Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F16038g86284943120.0
ACR085C95493512821e-162
ADL082C5691121241e-06
KLLA0F27511g6231121071e-04
CAGL0L00781g6731051062e-04
Scas_704.406081051043e-04
YIL046W (MET30)6401121034e-04
Scas_692.25488306950.003
Kwal_23.535147459930.006
Kwal_23.5769627112930.006
Kwal_56.236851102104930.006
KLLA0D07546g647122920.008
Scas_558.3725152890.021
Kwal_26.7570218119840.036
Scas_693.221145109850.055
Kwal_23.6429750137850.059
Kwal_27.11585823228840.072
YCR084C (TUP1)713121840.075
AFL014C557139840.076
YDR128W1148109820.12
CAGL0E00561g836149820.12
Scas_713.50983236820.14
Scas_630.6621166810.15
YPL139C (UME1)460100800.17
Scas_707.22730121810.18
YBR103W (SIF2)53562790.25
Scas_631.1747463780.32
CAGL0J04818g65474780.32
KLLA0D16390g936207780.36
Scas_719.5262871770.44
AGL196C935235770.45
AFR199C334119750.62
CAGL0C02937g46787760.64
CAGL0C03608g643168760.64
YLR129W (DIP2)94392760.66
Sklu_1963.231435750.71
CAGL0F07337g621115760.72
YLR429W (CRN1)65179760.72
KLLA0E23529g82658750.77
AGL024W75664750.85
AEL246C81558741.1
CAGL0B02013g112075741.1
Sklu_2315.814764701.2
KLLA0E12287g32689731.3
KLLA0F10263g682117731.4
Scas_629.12671119731.4
Sklu_1645.258764731.4
AGR207C32037721.5
KLLA0E24508g32735721.7
ADL322C50190721.8
Scas_512.353438721.8
Kwal_27.1223931635711.9
Scas_718.6*54663722.1
Kwal_56.23920937176722.2
Kwal_23.5035744133712.2
Kwal_27.1266772138703.0
Scas_571.460170685.0
AGR067W112586686.1
CAGL0M09845g93699686.6
CAGL0K00275g715195677.0
KLLA0C08547g51537668.2
Scas_620.757663668.9
CAGL0K00957g793113669.1
YOR229W (WTM2)46781669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F16038g
         (849 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...  1665   0.0  
ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...   498   e-162
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    52   1e-06
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    46   1e-04
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    45   2e-04
Scas_704.40                                                            45   3e-04
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    44   4e-04
Scas_692.25                                                            41   0.003
Kwal_23.5351                                                           40   0.006
Kwal_23.5769                                                           40   0.006
Kwal_56.23685                                                          40   0.006
KLLA0D07546g complement(647984..649927) some similarities with s...    40   0.008
Scas_558.3                                                             39   0.021
Kwal_26.7570                                                           37   0.036
Scas_693.22                                                            37   0.055
Kwal_23.6429                                                           37   0.059
Kwal_27.11585                                                          37   0.072
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    37   0.075
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    37   0.076
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    36   0.12 
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    36   0.12 
Scas_713.50                                                            36   0.14 
Scas_630.6                                                             36   0.15 
YPL139C (UME1) [5307] chr16 complement(289668..291050) Negative ...    35   0.17 
Scas_707.22                                                            36   0.18 
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    35   0.25 
Scas_631.17                                                            35   0.32 
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    35   0.32 
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    35   0.36 
Scas_719.52                                                            34   0.44 
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    34   0.45 
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    33   0.62 
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    34   0.64 
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    34   0.64 
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    34   0.66 
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         33   0.71 
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    34   0.72 
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    34   0.72 
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    33   0.77 
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    33   0.85 
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    33   1.1  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    33   1.1  
Sklu_2315.8 YPL071C, Contig c2315 13843-14286                          32   1.2  
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    33   1.3  
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    33   1.4  
Scas_629.12                                                            33   1.4  
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          33   1.4  
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    32   1.5  
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    32   1.7  
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    32   1.8  
Scas_512.3                                                             32   1.8  
Kwal_27.12239                                                          32   1.9  
Scas_718.6*                                                            32   2.1  
Kwal_56.23920                                                          32   2.2  
Kwal_23.5035                                                           32   2.2  
Kwal_27.12667                                                          32   3.0  
Scas_571.4                                                             31   5.0  
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    31   6.1  
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    31   6.6  
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    30   7.0  
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    30   8.2  
Scas_620.7                                                             30   8.9  
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    30   9.1  
YOR229W (WTM2) [5020] chr15 (768409..769812) Transcriptional mod...    30   9.7  

