: 343 CEFYQAYADVYDLMDMTEIMISEMVKE 369
            +   ++A   D+M + E  I+ + K+
Sbjct: 267 LDMEMSFASQKDVMSVIEKCITSVWKK 293

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 470 HPQMMSPLAKYSR--DQPGLC--ERFEVFVATKEICNAYTELNDPFDQRARFEEQANQKA 525
           HP  M  L  Y +    P  C  + +++ +   E+    T ++DP  Q+  FE       
Sbjct: 520 HPFTMVQLQDYDKLTTNPIDCLGQHYDLVMNGIELGGGSTRIHDPELQKFMFEN-----V 574

Query: 526 QGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
                 Q++     +A E G PP  G+  G DR+   L  +++IR+V+ FP
Sbjct: 575 LKISNYQILFGHLLSAFETGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPFP 625

>Kwal_0.375
          Length = 428

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 122/279 (43%), Gaps = 32/279 (11%)

Query: 104 TLPEFLSKYANLKRGETLPEEKVSIAGRIHAKRESGSKLKFYVLH-GDG-VEVQVMSQLQ 161
           +LP+  +KY  +K  + + +++V ++G IH +R S S L F VL  G G ++  +   L 
Sbjct: 112 SLPD-ATKYKIIKSYDAI-DQRVKVSGWIHRQRSSKS-LVFIVLRDGTGYLQAVLTGDLA 168

Query: 162 DYHTESSYEDDHSLIKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTD 221
             H  S+   + S+   G +  +    G+T+P     G + + V   ++++    + P+ 
Sbjct: 169 RAHQTSTLTLESSITLYGKVCKLPE--GKTAP-----GGVELLVDYYEIIS----LAPSG 217

Query: 222 HFGF-------KDQELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETP 274
              F        D  L   +R+L L   +        R+ ++  VR+F D     EV  P
Sbjct: 218 DDAFTNKIAEGADPSLLLDQRHLAL-RGETLSAVMKVRAALLRSVRRFYDQEGLTEVTPP 276

Query: 275 MM--NVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGI 332
            M    + GG+T      +      + Y+  + +L+L E  +  +  VY I   FR E  
Sbjct: 277 CMVQTQVEGGSTLFKLGYYGE----EAYLTQSSQLYL-ETCLASLGDVYSIQESFRAEKS 331

Query: 333 DM-THNPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEI 370
               H  E+T  E    +    +++   E +I+++V+ +
Sbjct: 332 HTRRHLSEYTHIEAELCFLSFDEMLVHIEKLITQVVQSV 370

>Scas_607.14
          Length = 555

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 103/481 (21%), Positives = 185/481 (38%), Gaps = 92/481 (19%)

Query: 124 EKVSIAGRIHAKRESGSKLKFYVLH-GDGV-------EVQVMSQLQDYHTESSYEDDHSL 175
           ++V I+G +H  R S  K+ F VL  G G        ++ +  Q  D   E++     ++
Sbjct: 131 QRVKISGWVHRFR-SNKKVVFLVLRDGTGFLQCVLTGDLALAKQTLDITLETTVTLYGTI 189

Query: 176 IKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRIQLLTPCLHMLPTDHFGF-------KDQ 228
           IK  +        G+T+P     G++ + V   +++       P+    F        D 
Sbjct: 190 IKVPE--------GKTAP-----GDVELVVDYYEVV----GQAPSGEEAFTNKIAEDSDP 232

Query: 229 ELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMM--NVIAGGATAK 286
            L   +R+L L   +        R+ ++  VR+  +    +EV  P M    + GG+T  
Sbjct: 233 SLLLDQRHLAL-RGETLSGVMKVRAALLRAVRRVYEEEGLLEVTPPCMVQTQVEGGST-- 289

Query: 287 PFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNPEFTTCEF 345
             +   +    + ++  + +L+L E  +  +  V+ +   FR E      H  E+T  E 
Sbjct: 290 --LFKLDYYGEEAFLTQSSQLYL-ETCLPALGDVFCVQESFRAEKSHTRRHLSEYTHIEA 346

Query: 346 YQAYADVYDLMDMTEIMISEMVK-----EITGSYVIKYHPD---PNDETKELELNFTRPW 397
             A+    +L++  E +I + V+      + G  V + HP    P      LE      W
Sbjct: 347 ELAFLTFEELLEHIETLIVKSVQYVMEDPVAGPIVNQLHPHFVPPKGPFMRLEYKDAITW 406

