Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F16907g45244118160.0
Scas_608.543132311271e-152
Kwal_27.1014646931611041e-148
CAGL0C02211g48132011031e-147
YEL040W (UTR2)46732510491e-139
KLLA0F04906g4963226143e-74
Kwal_56.245184753255942e-71
Sklu_1954.15103285832e-69
YLR213C (CRR1)4223275562e-66
Scas_674.154183395396e-64
CAGL0J08910g4943185394e-63
ADR078C4501894991e-57
AGR318C4521592851e-27
CAGL0G09449g4522212772e-26
Scas_441.24251712593e-24
YGR189C (CRH1)5071882596e-24
Sklu_2390.24781502561e-23
KLLA0F22671g4662262515e-23
Scas_507.24311652462e-22
Kwal_33.153934591652302e-20
Scas_720.273881911182e-06
Scas_647.223861731111e-05
Scas_630.33872301092e-05
Scas_647.19d3872061049e-05
Scas_721.134384175850.018
KLLA0E23958g208248656.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F16907g
         (445 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F16907g 1555857..1557215 some similarities with sp|P32623 S...   704   0.0  
Scas_608.5                                                            438   e-152
Kwal_27.10146                                                         429   e-148
CAGL0C02211g 225012..226457 similar to sp|P32623 Saccharomyces c...   429   e-147
YEL040W (UTR2) [1387] chr5 (78053..79456) Cell wall protein [140...   408   e-139
KLLA0F04906g complement(482183..483673) some similarities with s...   241   3e-74
Kwal_56.24518                                                         233   2e-71
Sklu_1954.1 YLR213C, Contig c1954 323-1855 reverse complement         229   2e-69
YLR213C (CRR1) [3614] chr12 complement(566656..567924) Sporulati...   218   2e-66
Scas_674.15                                                           212   6e-64
CAGL0J08910g complement(877143..878627) similar to tr|Q05790 Sac...   212   4e-63
ADR078C [1819] [Homologous to ScYLR213C (CRR1) - SH] (847158..84...   196   1e-57
AGR318C [4629] [Homologous to ScYGR189C (CRH1) - SH] (1325918..1...   114   1e-27
CAGL0G09449g 898735..900093 similar to sp|P53301 Saccharomyces c...   111   2e-26
Scas_441.2                                                            104   3e-24
YGR189C (CRH1) [2140] chr7 complement(876672..878195) Cell wall ...   104   6e-24
Sklu_2390.2 YGR189C, Contig c2390 9663-11099                          103   1e-23
KLLA0F22671g complement(2115530..2116930) some similarities with...   101   5e-23
Scas_507.2                                                             99   2e-22
Kwal_33.15393                                                          93   2e-20
Scas_720.27                                                            50   2e-06
Scas_647.22                                                            47   1e-05
Scas_630.3                                                             47   2e-05
Scas_647.19d                                                           45   9e-05
Scas_721.134                                                           37   0.018
KLLA0E23958g complement(2124622..2130870) some similarities with...    30   6.4  

>KLLA0F16907g 1555857..1557215 some similarities with sp|P32623
           Saccharomyces cerevisiae YEL040w UTR2 cell wall protein,
           hypothetical start
          Length = 452

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/441 (80%), Positives = 356/441 (80%)

Query: 1   MRSFXXXXXXXXXXXXXXXXXDETTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKF 60
           MRSF                 DETTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKF
Sbjct: 1   MRSFAKVLALAAVALKVVSAADETTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKF 60

Query: 61  SYKKEACMPLPVCRDTITIFDNYTSKMANLYTYLGDASKANWTYEGYPIDYEDENALIMA 120
           SYKKEACMPLPVCRDTITIFDNYTSKMANLYTYLGDASKANWTYEGYPIDYEDENALIMA
Sbjct: 61  SYKKEACMPLPVCRDTITIFDNYTSKMANLYTYLGDASKANWTYEGYPIDYEDENALIMA 120

Query: 121 MPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQ 180
           MPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQ
Sbjct: 121 MPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQ 180

Query: 181 TNWYWQGALNYTNSKNLTATNNDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTS 240
           TNWYWQGALNYTNSKNLTATNNDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTS
Sbjct: 181 TNWYWQGALNYTNSKNLTATNNDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTS 240

Query: 241 KQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDWDSDDIKDYGYYYAVLESVNITC 300
           KQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDWDSDDIKDYGYYYAVLESVNITC
Sbjct: 241 KQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDWDSDDIKDYGYYYAVLESVNITC 300

Query: 301 YDPPSGTTKNGSEVYQYSGEDNWLQKGVFITDGNTILKDYDNSGLDDNTPDEXXXXXXXX 360
           YDPPSGTTKNGSEVYQYSGEDNWLQKGVFITDGNTILKDYDNSGLDDNTPDE        
Sbjct: 301 YDPPSGTTKNGSEVYQYSGEDNWLQKGVFITDGNTILKDYDNSGLDDNTPDESSSSSSSS 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXNDDTDEXXXXXXXXXXXXGFVQNMXXXXXXXX 420
                                       NDDTDE            GFVQNM        
Sbjct: 361 STSSSSKSSSTSTGSSSGSASTTTTAGSNDDTDESSSSSTSSSAAAGFVQNMSTTSSSGN 420

Query: 421 XXXXXXXXXXXXEKNLSYGFG 441
                       EKNLSYGFG
Sbjct: 421 SSSATSTSAAGAEKNLSYGFG 441

>Scas_608.5
          Length = 431

 Score =  438 bits (1127), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 199/323 (61%), Positives = 249/323 (77%)

Query: 22  DETTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTITIFD 81
           +  T C+    CPED PCC+Q G CGTG YCLG CNP FS+  ++CMPLP+C+D+ T FD
Sbjct: 21  NAVTICNATQSCPEDLPCCSQGGQCGTGQYCLGSCNPSFSFNIDSCMPLPICKDSSTKFD 80