>KLLA0F16038g complement(1487475..1490063) weakly similar to
           ca|CA1657|IPF16022 Candida albicans unknown function,
           hypothetical start
          Length = 862

 Score = 1665 bits (4312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 816/849 (96%), Positives = 816/849 (96%)

Query: 1   MREPLDNLKISRIFGSSSNSRTCFSAAKDLIAYAASGGVVVAQLDFDTQQIIKQRFFCAS 60
           MREPLDNLKISRIFGSSSNSRTCFSAAKDLIAYAASGGVVVAQLDFDTQQIIKQRFFCAS
Sbjct: 1   MREPLDNLKISRIFGSSSNSRTCFSAAKDLIAYAASGGVVVAQLDFDTQQIIKQRFFCAS 60

Query: 61  SKSLRQESHSPTNIAKDYYGLIKPEHSISIKGDTWNDSDEASEKAVTIGSDLSPARCSPS 120
           SKSLRQESHSPTNIAKDYYGLIKPEHSISIKGDTWNDSDEASEKAVTIGSDLSPARCSPS
Sbjct: 61  SKSLRQESHSPTNIAKDYYGLIKPEHSISIKGDTWNDSDEASEKAVTIGSDLSPARCSPS 120

Query: 121 KIKDRIKDISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQ 180
           KIKDRIKDISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQ
Sbjct: 121 KIKDRIKDISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQ 180

Query: 181 FHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSALVTYGVRQ 240
           FHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSALVTYGVRQ
Sbjct: 181 FHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSALVTYGVRQ 240

Query: 241 IKVWKFENTNNTANNKLTIPRTRTAIKGKNIVLGTLIESTFIDSEWLRDDQLLFLTDSRQ 300
           IKVWKFENTNNTANNKLTIPRTRTAIKGKNIVLGTLIESTFIDSEWLRDDQLLFLTDSRQ
Sbjct: 241 IKVWKFENTNNTANNKLTIPRTRTAIKGKNIVLGTLIESTFIDSEWLRDDQLLFLTDSRQ 300

Query: 301 VVLYQNGSLISLYELEGDKQYDNILVDWDNDKLWFSYDEYVDSIPLTHVLNHQERLRPGS 360
           VVLYQNGSLISLYELEGDKQYDNILVDWDNDKLWFSYDEYVDSIPLTHVLNHQERLRPGS
Sbjct: 301 VVLYQNGSLISLYELEGDKQYDNILVDWDNDKLWFSYDEYVDSIPLTHVLNHQERLRPGS 360

Query: 361 GSSSIRGASPIKNNLFDQKFVDTEASVRDTHKILMMKLVTNKTVLFCTSKGEISIINETI 420
           GSSSIRGASPIKNNLFDQKFVDTEASVRDTHKILMMKLVTNKTVLFCTSKGEISIINETI
Sbjct: 361 GSSSIRGASPIKNNLFDQKFVDTEASVRDTHKILMMKLVTNKTVLFCTSKGEISIINETI 420

Query: 421 KPISNPSLNDIKVFKKINNDLAVLCSKKGDIKLFDGTKLSKYELDISDLSSDEEITSLDF 480
           KPISNPSLNDIKVFKKINNDLAVLCSKKGDIKLFDGTKLSKYELDISDLSSDEEITSLDF
Sbjct: 421 KPISNPSLNDIKVFKKINNDLAVLCSKKGDIKLFDGTKLSKYELDISDLSSDEEITSLDF 480

Query: 481 SVNENYFVVGDSTGKLSVYKDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNF 540
           SVNENYFVVGDSTGKLSVYKDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNF
Sbjct: 481 SVNENYFVVGDSTGKLSVYKDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNF 540

Query: 541 IELRAGEWNICETVKDNKGNIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETIL 600
           IELRAGEWNICETVKDNKGNIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETIL
Sbjct: 541 IELRAGEWNICETVKDNKGNIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETIL 600

Query: 601 SVKNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADS 660
           SVKNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTP        QGDGILVNHFYVNADS
Sbjct: 601 SVKNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADS 660