Query: 398 KRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDCAPPLTNARMLDKLVGEL 457
            + + I+   N     F  GD +  AE  E                            ++
Sbjct: 407 LQEHNIK---NEDGEDFKFGDDI--AEAAE---------------------------RKM 434

Query: 458 EDTCINPTFIFGHP-QMMSPLAKYSRDQPGLCERFEVFVAT-KEICNAYTELNDPFDQRA 515
            DT   P  +   P ++ S      +D P + E  +V + T  EI      ++D  +  A
Sbjct: 435 TDTLNVPILLTRFPVEIKSFYMPKCKDDPRVTESVDVLMPTVGEITGGSMRISDIDELMA 494

Query: 516 RFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLF 575
            F      K +G D        F +  +YG  P GG+G G +R+  +L +  T+R+  L+
Sbjct: 495 GF------KREGIDPKPYY--WFIDQRKYGTCPHGGYGLGTERILAWLCNRFTVRDCSLY 546

Query: 576 P 576
           P
Sbjct: 547 P 547

>CAGL0A02112g 216596..218242 highly similar to sp|P38707
           Saccharomyces cerevisiae YHR019c DED81
           asparaginyl-tRNA-synthetase, hypothetical start
          Length = 548

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 109/509 (21%), Positives = 190/509 (37%), Gaps = 98/509 (19%)

Query: 98  KFQVSVTLPEFLSKYANLKRGETLPEEKVSIAGRIHAKRESGSKLKFYVLHGDGV----- 152
           K +   +LPE  +K   + +   L  ++V I+G IH  R S  K+ F VL  DG      
Sbjct: 100 KIEEDKSLPE--AKKCKIGQSYELVGQRVKISGWIHRLR-SNKKVMFIVLR-DGYGYLQS 155

Query: 153 ----EVQVMSQLQDYHTESSYEDDHSLIKRGDIVGVEGYVGRTSPKKGGEGEISVFVSRI 208
               ++ +  Q  D   ES+             V + G + +    K   G + + V   
Sbjct: 156 VLTGDLAIAQQSLDLTIEST-------------VTLYGTITKVPEGKSAPGGVELLVDYY 202

Query: 209 QLLTPCLHMLPTDHFGF-------KDQELRYRKRYLDLIMNKDARNRFITRSKIISYVRK 261
           +++     + P+    F        D  L   +R+L L   +        R+ ++  +R+
Sbjct: 203 EVV----GLAPSGDEAFTNKIAEGADPSLLLDQRHLAL-RGETLSAVMKVRAALMKSIRR 257

Query: 262 FLDTRNFIEVETPMM--NVIAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDR 319
                +  EV  P M    + GG+T      +        Y+  + +L+L E  +  +  
Sbjct: 258 VYTEESLTEVTPPCMVQTQVEGGSTLFKLDYYGEQ----AYLTQSSQLYL-ETCLPSLGD 312

Query: 320 VYEIGRQFRNEGIDMT-HNPEFTTCEFYQAYADVYDLMDMTEIMISEMVK-----EITGS 373
           VY +   FR E      H  E+T  E   A+    +L+D  E ++ + V+      I G 
Sbjct: 313 VYCVQESFRAEKSHTRRHLSEYTHIEAELAFLTFEELLDHIERVLCKTVQYILEDPIAGP 372

Query: 374 YVIKYHPD---PNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQLHTAETGEFLK 430
            V + +PD   P      LE      W + +   +++N     F  GD +  AE  E   
Sbjct: 373 LVKQLNPDFQAPKMPFMRLEYKDAIEWLKEH---DIKNEDGEEFKFGDDI--AEAAE--- 424

Query: 431 KVLKDNKMDCAPPLTNARMLDKLVGELEDTCINPTFIFGHP-QMMSPLAKYSRDQPGLCE 489
                                    ++ DT   P  +   P ++ S      +D   + E
Sbjct: 425 ------------------------RKMTDTIGVPILLTKFPAEIKSFYMPRCKDDNRVTE 460

Query: 490 RFEVFVAT-KEICNAYTELNDPFDQRARFE-EQANQKAQGDDEAQLVDETFCNALEYGLP 547
             +V + T  EI      +N   +  A F+ E  + KA            F +  +YG  
Sbjct: 461 SVDVLMPTVGEITGGSMRINTEEELLAGFKRENIDPKAY---------YWFIDQRKYGTC 511