Query: 82  NYTSKMANLYTYLGDASKANWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGNI 141
           NY+SK+ N YT+LG+ S A+W Y G  IDY DEN+LI+AMPKNSGGTVL+ST  +WYG I
Sbjct: 81  NYSSKILNEYTFLGNVSAADWLYSGNIIDYADENSLILAMPKNSGGTVLTSTRAVWYGKI 140

Query: 142 KTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTATN 201
             RMKASH  GV++A ILFS +QDEID+E+VGAD+EKVQTN+YWQG LNY +S N+T  +
Sbjct: 141 TARMKASHLGGVITAFILFSGIQDEIDFEFVGADIEKVQTNYYWQGTLNYNHSTNITVDD 200

Query: 202 NDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGN 261
             +DYH YE+DW ED ITWSVDG +GRTL+KNETYNST+  Y +PQTPS+V LS+WPGGN
Sbjct: 201 VFDDYHTYELDWHEDYITWSVDGTIGRTLYKNETYNSTTDTYRFPQTPSQVHLSIWPGGN 260

Query: 262 ATNEQGTINWAGGEIDWDSDDIKDYGYYYAVLESVNITCYDPPSGTTKNGSEVYQYSGED 321
           ATN  GTI WAGGEI+WD+ DI D GYYYA++  VNITCYDPP    KNG++ Y+Y+  D
Sbjct: 261 ATNAPGTIAWAGGEINWDAPDISDPGYYYAIVNEVNITCYDPPIFAKKNGTKAYKYTNSD 320

Query: 322 NWLQKGVFITDGNTILKDYDNSG 344
           N+L+K + ITD   +L   + +G
Sbjct: 321 NFLEKSIMITDDEVMLGSDEATG 343

>Kwal_27.10146
          Length = 469

 Score =  429 bits (1104), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 199/316 (62%), Positives = 251/316 (79%), Gaps = 1/316 (0%)

Query: 33  CPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTITIFDNYTSKMANLYT 92
           CPED PCC+QYGTCGTG  CLGGCNP +SY   ACMP+PVC+D+ TIF+NY+S++   Y+
Sbjct: 34  CPEDKPCCSQYGTCGTGLTCLGGCNPMYSYNLSACMPVPVCKDSKTIFNNYSSEVVPRYS 93

Query: 93  YLGDASKANWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAG 152
           YLGDA K +WTYEG   D  DE AL+MAMPK SGGTVLSST YMWYG +  RMK SH AG
Sbjct: 94  YLGDADKHDWTYEGSLADL-DEEALVMAMPKYSGGTVLSSTRYMWYGKVGARMKTSHRAG 152

Query: 153 VVSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTATNNDEDYHIYEID 212
           VV+A I+FSSV DE+D+E++GA+L   QTN+Y++GALN+TNSKN++ ++  E+YH+YE+D
Sbjct: 153 VVTAFIMFSSVMDEMDFEFIGANLTTAQTNYYFEGALNWTNSKNISTSDTYENYHLYEVD 212

Query: 213 WKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWA 272
           W ED I W VDGEVGRTL+KN+TYN+T+  Y +PQTP+R+QLS+WPGGNAT   GT  WA
Sbjct: 213 WHEDHIDWLVDGEVGRTLYKNKTYNATTGDYMFPQTPARIQLSIWPGGNATQPIGTRQWA 272

Query: 273 GGEIDWDSDDIKDYGYYYAVLESVNITCYDPPSGTTKNGSEVYQYSGEDNWLQKGVFITD 332
           GG+IDWD+DDI D GYYYA+LESVNITCYDPP+GT +NG+  Y+Y    N+ Q G+ IT+
Sbjct: 273 GGDIDWDADDIVDNGYYYALLESVNITCYDPPAGTMQNGTNAYRYINSKNFTQAGIAITN 332

Query: 333 GNTILKDYDNSGLDDN 348
             TIL   ++SG + N
Sbjct: 333 DTTILGSDEDSGFNAN 348

>CAGL0C02211g 225012..226457 similar to sp|P32623 Saccharomyces
           cerevisiae YEL040w UTR2 cell wall protein, hypothetical
           start
          Length = 481

 Score =  429 bits (1103), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 188/320 (58%), Positives = 253/320 (79%)

Query: 27  CSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTITIFDNYTSK 86
           C+  S CPE+ PCC+Q+G CGTG YC+  CNPKFS+  ++C+P+PVC+D+ T FD+Y+SK
Sbjct: 28  CNATSQCPEEFPCCSQFGQCGTGQYCINNCNPKFSFSIDSCVPMPVCKDSSTKFDDYSSK 87

Query: 87  MANLYTYLGDASKANWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMK 146
           + N  TYL +AS A+WTY GY +DY DE+++I+AMPKNSGG+VLS+T YMWYG +  R+K
Sbjct: 88  VLNADTYLNNASAADWTYSGYLVDYPDEDSMILAMPKNSGGSVLSTTRYMWYGKVSARLK 147

Query: 147 ASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTATNNDEDY 206
           +SH  GVVS+MILFS+VQDEID E++GADL  VQTN+YW+G LNYTNS N+T +N  E+Y
Sbjct: 148 SSHLGGVVSSMILFSNVQDEIDIEFIGADLNTVQTNFYWEGTLNYTNSANMTTSNTFENY 207

Query: 207 HIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQ 266
           H YEIDW ED ITWS+DG VGRTL+KN+TYN T+  YE+PQTPSR+Q+S+WPGGNAT+  
Sbjct: 208 HDYEIDWHEDYITWSIDGVVGRTLYKNQTYNETTGIYEFPQTPSRIQISIWPGGNATSAP 267

Query: 267 GTINWAGGEIDWDSDDIKDYGYYYAVLESVNITCYDPPSGTTKNGSEVYQYSGEDNWLQK 326
           GTI WAGG I+WD+ DI+D GYYY +++  NITCYDPP+   KNG++ Y Y+   ++ Q 
Sbjct: 268 GTIAWAGGAINWDAPDIQDPGYYYMMVQEANITCYDPPANVKKNGTKSYIYTSNKDFTQD 327