Query: 661 DQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEIRP 720
           DQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEIRP
Sbjct: 661 DQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEIRP 720

Query: 721 EEEADEIXXXXXXXXXXXXXKNTNTIVSAPSTPVRNPKPFSPVRLQHPTPASSPLKKESP 780
           EEEADEI             KNTNTIVSAPSTPVRNPKPFSPVRLQHPTPASSPLKKESP
Sbjct: 721 EEEADEISGKLLDLSSSYSSKNTNTIVSAPSTPVRNPKPFSPVRLQHPTPASSPLKKESP 780

Query: 781 LTTKKRGIIPSNQLKSNLNKPQDXXXXXXXXXXXXVNEEQIDNIDEIRKEVSLIHNLIEP 840
           LTTKKRGIIPSNQLKSNLNKPQD            VNEEQIDNIDEIRKEVSLIHNLIEP
Sbjct: 781 LTTKKRGIIPSNQLKSNLNKPQDILSSLRQLRISLVNEEQIDNIDEIRKEVSLIHNLIEP 840

Query: 841 HEHILQKFG 849
           HEHILQKFG
Sbjct: 841 HEHILQKFG 849

>ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, 954
           aa]
          Length = 954

 Score =  498 bits (1282), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 309/935 (33%), Positives = 507/935 (54%), Gaps = 95/935 (10%)

Query: 5   LDNLKISRIFGSSSNSRTCFSAAKDLIAYAASGGVVV----------------------- 41
            +NL I +IFG+S+NS++CF      +AY ASGGVVV                       
Sbjct: 9   FENLDIEKIFGTSTNSKSCFCHVGSKVAYVASGGVVVSDIRMQDGPPSAGSSMDSLEGVE 68

Query: 42  -------AQLDFDTQQIIKQRFFCASSKSLRQESHSPTNIAKDYYGLIKPEHSISIKGDT 94
                  A+    T +I  QRFFCA S    +ES    N+AKD YGL K + SI +K  +
Sbjct: 69  KLGGAEDAEASRPTVKICSQRFFCAYSAVQHEESAQSANVAKDLYGLCKQDQSILVKTGS 128

Query: 95  WNDSDEASEKAVTIGSDLSPARCSPSKIKDRIKDISCLCFSADAKFLIVGETGHQPRILL 154
           W+++D   + + +  SDL+PAR SPSK+K+RIK ISCL  S D +++IVGE GH+PRIL+
Sbjct: 129 WHENDNPDKVSFSSSSDLTPARLSPSKVKNRIKTISCLNLSQDGRYMIVGELGHKPRILV 188

Query: 155 YSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVA 214
           YS+APDSNDFPVFVI QHS+G++ L+FHP DS +F SLG INDGFLH+W+L++ ++ L+ 
Sbjct: 189 YSLAPDSNDFPVFVIQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNVVLLG 248

Query: 215 SNKNSTIVLGLNWYKDSALVTYGVRQIKVWKFENTNNTAN-NKLTIPRTRTAIKGKNIVL 273
           +NKN + V  + W  +S  +TYGVR +K W+ +      +  K+   RTRT+IKGKNIVL
Sbjct: 249 TNKNISSVTDVLWC-NSKFITYGVRHLKEWRIDYPAPAGSTGKIQPARTRTSIKGKNIVL 307

Query: 274 GTLIESTFIDSEWLRDDQLLFLTDSRQVVLYQNGSLISLYELEG--DKQYDNILVDWDND 331
              I +TFID+  L  +++L LTD   +V Y+NG+L S++ LE   D Q  +IL D DND
Sbjct: 308 REFINATFIDATQLDQNRVLLLTDKNIMVSYENGTLSSVHNLETCLDGQVTSILADADND 367

Query: 332 KLWFSYDEYVDSIPLTHVLNHQERLRPGSGSSSIRGASPIKNN---LFDQKFVDTEASV- 387
            LW   D  + ++ L ++L + ERL+    + + RGA    NN   + +  F++++ +  
Sbjct: 368 TLWTIADGKIHAVSLEYILGNHERLKVAEAALAPRGAPRHPNNSNVIKNCSFLNSQLAPL 427

Query: 388 -----RDTHKILMMKLVTNKTVLFCTSKGEIS---IINETIKPISNPSLNDIKVFKKINN 439
                 +   I+ ++  +   +L+ T++G +    I N+   P+  P LN+I  +KKI  
Sbjct: 428 LHIAENNLKGIITVRKFSKSHLLYVTTQGCLGFYDIANQCSYPMVYPVLNNIAGYKKIYT 487