Query: 548 PTGGWGCGIDRLAMFLADSNTIREVLLFP 576
           P GG+G G +R+  +L +  T+R+  L+P
Sbjct: 512 PHGGYGLGTERILAWLCNRFTVRDCSLYP 540

>Scas_628.24
          Length = 487

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 82/368 (22%), Positives = 154/368 (41%), Gaps = 52/368 (14%)

Query: 226 KDQELRYRKRYLDLIMNKDARNRFITRSKIISY----VRKFLDTRNFIEVETPMMNVIAG 281
           K+Q L Y  R ++ I  K   N F  + K  S+    +  FL   NFI+V  P   +I G
Sbjct: 146 KNQSLTYL-RSINPIF-KHRTNYFKQQLKFRSFMEFQIHYFLMINNFIKVAPP---IITG 200

Query: 282 ----GATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-H 336
               GA  + F         D Y+ ++ +L L E ++   ++ + +   FR E  +   H
Sbjct: 201 NDCEGANNELFKIK----PTDAYLTVSAQLHL-ETLLNSTNKTWSLIPCFRAEKSNTNRH 255

Query: 337 NPEFTTCEFYQAYAD-VYDLMDMTEIMISEMVKEIT---GSYVIKYHPDPNDETKELELN 392
             EF   E   AY D +  L+D     I  +VK+        + +Y+P+  D+ + +   
Sbjct: 256 LLEFWMLELELAYIDDLEPLLDFIREFIIYLVKQCREHENDLLPRYYPNGVDDRETI--- 312

Query: 393 FTRPWKRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMDCAPPLTNARMLDK 452
            TR W   ++I+              + +T    + +KK+ +  +     P     +  +
Sbjct: 313 LTR-WD--SLIDP------------SKWNTVTYDDAIKKLQESGQDFVFKPTWGKALQSE 357

Query: 453 LVGELEDTCIN--PTFIFGHPQMMSPL-AKYSRDQPGLCERFEVFV-ATKEICNAYTELN 508
               L ++  N  P F+  +P+       K + + P   E F++ V    EI       N
Sbjct: 358 HEKWLAESYFNGTPVFVTKYPKDCKAFYMKQTPENPETVECFDLLVPGMGEIIGGSLREN 417

Query: 509 DPFDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLADSNT 568
           +     A+ E + +++   +   +L    + +  + G  P GG+G G++RL  +L  ++ 
Sbjct: 418 N----SAKLESEMDRRGM-NKRGEL--NWYIDLRKNGSVPHGGFGLGLERLISYLFGNHN 470

Query: 569 IREVLLFP 576
           I++ + FP
Sbjct: 471 IKDAIPFP 478

>YCR024C (YCR024C) [558] chr3 complement(160739..162217)
           Asparaginyl-tRNA synthetase, mitochondrial [1479 bp, 492
           aa]
          Length = 492

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 88/434 (20%), Positives = 162/434 (37%), Gaps = 64/434 (14%)

Query: 175 LIKRGDIVGVEGYVGRTSP--KKGGEGEISVFVSRIQLLTPCLHMLP------TDHFGFK 226
           ++K G  + +     +++P  K+  E +I   V  I+L+ P     P      T  +   
Sbjct: 80  ILKTGQTLSISNATWQSTPNRKQPFELQIKNPVKSIKLVGPVSENYPLQKKYQTLRYLRS 139

Query: 227 DQELRYRKRYLDLIMNKDARNRFITRSKIISYVRKFLDTRNFIEVETPMMNVIAGGATAK 286
              L+YR  YL  I+    R R     + + Y +K     +F +V  P++         +
Sbjct: 140 LPTLKYRTAYLSAIL----RLRSFVEFQFMLYFQK----NHFTKVSPPILTSNDCEGAGE 191

Query: 287 PFVTHHND-------LDMDMYMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT-HNP 338
            F    N             Y+ ++ +L L E++   + R + +   FR E  D   H  
Sbjct: 192 LFQVSTNTSPTASSYFGKPTYLTVSTQLHL-EILALSLSRCWTLSPCFRAEKSDTPRHLS 250