Query: 327 GVFITDGNTILKDYDNSGLD 346
            + I+D + +L++   +GL+
Sbjct: 328 SIMISDKDFVLENSAWTGLN 347

>YEL040W (UTR2) [1387] chr5 (78053..79456) Cell wall protein [1404
           bp, 467 aa]
          Length = 467

 Score =  408 bits (1049), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 245/325 (75%)

Query: 22  DETTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTITIFD 81
           +  T C+    CPED PCC+QYG CGTG YCL  C+ ++S+  ++CMP+P+C+ + T F 
Sbjct: 22  EAATFCNATQACPEDKPCCSQYGECGTGQYCLNNCDVRYSFSHDSCMPVPICKSSSTKFK 81

Query: 82  NYTSKMANLYTYLGDASKANWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGNI 141
           +Y+SK+ N  T+LG+ S+A+W Y G  +DY+DE +LI+AMPKNSGGTVLSST  +WYG +
Sbjct: 82  DYSSKLGNANTFLGNVSEADWLYTGDVLDYDDEESLILAMPKNSGGTVLSSTRAVWYGKV 141

Query: 142 KTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTATN 201
             R+K SH AGVV+  IL+S   DE+DYE+VGADLE  QTN+YW+  LNYTNS N++ T+
Sbjct: 142 SARIKTSHLAGVVTGFILYSGAGDELDYEFVGADLETAQTNFYWESVLNYTNSANISTTD 201

Query: 202 NDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGN 261
             E+YH YE+DW ED +TWS+DG VGRTL+KNETYN+T+++Y+YPQTPS+V +S+WPGGN
Sbjct: 202 TFENYHTYELDWHEDYVTWSIDGVVGRTLYKNETYNATTQKYQYPQTPSKVDISIWPGGN 261

Query: 262 ATNEQGTINWAGGEIDWDSDDIKDYGYYYAVLESVNITCYDPPSGTTKNGSEVYQYSGED 321
           +TN  GTI W+GGEI+WD+ DI + GYYYA++  VNITCYDPPS T KNG+  Y Y+   
Sbjct: 262 STNAPGTIAWSGGEINWDASDISNPGYYYAIVNEVNITCYDPPSDTKKNGTSAYVYTSSS 321

Query: 322 NWLQKGVFITDGNTILKDYDNSGLD 346
            +L K + ITD   ++   + SGLD
Sbjct: 322 EFLAKDIAITDDEVMMDSDEGSGLD 346

>KLLA0F04906g complement(482183..483673) some similarities with
           sgd|S0004203 Saccharomyces cerevisiae YLR213c CRR1,
           hypothetical start
          Length = 496

 Score =  241 bits (614), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 121/322 (37%), Positives = 188/322 (58%), Gaps = 47/322 (14%)

Query: 27  CSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMP----------------- 69
           CS +++CP + PCC+Q+G CGTG +C+GGCNP+ S+   +C+                  
Sbjct: 32  CSLENNCPAEWPCCSQFGQCGTGPFCVGGCNPRLSHDPGSCLGQPALLPRMSPSFWLQSS 91

Query: 70  -----------LPVCRDTITIFDNYTSK-------MANLYTYLGDASKA---------NW 102
                      LP  + ++ +  N   +       + N   +L    +          ++
Sbjct: 92  LEQKPALKSSFLPRVQPSMDVASNEGGEKDLNNRGIVNFANFLISPQERIIKKMLRDYHF 151

Query: 103 TYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSS 162
           TY G+ + Y+    L +AMPK++ G+++SST    YG    +MK + G GVV+A++L S+
Sbjct: 152 TYSGF-VKYDAPGQLTLAMPKHTSGSLISSTRSFLYGRATVKMKTARGRGVVTAVVLIST 210

Query: 163 VQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTATNND-EDYHIYEIDWKEDVITWS 221
           V DEID+E++G +L   Q+N+Y QG LN+T  + L  +++  E+ HIYE+DW +D I W 
Sbjct: 211 VGDEIDFEFIGGELHHAQSNYYHQGELNHTRMEKLELSSDSFENTHIYEVDWDQDRINWI 270

Query: 222 VDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDWD-S 280
           VDG V RTL+K +T+N   ++YEYPQTP R+Q+S+WPGG    + GTI WAGG IDW+ S
Sbjct: 271 VDGVVARTLYKEDTWNEEKQRYEYPQTPMRLQVSVWPGGREDADPGTIMWAGGLIDWENS 330

Query: 281 DDIKDYGYYYAVLESVNITCYD 302
            DI + G +YA +ES+ +T Y+
Sbjct: 331 PDILEKGQFYATVESIAVTPYE 352

>Kwal_56.24518
          Length = 475

 Score =  233 bits (594), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 121/325 (37%), Positives = 188/325 (57%), Gaps = 46/325 (14%)

Query: 22  DETTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVC-------- 73
           D    CS+D  CP++ PCC+QYG CG G  C+GGC+P+FS+   +C  +P          
Sbjct: 27  DPAIECSKDKSCPQEWPCCSQYGQCGKGPICVGGCDPRFSHSALSCAAIPALVPSLDSTY 86

Query: 74  ---RDTITIFD-----------------------NYTSKMAN---LYTYLGDA----SKA 100
              +D+  + D                       NY S +++   L+    D+    S+A
Sbjct: 87  QSLQDSEKLIDQLQVSPVVNTFFGAESIIPAAGFNYISTLSSKRLLHFSRSDSPTELSEA 146

Query: 101 NWTYEGYPIDYEDENA--LIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMI 158
           ++TY GY +++ED  +  LI+AMP  + G++LSS     YG  +  MK++ GAGVVSAM+
Sbjct: 147 DFTYSGY-LEFEDSPSSDLILAMPPGTTGSLLSSAKSFLYGKAEVTMKSARGAGVVSAMV 205