Query: 440 DLAVLCSKKGDIKLFD--GTKLSKYELDIS-----DLSSDEEITSLDFSVNENYFV---V 489
              +L S++G  K  D  G ++S+ +L +       L S+  I + +  +N    V   V
Sbjct: 488 SETLLWSREGRFKKLDEHGEQISELDLSLEPDLPYPLGSESSIGAAEMFLNTAGTVSLAV 547

Query: 490 GDSTGKLSVYKDNVCEYQ----SKVHSAAINGI---QIYEKDAFKIVITISRDRTMNFIE 542
           G   G L +Y+ +  + +    +K H++ IN I   Q   K    ++++I RDR +    
Sbjct: 548 GTGNGDLLIYEYSNSKTKKVLDTKAHTSKINDIVCLQTGTKTKVDVLVSIGRDRIVQVFL 607

Query: 543 LRAGEWNICETVKDNKGNIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETILSV 602
                W + +T+ DNKGN+I++   DN +Y  S+DR+++ YR +  D+ L + KE ILS+
Sbjct: 608 RTEERWELQQTLSDNKGNVIKMIHDDNVVYVASADRSITKYRFEYTDDDLLIYKEKILSI 667

Query: 603 KNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYV---NAD 659
           K++P+ + L +   ++S +DK + I+DK    +           D +++++ Y+   N  
Sbjct: 668 KSAPINIHLFDDRFLISTNDKQLLIYDKALEKSRYLKLLSDTD-DPVIIDNLYLNLRNCK 726

Query: 660 SDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVAN-KFVTVTGNGCLFSWEI 718
            ++I+CSS+ DK +RC+++TTGK + QY+ H++PVVG+    + K ++++ NGC+FSW  
Sbjct: 727 QEEIMCSSA-DKVLRCYNFTTGKLMKQYFGHSEPVVGLVPARDGKLLSISSNGCIFSWAP 785

Query: 719 RPEEEADEIXXXXXXXXXXXXXKNTNTIVSAPSTPVRNPKP-----------FSPVRLQH 767
           + ++  ++                  ++   P +  R  +P            SPV+L +
Sbjct: 786 QSDQLLEQRQFFIPLTGISVNSTLRESLDEQPVS-ARAARPETIAPRTQYTTVSPVKLPY 844

Query: 768 PTPASSPLKKESP---LTTKKRGIIPS------NQLKS-----NLNKPQDXXXXXXXXXX 813
             P S      SP   ++ ++ G+  S      + ++S     +L++P            
Sbjct: 845 KCPDSRADSACSPRFRMSNQRYGLSSSKSGNYCSSMRSCIGDEDLHQPTLLLQLKLFRDY 904

Query: 814 XXVNEEQIDNIDEIRKEVSLIHNLIEPHEHILQKF 848
               +      D I  E+ LI ++IEP   +L+K+
Sbjct: 905 LSSEDVPGPEHDAIIHEIKLISSIIEPQNKLLEKY 939

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 8/112 (7%)

Query: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCS 666
           L LQLTN  ++    D T+ I+D    +T           DG+    F      DQ L +
Sbjct: 263 LSLQLTNKLLLTGSYDSTVAIWDL---ATGKLIRRLSGHTDGVKALRF-----DDQKLIT 314

Query: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEI 718
            SLDKTIR ++Y TG C++ Y  H D V+ + +     V+ + +  +  W +
Sbjct: 315 GSLDKTIRVWNYVTGACVSTYRGHQDSVLSVDSFRKLIVSGSADKTVKVWHV 366

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGN 710
           L S SLD TI+ ++  TG C+   + H + V  +   A+ F  V+G+
Sbjct: 472 LLSCSLDNTIKLWNVKTGACIRTQFGHVEGVWDIA--ADNFRIVSGS 516

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 8/112 (7%)

Query: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCS 666
           L L+  +  +     D T+ I+D  S +            DG+   +F      DQ + +
Sbjct: 316 LSLKFNHRLLFTGSYDSTVAIWDTKSGNL---IRRLTGHTDGVKGIYF-----DDQKMIT 367