Query: 339 EFTTCEFYQAYAD-VYDLMDMTEIMISEMVK-------EITGSYVIKYHPDPNDETKELE 390
           EF   E    + + V +L    E  I  ++K       E+     I      N+ + EL 
Sbjct: 251 EFWMLEVEMCFVNSVNELTSFVETTIKHIIKACIDNQQELLPKQFIS--SQENNASSELS 308

Query: 391 LNFTRPWKRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMD-------CAPP 443
           +N      +    + +  ++H        +      E LKK  + N++           P
Sbjct: 309 INQETQQIKTRWEDLINEKWH-------NITYTNAIEILKK--RHNEVSHFKYEPKWGQP 359

Query: 444 LTNARMLDKLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPG-LCERFEVFV-ATKEIC 501
           L        L GE   +   P F+  +P++  P        P      F++ V    EI 
Sbjct: 360 LQTEHE-KFLAGEYFKS---PVFVTDYPRLCKPFYMKQNSTPDDTVGCFDLLVPGMGEII 415

Query: 502 NAYTELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAM 561
                 +D +D+  R       KA+G + +  +D  + +  + G  P GG+G G +R   
Sbjct: 416 GGSLREDD-YDKLCR-----EMKARGMNRSGELD-WYVSLRKEGSAPHGGFGLGFERFIS 468

Query: 562 FLADSNTIREVLLF 575
           +L  ++ I++ + F
Sbjct: 469 YLYGNHNIKDAIPF 482

>CAGL0K07656g 761388..762881 highly similar to sp|P15625
           Saccharomyces cerevisiae YFL022c Phenylalanyl-tRNA
           synthetase alpha chain, start by similarity
          Length = 497

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 319 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTEIMISEMVKEITGSYVI 376
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E   ++M   +TG   +
Sbjct: 345 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFAKM--GVTG---L 399

Query: 377 KYHPDPN 383
           K+ P  N
Sbjct: 400 KFKPTYN 406

>AFR516W [3708] [Homologous to ScYFL022C (FRS2) - SH]
           complement(1358569..1360068) [1500 bp, 499 aa]
          Length = 499

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 319 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTEIMISEMVKEITGSYVI 376
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E   ++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM--GVTG---L 401

Query: 377 KYHPDPNDETK 387
           ++ P  N  T+
Sbjct: 402 RFKPTYNPYTE 412

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
           cell stress, member of the DnaJ family of predicted
           protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 347 QAYADVYDLMDMTEIMISEMVKEITGSYVIKYHPDPNDETKELELNFTRPWKRINMIEEL 406
           Q    +YD +++T    +  +K+   +  +KYHPD N+ T+E +  F    +   +++  
Sbjct: 2   QQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILK-- 59

Query: 407 ENRFHVTFPAGDQLHTAE 424
           +NR    +   DQ  T +
Sbjct: 60  DNRLRALY---DQYGTTD 74

>Kwal_47.17998
          Length = 499

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 319 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVIKY 378
           R++ I R FRNE +D TH  EF   E   A  ++  L D+ + M  E   E  G   +++
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNI-TLGDLIQFM--EGFFEKMGVTGLRF 403

Query: 379 HPDPNDETK 387
            P  N  T+
Sbjct: 404 KPTYNPYTE 412

>KLLA0F25234g complement(2349192..2350691) highly similar to
           sp|P15625 Saccharomyces cerevisiae YFL022c FRS2
           phenylalanine--tRNA ligase beta chain, cytosolic
           singleton, start by similarity
          Length = 499

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 319 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTEIMISEMVKEITGSYVI 376
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E   ++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEDFFAKM--GVTG---L 401

Query: 377 KYHPDPN 383
           ++ P  N
Sbjct: 402 RFKPTYN 408

>Scas_707.14
          Length = 499

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 319 RVYEIGRQFRNEGIDMTHNPEFTTCEFYQAYADVY--DLMDMTEIMISEMVKEITGSYVI 376
           R++ I R FRNE +D TH  EF   E   A  ++   DL+   E   ++M   +TG   +
Sbjct: 347 RLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEEFFAKM--GVTG---L 401

Query: 377 KYHPDPN 383
           ++ P  N
Sbjct: 402 RFKPTYN 408

>YFL022C (FRS2) [1661] chr6 complement(93497..95008)
           Phenylalanyl-tRNA synthetase, beta subunit, cytoplasmic
           [1512 bp, 503 aa]
          Length = 503