Query: 159 LFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTN-SKNLTATNNDEDYHIYEIDWKEDV 217
           L S+V+DE+D+E +G  L+  Q N+Y+QG L +T  +++    +   +YH Y  DW E+ 
Sbjct: 206 LMSAVKDEVDFELLGGSLDSAQANYYYQGELIHTRMTQSSVKPDTYSEYHTYAFDWNEER 265

Query: 218 ITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEID 277
           I W VDG V RT+++ +TY+  +  ++YPQTP R++L++WPGG   N  GT+ WAGG ID
Sbjct: 266 IKWLVDGAVVRTVYRADTYDPVTDTFKYPQTPMRLELAIWPGGLPANSPGTVMWAGGLID 325

Query: 278 WD-SDDIKDYGYYYAVLESVNITCY 301
           W+ S DI + G +   ++ V+IT Y
Sbjct: 326 WENSADILENGQFQLAVKHVSITPY 350

>Sklu_1954.1 YLR213C, Contig c1954 323-1855 reverse complement
          Length = 510

 Score =  229 bits (583), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 118/328 (35%), Positives = 181/328 (55%), Gaps = 52/328 (15%)

Query: 26  TCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLP-------------- 71
           +CS  S CP + PCC+QYG CG+G  C+GGCNPKFS+   +C+ +P              
Sbjct: 31  SCSATSKCPPEWPCCSQYGLCGSGPLCIGGCNPKFSFNVHSCVAMPALLPPVQASYGKQN 90

Query: 72  --------VCRDTITIFDNYTSK-------------------MANLYTYLGDASKA---- 100
                   +  D  T+  ++  +                   + +   YL    K+    
Sbjct: 91  KQTIQSVQILDDEPTLLTDFRPRDFSLMEGEKVTEADLNSRGLMHFSKYLITPDKSIGKQ 150

Query: 101 -----NWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVS 155
                 +TY GY       N +I+ MP  + G+++SST    YG     MK +   GV+S
Sbjct: 151 MLENYEFTYSGYMDLDSKSNDIILGMPNRTTGSLISSTRSFLYGKAAVTMKTARSRGVIS 210

Query: 156 AMILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTATNND-EDYHIYEIDWK 214
           A++LFS+V+DEID+E++G++L + QTN+Y QG L +T  +     ++   +YH YE+DW 
Sbjct: 211 AIMLFSAVRDEIDFEFLGSELTEAQTNYYHQGELVHTRMQRFPIPSDSFHNYHTYELDWN 270

Query: 215 EDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGG 274
           E+ I W +DG V RTLFK +T++   K ++YPQTP ++++SLWPGG   N+ GTI+WAGG
Sbjct: 271 EERIHWLIDGVVVRTLFKRDTWDPELKIFKYPQTPMKLEVSLWPGGMEGNDPGTISWAGG 330

Query: 275 EIDWD-SDDIKDYGYYYAVLESVNITCY 301
            IDW+ S DI +   +Y++++ V IT Y
Sbjct: 331 LIDWENSPDIIEKKQFYSMVKQVTITPY 358

>YLR213C (CRR1) [3614] chr12 complement(566656..567924) Sporulation
           specific protein with similarity to Crh1p cell wall
           protein [1269 bp, 422 aa]
          Length = 422

 Score =  218 bits (556), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 173/327 (52%), Gaps = 49/327 (14%)

Query: 24  TTTCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTITIFDNY 83
           + +CS ++ CP + PCC+ Y  CG G  C+GGCN + S+ +E+C P+P    +  +    
Sbjct: 28  SISCSPNNPCPAEWPCCSPYNECGAGPICVGGCNVRSSFDEESCAPIPALVASQKLEFVS 87

Query: 84  TSKMANL----------------------------------------YTYLGDASKA--- 100
           T K+                                           +    D+ +A   
Sbjct: 88  TPKVPKFIVNYQPKPPIREGNGPNKANTKVGVVEGELNSKRIIHYAKFLVTPDSKEAEKM 147

Query: 101 ----NWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSA 156
               ++T+ GY         +++AMPK + G++++ST    YG    RMK +   GVV+A
Sbjct: 148 LEDFDFTHSGYTSIEASSGNIVLAMPKKTTGSLITSTRSFLYGKASVRMKTARSRGVVTA 207

Query: 157 MILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTATNND-EDYHIYEIDWKE 215
             L S++ DEID+EW+G DL   Q+N+Y QG L+YT  +      +    YH YEIDW  
Sbjct: 208 FDLTSAIGDEIDFEWLGGDLMTAQSNYYSQGHLDYTRMQRFPVGADTWATYHTYEIDWDP 267

Query: 216 DVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGE 275
           D I W VDG++ RT+ K +T++  SK+Y YPQTP R+++++WPGG+ TN  GTINWAGG 
Sbjct: 268 DRIIWYVDGKIARTVLKKDTWDPISKEYRYPQTPMRLEIAVWPGGSETNGPGTINWAGGL 327

Query: 276 IDWD-SDDIKDYGYYYAVLESVNITCY 301
           IDW+ S DI + G + A +E + +T Y
Sbjct: 328 IDWENSPDIIEKGQFTAHVEQITVTPY 354

>Scas_674.15
          Length = 418

 Score =  212 bits (539), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 121/339 (35%), Positives = 174/339 (51%), Gaps = 55/339 (16%)

Query: 26  TCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTIT--IFDNY 83
            CS++SHCP D PCC+ YG CG+G  CLGGCNPK S++  AC PLP+     T   +D  
Sbjct: 31  ACSKESHCPPDWPCCSPYGDCGSGPVCLGGCNPKLSFEDTACAPLPILYSPATELRYDRS 90