Query: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEI 718
           +SLDKTIR ++Y TG C++ Y  H D V+ + +     V+ + +  +  W +
Sbjct: 368 ASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKKIIVSASADKTVKVWHV 419

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 46/223 (20%), Positives = 94/223 (42%), Gaps = 26/223 (11%)

Query: 491 DSTGKLSVYKDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNFIELRAGEWNI 550
           D T ++  Y    C    + H  ++  +  Y+K    I+++ S D+T+    + +     
Sbjct: 371 DKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK----IIVSASADKTVKVWHVES---RT 423

Query: 551 CETVKDNKG--NIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETILSVKNS-PL 607
           C T++ +    N ++L       Y+ S D+T+  + I   ++ + V +  +  V+   PL
Sbjct: 424 CYTLRGHTEWVNCVKLHPKSFTCYSSSDDKTLRMWDIR-TNSCIKVFRGHVGQVQKVIPL 482

Query: 608 RLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCSS 667
            ++ T + ++  + +K            P           GI    F  N      L S 
Sbjct: 483 TIKDTENLVVDEKIEKV---------PNPELEEDFADDCTGI----FDPNLKYPTHLLSC 529

Query: 668 SLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGN 710
           SLD TI+ +  ++G+C+   + H + V  +   A+ F  V+G+
Sbjct: 530 SLDNTIKLWEVSSGRCIRTQFGHVEGVWDI--AADNFRIVSGS 570

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 656 VNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFS 715
           + AD+ +I+ S S DK+I+ +    GKC+  +  H  P+V +    + FV+    G +  
Sbjct: 559 IAADNFRIV-SGSHDKSIKVWDLQNGKCIQTFTGHKAPIVCVGIGDSSFVSGDELGEVKM 617

Query: 716 WEI 718
           W  
Sbjct: 618 WHF 620

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 10/105 (9%)

Query: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCS 666
           L LQ     +     D T+ I+D     T           DG+   +F      DQ L +
Sbjct: 338 LTLQFNYRLLFTGSYDTTVAIWDLF---TGKLIRRLTGHSDGVKTLYF-----DDQKLIT 389

Query: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNG 711
            SLDKTIR ++Y TG+C++ Y  H D V  M+  ++K + V+G+ 
Sbjct: 390 GSLDKTIRVWNYITGECISTYRGHTDSV--MSVDSHKKIIVSGSA 432

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 84/196 (42%), Gaps = 13/196 (6%)

Query: 527 KIVITISRDRTMNFIELRAGEWNICETVKDNKG--NIIQLEMCDNKLYTISSDRTVSCYR 584
           KI+++ S D+T+    +   E   C T+K +    N ++L       Y+ S D T+  + 
Sbjct: 425 KIIVSGSADKTVKVWHV---ESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRMW- 480

Query: 585 IDIVDNT-LNVSKETILSVKNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXX 643
            DI  NT L V +  +  V+   + L + ++  +V+   K  +  D  SN T        
Sbjct: 481 -DIRTNTCLRVFRGHVGQVQKV-IPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENG 538

Query: 644 XQGDGILVNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANK 703
             G   L             L S +LD TI+ +   +G+C+   + H + V  +     +
Sbjct: 539 VNGQRELDKKMPYPTH----LLSCALDNTIKLWEVRSGRCIRTQFGHVEGVWDIAADNFR 594

Query: 704 FVTVTGNGCLFSWEIR 719
            ++ + +G +  W+++
Sbjct: 595 IISGSHDGSIKIWDLQ 610

>Scas_704.40
          Length = 608

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 10/105 (9%)

Query: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCS 666
           L LQ     +     D T+ I+D  SN             DG+   +F      +  L +
Sbjct: 257 LTLQFNYRLLFTGSYDSTVAIWDLCSNK---LIRRLSGHTDGVKTLYF-----DEAKLVT 308

Query: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNG 711
            SLDKTIR ++Y TG+C++ Y  H D V  M+  A K + V+G+ 
Sbjct: 309 GSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSA 351

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 30/56 (53%)

Query: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEIR 719
           L S SLD TI+ +   TG+C+   + H + V  +     + ++ + +G +  W+++
Sbjct: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQ 535

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 8/112 (7%)

Query: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCS 666
           L LQ     +     D T+ I+D     T           DG+   +F      D+ L +
Sbjct: 306 LTLQFNYRLLFTGSYDSTIGIWDLF---TGKLIRRLSGHSDGVKTLYF-----DDRKLIT 357