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 319 RVYEIGRQFRNEGIDMTHNPEFTTCE 344
           R++ I R FRNE +D TH  EF   E
Sbjct: 351 RLFSIDRVFRNEAVDATHLAEFHQVE 376

>CAGL0L08030g 875106..876509 similar to sp|P25345 Saccharomyces
           cerevisiae YCR024c asn-tRNA synthetase, hypothetical
           start
          Length = 467

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 536 ETFCNALEYGLPPTGGWGCGIDRLAMFLADSNTIREVLLFP 576
           + + N  + G+ P GG+G G +R   +L     I++ + FP
Sbjct: 418 DWYVNLRKQGVAPHGGFGLGFERFISYLLGIQNIKDTIPFP 458

>KLLA0B13090g complement(1142698..1145763) similar to sp|P12868
           Saccharomyces cerevisiae YMR231w PEP5 vacuolar
           biogenesis protein singleton, start by similarity
          Length = 1021

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 58/137 (42%), Gaps = 22/137 (16%)

Query: 326 QFRNEGIDMTHNPE------FTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVIKYH 379
            F+ +G+    NPE           F+ + + ++DL     +++   + E+   YV+KY 
Sbjct: 469 HFKRDGV-FNENPEEFGNWSMNDDSFFYSDSSLFDLDIALRLLLECNMLELAQKYVLKYS 527

Query: 380 PDPNDETKELELNFTRPWKRINMIEELENRFHVTFPAGDQLHTAETGEFLKKVLKDNKMD 439
            DP+     + L+    +  +N I+ L        P  D L      +F +K+L     D
Sbjct: 528 KDPSQVVSIVLLHKKDSFGALNYIKSL--------PVDDALRV--LIKFSRKLL-----D 572

Query: 440 CAPPLTNARMLDKLVGE 456
             P  TN  ++D  +G+
Sbjct: 573 LIPNETNLLLIDLFIGQ 589

>CAGL0J09900g 966959..967810 highly similar to sp|P04840
           Saccharomyces cerevisiae YNL055c POR1, start by
           similarity
          Length = 283

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 48/119 (40%), Gaps = 19/119 (15%)

Query: 286 KPFVTHHNDLDM--------DMYMR-----IAPELFLKELVVGGMDRVYEIGRQFRNE-- 330
           +PF T     D+        DM +      +A   F  ++  G + + Y I   +  +  
Sbjct: 118 QPFFTARGAFDLLKGPGFVGDMTLAHESGVVAGAQFGYDIAAGSLSK-YAIALGYAAQDY 176

Query: 331 --GIDMTHNPEFTTCEFYQAYADVYDLMDMTEIMISEMVKEITGSYVIKYHPDPNDETK 387
             G+++ +N + TT  F+Q  +    +     +   + V  +   +  KY PDPN + K
Sbjct: 177 HLGLNI-NNDQVTTATFFQNVSPQLQIGSRATLNPRQTVSNVNIEFATKYLPDPNSQVK 234

>KLLA0F24200g 2257007..2258965 similar to sp|P53918 Saccharomyces
           cerevisiae YNL125c ESBP6, hypothetical start
          Length = 652

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 5/56 (8%)

Query: 512 DQRARFEEQANQKAQGDDEAQLVDETFCN--ALEYGLPPTGGWG---CGIDRLAMF 562
           D    +  +   +  GDDE Q +++ F N       LPP GG+G   C    L MF
Sbjct: 153 DSEGEYRSEVPVELAGDDEGQTLNKVFTNKETNTLDLPPEGGYGWVCCLCVTLVMF 208

>CAGL0J02486g complement(239041..242748) similar to sp|P40318
           Saccharomyces cerevisiae YIL030c SSM4, hypothetical
           start
          Length = 1235

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 506 ELNDPFDQRARFEEQANQKAQGDDEAQLVDETFCNA 541
           E+NDPF  R RFEE  N++AQ   +  L  +   NA
Sbjct: 326 EMNDPF--RERFEEMMNRRAQNQFDNLLAQQQERNA 359

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,783,900
Number of extensions: 831619
Number of successful extensions: 2351
Number of sequences better than 10.0: 56
Number of HSP's gapped: 2368
Number of HSP's successfully gapped: 66
Length of query: 579
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 472
Effective length of database: 12,891,983
Effective search space: 6085015976
Effective search space used: 6085015976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)