Query: 84  TSKMANLYTYLGDASKANWTYEGYPIDYEDENALIMAMPKNSGGTV-------------- 129
               ++           ++  E  P ++E E      +  NS G +              
Sbjct: 91  IPPSSSKDEVFQQMINEHYPQEA-PSNFEKEILQNNKLHLNSRGIIHFTDYLMTDSVDKA 149

Query: 130 ---LSSTHYMWYGNI---------------------------------KTRMKASHGAGV 153
              LS   +++ G I                                   R++A+   GV
Sbjct: 150 KDMLSKYQFLYSGPINIDPQTNDIQLNMPKQSSGSLITSAKYFLYGKLHVRLRAARSIGV 209

Query: 154 VSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGALNYTN-SKNLTATNNDEDYHIYEID 212
           V+ ++L S V DEID+E++GA+L  VQTN+Y QG L +TN  K    TN    YH Y ID
Sbjct: 210 VTGLVLISQVGDEIDFEFLGAELNFVQTNYYSQGELIHTNMQKYHIPTNIWATYHTYSID 269

Query: 213 WKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWA 272
           W  D I W V+G++ RTLFK +T++  SK+++YP+TP R+++++WPGG ATN  GTI+WA
Sbjct: 270 WNPDRILWMVEGQIIRTLFKRDTWDPVSKRFKYPETPMRLEIAIWPGGAATNPPGTISWA 329

Query: 273 GGEIDWD-SDDIKDYGYYYAVLESVNITCYDPPSGTTKN 310
           GG I+WD + DI + G +   ++  NI  Y  P  T K 
Sbjct: 330 GGLINWDTAPDILEKGQFSVYVQHANIVPYINPKITEKQ 368

>CAGL0J08910g complement(877143..878627) similar to tr|Q05790
           Saccharomyces cerevisiae YLR213c CRR1, hypothetical
           start
          Length = 494

 Score =  212 bits (539), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 111/318 (34%), Positives = 178/318 (55%), Gaps = 46/318 (14%)

Query: 27  CS-EDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVC------------ 73
           CS  D  CP + PCC+ YG CG+G  C+GGCNP++S+++++C+P PV             
Sbjct: 34  CSIRDGSCPAEWPCCSPYGVCGSGPTCIGGCNPQYSFREDSCVPSPVLIPYNAIEFSTEG 93

Query: 74  RDTITIF-------DNYTSKMANL-----------------YTYLGDASKANWTYEGYPI 109
              I I        D +  K A +                 +    DA++AN     Y  
Sbjct: 94  TKLIRIASGNLQKGDAFLKKGARMKEREMELKRNKMIHFSDFLITEDATEANKMLMDYDF 153

Query: 110 DYE-------DENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSS 162
            Y          + + + MPK S G++++S     YG +   MK +   GV++A++L S+
Sbjct: 154 IYSGMTQMDPTTSEIQLTMPKRSTGSLVASVRSFLYGKVSVTMKTARSGGVITALVLMSA 213

Query: 163 VQDEIDYEWVGADLEKVQTNWYWQGALNYTNSKNLTATNND-EDYHIYEIDWKEDVITWS 221
           V DE+D+E+VG++L +VQTN Y+QG L++T  K     +N   +YH +EI W ED + W 
Sbjct: 214 VGDELDFEFVGSELNQVQTNHYYQGELDFTKMKKHEIKDNTWLNYHNFEIFWTEDKVDWV 273

Query: 222 VDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDWDS- 280
           +DG V RTL+K +T++  +K Y++P +P R+++++WPGG+  NE GTI WAGG +DWD+ 
Sbjct: 274 IDGVVVRTLYKKDTWDPNAKVYKFPDSPMRLEIAIWPGGSEKNEIGTIMWAGGLVDWDNP 333

Query: 281 DDIKDYGYYYAVLESVNI 298
            D+ + GY+ A ++ + I
Sbjct: 334 PDMLEKGYFSANVKVIRI 351

>ADR078C [1819] [Homologous to ScYLR213C (CRR1) - SH]
           (847158..848510) [1353 bp, 450 aa]
          Length = 450

 Score =  196 bits (499), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 130/189 (68%), Gaps = 2/189 (1%)

Query: 116 ALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGAD 175
           +LI+ MPK + G+++SS+    YG     MK S G GV++A++  SS QDEIDYE+VG++
Sbjct: 175 SLILGMPKKTTGSLISSSKVFLYGRAAVTMKTSRGPGVITAIVFMSSTQDEIDYEFVGSE 234

Query: 176 LEKVQTNWYWQGALNYTNSKNLT-ATNNDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNE 234
           L  VQTN+Y+QG LN++  +  +  +N+ E+YHIYE+DW  + I W VDGE+ RTL+K +
Sbjct: 235 LHTVQTNYYYQGELNHSRMRRHSLPSNSHEEYHIYEVDWDAERIHWMVDGEIVRTLYKRD 294

Query: 235 TYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDWD-SDDIKDYGYYYAVL 293
           T++   K Y+YPQTP  +Q+SLWP G     QGTI WAGG IDW+ + DIK +G   A +
Sbjct: 295 TWDPVHKIYKYPQTPMMLQISLWPAGTPDAPQGTIEWAGGLIDWENAPDIKAHGQLAAQI 354

Query: 294 ESVNITCYD 302
           + V IT Y+
Sbjct: 355 QRVAITPYN 363

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 39/54 (72%)

Query: 26 TCSEDSHCPEDNPCCNQYGTCGTGSYCLGGCNPKFSYKKEACMPLPVCRDTITI 79
           CSE SHCP++ PCC+QYG CG+G  C+ GCNPKFS+  E+C+P+P     + I
Sbjct: 30 ACSEASHCPKEWPCCSQYGQCGSGPLCISGCNPKFSHSPESCVPVPALLPQLEI 83

>AGR318C [4629] [Homologous to ScYGR189C (CRH1) - SH]
           (1325918..1327276) [1359 bp, 452 aa]
          Length = 452

 Score =  114 bits (285), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 89/159 (55%), Gaps = 8/159 (5%)