Query: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEI 718
            SLDKTIR ++Y TG+C++ Y  H+D V+ + +     V+ + +  +  W +
Sbjct: 358 GSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHV 409

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 29/56 (51%)

Query: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEIR 719
           L S  LD TI+ +   TGKC+   + H + V  +     + ++ + +G +  W+++
Sbjct: 525 LLSCGLDNTIKLWDVKTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQ 580

>Scas_692.25
          Length = 488

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 126/306 (41%), Gaps = 65/306 (21%)

Query: 324 ILVDWDNDKLWFSYDEYVDSIPLTHVLNHQERLRPGSGSSSIRGASPIKNNLFDQKFVDT 383
           I +  DN KL ++YD +  S+PL     H +      G +SI      KNN    K  + 
Sbjct: 151 IFIGTDNGKL-YAYDIFNYSLPLDSTQAHIK------GITSIDAIMEFKNN---NKTEEP 200

Query: 384 EASVRDTHKILMMKLV-----TNKTVLFCTSKGEISIINETIKPISNPSLNDIKVFKKIN 438
            A +  + K L +KL       NK +LF        I++E            +K+F+K+N
Sbjct: 201 SAIIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSE------------VKLFRKLN 248

Query: 439 NDLAVLCSKKGDIKLF---DGTKLSKYE-----LDISDLSSDEEIT-SLDFSVNENYFVV 489
           N     CS+   I+++   DG  L+ +      +   D+S D  ++ S D S+   ++  
Sbjct: 249 NIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGDFVLSGSQDASLRLTHWPS 308

Query: 490 GD--STGKLSVYKDNVCEY-----QSKVHSAAINGIQI-------YEKDAFKIVITISRD 535
           G+  S G    +     ++      ++  S  IN ++        YEK +FK   + SRD
Sbjct: 309 GNGLSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASASRD 368

Query: 536 RTMNFIELRA---------------GEWNICETVKDNKGNIIQLEMCDNKLYTISSDRTV 580
           R +   E+                   +    T+K +   +  L +  N L++ S D+T+
Sbjct: 369 RLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIRGNYLFSCSDDKTI 428

Query: 581 SCYRID 586
            C+ ++
Sbjct: 429 RCWNLE 434

>Kwal_23.5351
          Length = 474

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 663 ILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVAN--KFVTVTGNGCLFSWEIR 719
           +LCS+ LD     +   TG+ L     HA P+ G++   N     T +G+G +  W+IR
Sbjct: 327 LLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIR 385

>Kwal_23.5769
          Length = 627

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 8/112 (7%)

Query: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCS 666
           L LQ     +     D T+ I+D    +T           DG+   +F       Q L +
Sbjct: 321 LSLQFNYRLLFTGSYDSTVAIWDL---ATGKLVRRLTGHRDGVKAIYF-----DGQKLIT 372

Query: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEI 718
            SLD+ IR ++Y TG C+  Y  H+D V+ + +     V+ + +  +  W +
Sbjct: 373 GSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHV 424

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 656 VNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCL 713
           + AD+ +I+ S + DKT++ +   +GKC++ + +H  P+  +    ++FV+    GC+
Sbjct: 565 IAADNFRIV-SGAHDKTVKVWDLQSGKCIHTFDSHQAPITCVGIGDSEFVSGDELGCV 621

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTG 709
           L S SLD TI+ +   TGKC+  ++ H + +  +   A+ F  V+G
Sbjct: 532 LLSCSLDNTIKLWEVRTGKCVRTHFGHVEGIWDI--AADNFRIVSG 575

>Kwal_56.23685
          Length = 1102

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 19/104 (18%)

Query: 151 RILLYSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSI 210
           + LL++++ +S+D    V+H HS  I+ + FHP    I  +  +  D ++H W +   S 
Sbjct: 92  KALLWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSI--DAYVHAWDM--RSP 147

Query: 211 RLVASNKNSTIVLGLNWYKDSALVTYGVRQIKVWKFENTNNTAN 254
           R                Y  +++ + G  Q+K W ++N+N  A+
Sbjct: 148 RRA--------------YYSASVWSAGASQVK-WNYKNSNVMAS 176

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 11/122 (9%)

Query: 609 LQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCSSS 668
           LQ  N+ II    DK + ++D  ++              G+    F       +IL S S
Sbjct: 266 LQFENNYIITGADDKKINVYDAEND---LFLLELNGHEGGVWALKFV----DGKILVSGS 318

Query: 669 LDKTIRCFSYTTGKCLNQYYAHADPVVGMTTV----ANKFVTVTGNGCLFSWEIRPEEEA 724
            D+++R ++  TGKC + +  H   V  +  V    +   VT + +  L  W++ P +E 
Sbjct: 319 TDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPPMKEL 378

Query: 725 DE 726
           D+
Sbjct: 379 DK 380

>Scas_558.3
          Length = 725

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 74/152 (48%), Gaps = 11/152 (7%)

Query: 480 FSVNENYFVVGDSTGKLSVYKDN-VCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTM 538
            SV EN F+   +   + ++K+N + +  S +HS  I  I++    + K + T S D T+
Sbjct: 150 ISVEENTFITASADRTVKLWKENKLLKTFSGIHSDVIRNIEVLS--SGKEIATCSNDGTI 207

Query: 539 NFIELRAGEWNICETVKDNKGNI--IQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSK 596
              +L     NI + +  ++  +  ++L    +KL +   DR++   RI  ++N  N+ +
Sbjct: 208 KISDLDG---NIKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSL---RIWDINNNFNIKQ 261

Query: 597 ETILSVKNSPLRLQLTNSDIIVSRSDKTMQIF 628
              L   +      L N DI+V  SD T++IF
Sbjct: 262 VIKLPAVSIWCVDTLPNGDIVVGCSDNTVRIF 293

>Kwal_26.7570
          Length = 218

 Score = 37.0 bits (84), Expect = 0.036,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 52/119 (43%), Gaps = 5/119 (4%)

Query: 580 VSCYRIDIVDNTLNVSKETILSVKNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXX 639
           +S   + ++  TL      + S+  SP +  L    ++    DK++  +  T +      
Sbjct: 1   MSSAEVLVLRGTLEGHNGWVTSLATSPAQPNL----LLSGSRDKSLITWKLTGDDQQYGV 56

Query: 640 XXXXXQGDGILVNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMT 698
                +G   +V    V  D +  L S+S DKT+R +   TGKC+ ++  H   V+ +T
Sbjct: 57  PVRSFRGHSHIVQDCTVTPDGEYAL-SASWDKTVRLWELATGKCIQRFVGHKSDVLSVT 114

>Scas_693.22
          Length = 1145

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

Query: 138 AKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTIFTSLGLIND 197
           AK   V  T +Q + L++++A  S+D    V+H HS  I+ + F+P++  I  +  +  D
Sbjct: 83  AKPYWVVSTSNQ-KALIWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSV--D 139

Query: 198 GFLHIWKLSTNSIRLVASNKNSTIVLGLNW-YKDS-ALVTYGVRQIKVW 244
            ++H W + +       ++   +    + W YKDS  L +     I +W
Sbjct: 140 TYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSNILASAHSNDIYIW 188

>Kwal_23.6429
          Length = 750

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 54/137 (39%), Gaps = 13/137 (9%)

Query: 115 ARCSPSKIKDRIKD--ISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQH 172
           A+ SP+       D  I  +CFS D KFL  G       I ++ +A       V  +  H
Sbjct: 457 AKASPAVATSASSDLYIRSVCFSPDGKFLATG--AEDKLIRIWDLA---TRRIVMTLQGH 511

Query: 173 SYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSA 232
              I  L + P    + +  G   D  + IW L T    L  S ++    + ++   D  
Sbjct: 512 EQDIYSLDYFPSGDKLVSGSG---DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGK 567

Query: 233 LVTYGV--RQIKVWKFE 247
           L+  G   R +++W  E
Sbjct: 568 LIAAGSLDRTVRIWDSE 584

>Kwal_27.11585
          Length = 823

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 45/228 (19%), Positives = 89/228 (39%), Gaps = 59/228 (25%)

Query: 503 VCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNFIELRAGEWNICETVKDNKGNII 562
           V +Y  + H   IN + I   D+  +  T S D+T     + +GE  +  T+ ++K  + 
Sbjct: 495 VSDYTRRAHEKDINALSISPNDS--VFATASYDKTCKIWNVDSGE--LEGTLANHKRGLW 550