Query: 129 VLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGA 188
            + S  Y+ YG ++   KA+ G G+VS+  L S  +DEID EW+G D  + QTN++ +G 
Sbjct: 82  AIMSDFYLMYGKVEVTFKAAPGKGIVSSFYLQSDARDEIDLEWLGGDTAQFQTNFFCKGN 141

Query: 189 L-NYTNSKNLTATNNDEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQ 247
           +  YT       +   E++H Y IDWK D + + +DG+  R + KN+T         YPQ
Sbjct: 142 VTTYTRGAFHNVSRPQEEFHTYTIDWKMDELVFYLDGKPIRRV-KNDTSEG------YPQ 194

Query: 248 TPSRVQLSLWPGGNATNEQGTINWAGGEIDWDSDDIKDY 286
           +P R+ + +W GG+ TN  GT+ WAGG+ D+       Y
Sbjct: 195 SPMRLYMGVWAGGDPTNHPGTVEWAGGQTDYSKVPFTAY 233

>CAGL0G09449g 898735..900093 similar to sp|P53301 Saccharomyces
           cerevisiae YGR189c CRH1, hypothetical start
          Length = 452

 Score =  111 bits (277), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 115/221 (52%), Gaps = 25/221 (11%)

Query: 65  EACMPL-----PVCRDTITIF-DNYTSKMANLYTYLGDASKANWTYEGYPIDYEDENALI 118
           ++C PL     P  +   T F +N+TS+ +  +T   +  K  +T +G          L 
Sbjct: 21  DSCDPLKQTNCPADKALATSFSENFTSE-SKWFTAEDNPGKIEYTSDG----------LA 69

Query: 119 MAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEK 178
           M++ K      L S  Y+ YG  +   KA  G G+VS+  L S   DEID EW+G+D  +
Sbjct: 70  MSLTKRFDNPSLKSNFYIMYGKTEVIFKAGDGRGIVSSFFLQSDDLDEIDLEWIGSDDTQ 129

Query: 179 VQTNWYWQGALNYTNSKNLTATNN-DEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYN 237
            Q+N++ +G     +       N   +++H Y IDW  + +TW +DG+V R L      N
Sbjct: 130 FQSNYFSKGNTATYDRGEFHGVNQPQKEFHNYTIDWTMEQLTWYLDGQVVRVL-----PN 184

Query: 238 STSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDW 278
           +TS+   YPQTP  +++ +W GG+ +N  GTI WAGGE D+
Sbjct: 185 TTSQ--GYPQTPMYIKMGIWAGGDPSNAPGTIEWAGGETDY 223

>Scas_441.2
          Length = 425

 Score =  104 bits (259), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 91/171 (53%), Gaps = 9/171 (5%)

Query: 109 IDYEDENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEID 168
           I Y D+  + + + K      L S  Y+ YG ++  +KA  G G++S+  L S   DEID
Sbjct: 66  ITYSDD-GVALTLAKRFDNPALKSDFYIMYGKLEVILKAGSGTGIISSFYLQSDDLDEID 124

Query: 169 YEWVGADLEKVQTNWYWQGAL-NYTNSKNLTATNNDEDYHIYEIDWKEDVITWSVDGEVG 227
            EWVG D  + Q+N++ +G +  Y   +     +   +YH Y +DW  D  TW +DG+  
Sbjct: 125 IEWVGGDTTQFQSNYFSKGNVTTYDRGEFHIVESPQTEYHNYTLDWAMDKTTWYLDGQAV 184

Query: 228 RTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDW 278
           R L      N+TS+   YPQ+P  + + +W GG+  N  GTI WAGG  D+
Sbjct: 185 RVL-----PNTTSEG--YPQSPMYIMMGIWAGGDPDNAAGTIEWAGGLTDY 228

>YGR189C (CRH1) [2140] chr7 complement(876672..878195) Cell wall
           protein [1524 bp, 507 aa]
          Length = 507

 Score =  104 bits (259), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 94/188 (50%), Gaps = 14/188 (7%)

Query: 115 NALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGA 174
           + L M + K      L S  Y+ YG ++  +KA++G G+VS+  L S   DEID EWVG 
Sbjct: 83  DGLSMTLAKRYDNPSLKSNFYIMYGKLEVILKAANGTGIVSSFYLQSDDLDEIDIEWVGG 142

Query: 175 DLEKVQTNWYWQGALNYTNSKNLTATNNDED-YHIYEIDWKEDVITWSVDGEVGRTLFKN 233
           D  + Q+N++ +G     +       +   D +H Y +DW  D  TW +DGE  R L   
Sbjct: 143 DNTQFQSNFFSKGDTTTYDRGEFHGVDTPTDKFHNYTLDWAMDKTTWYLDGESVRVL--- 199

Query: 234 ETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDWDSDDIKDYGYYYAVL 293
               S +    YPQ+P  + + +W GG+  N  GTI WAGGE +++      Y      +
Sbjct: 200 ----SNTSSEGYPQSPMYLMMGIWAGGDPDNAAGTIEWAGGETNYNDAPFTMY------I 249

Query: 294 ESVNITCY 301
           E V +T Y
Sbjct: 250 EKVIVTDY 257

>Sklu_2390.2 YGR189C, Contig c2390 9663-11099
          Length = 478

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 85/150 (56%), Gaps = 8/150 (5%)

Query: 130 LSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGADLEKVQTNWYWQGAL 189
           L S  Y+ YG ++  +KA++G GVV++  L S   DEID EW+G D  + Q+N++ +G +
Sbjct: 91  LKSDFYIMYGKVEVILKAANGTGVVTSFYLQSDDLDEIDLEWLGGDTTEFQSNFFSKGNV 150

Query: 190 NYTNSKNLTATNNDE-DYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQT 248
              +          + D+H Y IDW  D   W +DG+  RTL      N+TS+   YPQ+
Sbjct: 151 ETYDRGAFHGVYQPQIDFHNYTIDWGMDKTVWYLDGQPVRTL-----ENTTSEG--YPQS 203

Query: 249 PSRVQLSLWPGGNATNEQGTINWAGGEIDW 278
           P  V +  W GG+ +NE GTI WAGG  D+
Sbjct: 204 PMYVMMGTWAGGDPSNEPGTIEWAGGLTDY 233

>KLLA0F22671g complement(2115530..2116930) some similarities with
           sp|P53301 Saccharomyces cerevisiae YGR189c CRH1 family
           of putative glycosidases might exert a common role in
           cell wall organization, hypothetical start
          Length = 466

 Score =  101 bits (251), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 107/226 (47%), Gaps = 26/226 (11%)

Query: 55  GCNPKFSYKKEACMPLPVCRDTITI-FDNYTSKMANLYTYLGDASKANWTYEGYPIDYED 113
            CNP        C P P    +I++ FD  +S           A+  N +Y         
Sbjct: 23  ACNP---LTASTCSPDPALGKSISVPFDEESSYFERY------ATNGNVSY--------G 65

Query: 114 ENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVG 173
           ++ + M + K      L S  Y+ +G ++   KA+ G G++S+  L S   DEID EW G
Sbjct: 66  DDGVEMTINKRLDNPSLVSEFYIMFGKVQAIAKAAGGQGIISSFYLQSDDLDEIDIEWTG 125

Query: 174 ADLEKVQTNWYWQGALNYTNSKNLTATNNDE-DYHIYEIDWKEDVITWSVDGEVGRTLFK 232
            D  +VQ+N++ +G     +     + ++ +  YH Y IDW +D I   VD  + RT+  
Sbjct: 126 TDTTQVQSNFFSKGETTTFDRGAFHSVDDPQGSYHNYTIDWTKDEINIYVDSALVRTI-- 183

Query: 233 NETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDW 278
                ++     YP++P R+   +W GG++ NE GTI WAGG  D+
Sbjct: 184 -----TSDNGQGYPESPMRIFTGIWAGGDSQNEPGTIEWAGGLTDY 224

>Scas_507.2
          Length = 431

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 87/165 (52%), Gaps = 8/165 (4%)

Query: 115 NALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGA 174
           + L + + K      L ST Y+ YG ++   +A+ G G++S++ L S   DEID EW G 
Sbjct: 67  DGLTLTLEKRLDNPSLHSTFYIMYGKVEAIAQAAPGQGMISSVFLQSDDLDEIDIEWTGG 126

Query: 175 DLEKVQTNWYWQGALNYTNSKNLTATNNDE-DYHIYEIDWKEDVITWSVDGEVGRTLFKN 233
           D  +VQ+N++ +G     +       ++ +  YH Y +DW +D +TW +DG   R L  +
Sbjct: 127 DTTQVQSNYFSKGQTTTYDRGEFHPVDSPQTTYHNYTVDWTKDAVTWYIDGVSVRVLPSD 186

Query: 234 ETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDW 278
                      +P++P  + + +W GG++ N  GTI WAGG  D+
Sbjct: 187 APEG-------FPESPMALNIGIWAGGDSGNAPGTIEWAGGLTDY 224

>Kwal_33.15393
          Length = 459

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 83/165 (50%), Gaps = 8/165 (4%)

Query: 115 NALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEWVGA 174
           + + M + K     +L S  Y+ +G ++   KA+ G G++S+  L S   DEID EW G 
Sbjct: 69  DGMKMTINKRFDNPILKSDFYLMFGKVEVEFKAAAGQGIISSFYLQSDDLDEIDLEWTGG 128

Query: 175 DLEKVQTNWYWQGALNYTNSKNLTAT-NNDEDYHIYEIDWKEDVITWSVDGEVGRTLFKN 233
           D  + QTN++ +G     +           E +H Y IDW ++   + +DG + R+L  +
Sbjct: 129 DTTEFQTNYFSKGNTTTWDRGAFHGVYTPQEKFHTYTIDWTKEKTDFLLDGALVRSLASD 188

Query: 234 ETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTINWAGGEIDW 278
            +         YPQ+P  + +  W GG+  N+ GTI WAGG  D+
Sbjct: 189 ASGG-------YPQSPMYLIMGCWAGGDPDNQPGTIEWAGGLTDY 226

>Scas_720.27
          Length = 388

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 81/191 (42%), Gaps = 22/191 (11%)

Query: 96  DASKANWTYEGYPIDYEDENALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVS 155
           DAS +N T  G        + L + + +   GT L S  Y+ YG I+  MKA +   + S
Sbjct: 44  DASDSNTTMCG-------SDGLTLTIAERGDGTNLLSNFYILYGRIEAIMKAGNAKSISS 96

Query: 156 AMILFSS-------VQDEIDYEWVGADLEKVQTNWYWQGALNYTNS-KNLTATNNDEDYH 207
            +   +S         D     W   + ++ +T     G+ N T+  +     +   +YH
Sbjct: 97  EISFLASGTRRDGTEADLFTLGWDDGEGDEFETFSTSGGSGNSTDQWETHDVKSPQTEYH 156

Query: 208 IYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQG 267
            Y IDW +D +T+ VDG V R +        ++   E+P  P R+ ++    GN      
Sbjct: 157 NYTIDWTKDKLTFYVDGRVLRVV-------PSTDSAEFPNFPVRIAITHSDDGNPDYGTE 209

Query: 268 TINWAGGEIDW 278
             +  GGE D+
Sbjct: 210 YTDKHGGETDY 220

>Scas_647.22
          Length = 386

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 82/173 (47%), Gaps = 18/173 (10%)

Query: 117 LIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFS---SVQDEIDYEWVG 173
           L + + ++   T L S  Y+ YG I+  MKA +   + S +   S   S++D +      
Sbjct: 61  LTLTIAESGDSTTLWSNFYILYGRIEAIMKAGNARSISSEIAFESGAGSLRDGMRRSLFA 120

Query: 174 ADLEKVQTNWYWQGALNYTNSKNLTA-------TNNDEDYHIYEIDWKEDVITWSVDGEV 226
            D +  + + ++  + +  + +N TA        +   +YH Y IDW ++ +T+ VDG+ 
Sbjct: 121 IDWDDDEGDGFYTFSTSLNSHRNSTAQWEAHYVKSPQTEYHNYTIDWTKEKLTFYVDGQE 180

Query: 227 GRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATN-EQGTINWAGGEIDW 278
            R +        ++   ++P +P+R  ++    G+  N ++  ++  GGE D+
Sbjct: 181 VRVV-------PSTAIADFPNSPARFYITHTDDGDLENSDEEYVDMHGGETDY 226

>Scas_630.3
          Length = 387

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 103/230 (44%), Gaps = 37/230 (16%)

Query: 78  TIFDNYTSKMANLYTYLGDASKA-------NWTYEGYPIDYEDE----------NALIMA 120
           TIF    +  + +   + D +KA       N+  E    D+++E          + L + 
Sbjct: 5   TIFSALLTSASLVLANVADKNKALAATIDENFHVENSLWDFDEESDNNATMCGSDGLTLT 64

Query: 121 MPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSSVQDEIDYEW----VGADL 176
           + ++   T LSS  Y++YG I+  +KA + A  +S+ I F S    ++ +W       D 
Sbjct: 65  IAESGDSTDLSSDFYIFYGRIEAFVKAGN-ARSISSEIAFVSGSGAMNDDWRRTLFAIDW 123

Query: 177 EKVQTNWYWQGALNYTNSKNLTA-------TNNDEDYHIYEIDWKEDVITWSVDGEVGRT 229
           +  + + ++  +    + KN TA        +   +YH Y IDW ++ +T+ VDG V R 
Sbjct: 124 DDGEGDEFYTFSTAMNSHKNSTAQWETHYVKSPQTEYHNYTIDWTKEKLTFYVDGRVVRV 183

Query: 230 LFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGTI-NWAGGEIDW 278
           +        ++   ++P +P+R  +     G+  N+   I +  GG+ D+
Sbjct: 184 V-------PSTATADFPNSPARFFIMHSDEGDLENDDTEIVDRYGGQTDY 226

>Scas_647.19d
          Length = 387

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 90/206 (43%), Gaps = 41/206 (19%)

Query: 97  ASKANWTYEGYPIDYEDENA-------LIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASH 149
           A  + W +E    D  D+NA       L M + ++     LSS  Y+ YG I+  +KA +
Sbjct: 38  AKNSLWYFE----DESDDNAMTYGSDGLTMTISESGNTRDLSSKFYILYGRIEAIVKAGN 93

Query: 150 GAGVVSAMILFSSVQDEIDYEWVGADLEKVQTNWYW---QGALNYTNSKNLTATNN---- 202
              + SA+  FS   D    +  G  L  +     W   +G   YT S ++ + NN    
Sbjct: 94  ARSISSAINFFS--PDGTKDDGSGQGLFAID----WDDGEGDEFYTFSTSVNSHNNSTAQ 147

Query: 203 ---------DEDYHIYEIDWKEDVITWSVDGEVGRTLFKNETYNSTSKQYEYPQTPSRVQ 253
                      +YH Y IDW ++ +T+ VDG+  R +        ++   ++P +P+R  
Sbjct: 148 WEAHYVKSPQTEYHNYTIDWTKEKLTFYVDGQEVRVV-------PSTATADFPNSPARFF 200

Query: 254 LSLWPGGNATNEQGTI-NWAGGEIDW 278
           ++    G+  N+   I +  GG+ D+
Sbjct: 201 ITHSDQGDLENDDTEIVDMYGGQTDY 226

>Scas_721.134
          Length = 384

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 81/175 (46%), Gaps = 18/175 (10%)

Query: 115 NALIMAMPKNSGGTVLSSTHYMWYGNIKTRMKASHGAGVVSAMILFSS---VQDEIDYEW 171
           + L + + ++   T L S  Y+ YG I+  +KA +   + S++  FS+   ++D      
Sbjct: 56  DGLTLTIAESGDSTDLFSEFYILYGRIEAIVKAGNARSISSSIQFFSAPGTIRDGTSQGL 115

Query: 172 VGADLEKVQTNWYWQGALNYTNSKNLT-------ATNNDEDYHIYEIDWKEDVITWSVDG 224
              D +  + + ++  +    ++KN++         +   +YH Y IDW ++ +T+ VDG
Sbjct: 116 FAIDWDDGEGDEFYTFSTAMNSNKNISTQWETHYVKSPQTEYHNYTIDWTKEKLTFYVDG 175

Query: 225 EVGRTLFKNETYNSTSKQYEYPQTPSRVQLSLWPGGNATNEQGT-INWAGGEIDW 278
            V R +        ++   ++P +P +  ++    G+  N     I+  GGE D+
Sbjct: 176 RVVRVV-------PSTATADFPNSPVKFFITHSDDGDPENASAEYIDMHGGETDY 223

>KLLA0E23958g complement(2124622..2130870) some similarities with
           sp|P48415 Saccharomyces cerevisiae YPL085w SEC16
           multidomain vesicle coat protein singleton, hypothetical
           start
          Length = 2082

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 202 NDEDYHIYEIDWKEDVIT---WSVDGEVGRTLFKNETYNSTSKQYEYP 246
           ND+      + W++ +I     S+  EVGR L + E+ N   +Q ++P
Sbjct: 182 NDDTVQTEGLPWQDQIIAEELPSISAEVGRELPQQESINDYDQQEQFP 229

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.132    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,017,036
Number of extensions: 634729
Number of successful extensions: 1212
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1179
Number of HSP's successfully gapped: 39
Length of query: 445
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 340
Effective length of database: 12,961,219
Effective search space: 4406814460
Effective search space used: 4406814460
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)