Query: 563 QLEMC--DNKLYTISSDRTVSCYRIDIVDNTLNVSKETILSVKNSPLRLQLTNSDIIVSR 620
            +  C  D  L T S D+T+  + ++    +++V K T+    N+  R    N +     
Sbjct: 551 DVTFCQYDKLLATCSGDKTIKVWSLE----SMSVVK-TLEGHTNAVQRCSFINRN----- 600

Query: 621 SDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCSSSLDKTIRCFSYTT 680
                                                    + + S+  D  I+ +  +T
Sbjct: 601 -----------------------------------------KQIVSTGADGLIKVWDLST 619

Query: 681 GKCLNQYYAHADPVVGMTTVAN--KFVTVTGNGCLFSWEIRPEEEADE 726
           G+C+    AH++ +  ++ +++  +FVT   +G    W+   EEE  E
Sbjct: 620 GECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEEQKE 667

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 46/121 (38%), Gaps = 11/121 (9%)

Query: 129 ISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTI 188
           I  +CFS D KFL  G      RI         N   V ++  H   I  L + P    +
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDI-----ENRKIVMILQGHEQDIYSLDYFPSGDKL 500

Query: 189 FTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSALVTYGV--RQIKVWKF 246
            +  G   D  + IW L T    L  S ++    + ++   D   +  G   R ++VW  
Sbjct: 501 VSGSG---DRTVRIWDLRTGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVWDS 556

Query: 247 E 247
           E
Sbjct: 557 E 557

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 18/139 (12%)

Query: 106 VTIGSDLSPARCSPSKIKDRI-----KDISCLC---FSADAKFLIVGETGHQPRILLYSM 157
           V IG+     + +  ++KD I     K  S +C   F  D   L  G  G+   ++++  
Sbjct: 319 VCIGAKSGEIQVNDVRVKDHIVSTWEKHTSEVCGIKFRQDGLQLASG--GNDNTVMIWDT 376

Query: 158 APDSNDFPVFVIHQHSYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVASNK 217
             D    P++V   H+  +  + +HPD   +  + G   D  +H W  +T + R+ + N 
Sbjct: 377 RQDE---PLWVKRNHNAAVKAITWHPDVVNLLATGGGSLDRHIHFWNTTTGA-RIGSINT 432

Query: 218 NSTIVLGLNW---YKDSAL 233
            S  V  L+W   Y+DS +
Sbjct: 433 GSQ-VSSLHWGQSYEDSHM 450

>YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing
           five WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has a region of low
           similarity to a region of S. cerevisiae Sec27p, which a
           coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles [3447 bp, 1148 aa]
          Length = 1148

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

Query: 138 AKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTIFTSLGLIND 197
           AK   +  T +Q + +++++A  S++   FV+H HS  I+ + F+P    +  +  +  D
Sbjct: 80  AKPYWIVSTSNQ-KAIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSV--D 136

Query: 198 GFLHIWKLSTNSIRLVASNKNSTIVLGLNW-YKD-SALVTYGVRQIKVW 244
            ++H W + +      +++   +    + W YKD + L +     I VW
Sbjct: 137 TYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPNVLASSHGNDIFVW 185

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 55/149 (36%), Gaps = 13/149 (8%)

Query: 98  SDEASEKAVTIGSDLSPARCSPSKIKDRIKDISCLCFSADAKFLIVGETGHQPRILLYSM 157
           SDE +      G+D + A  S     D    I  +CFS D KFL  G      RI     
Sbjct: 529 SDENAHTDKADGNDNAEAETSAGATTDLY--IRSVCFSPDGKFLATGAEDKLIRIWDIEQ 586

Query: 158 APDSNDFPVFVIHQHSYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVASNK 217
                   V V+  H   I  L + P    + +  G   D  + IW L T    L  S +
Sbjct: 587 KKI-----VMVLKGHEQDIYSLDYFPSGDKLVSGSG---DRTVRIWDLKTGQCTLTLSIE 638

Query: 218 NSTIVLGLNWYKDSALVTYGV--RQIKVW 244
           +    + ++   D   +  G   R ++VW
Sbjct: 639 DGVTTVAVS-PGDGKFIAAGSLDRAVRVW 666

>Scas_713.50
          Length = 983

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 101/236 (42%), Gaps = 44/236 (18%)

Query: 488 VVGDSTGKLSVYKDNVCEYQ----SKVHSAAINGIQIYEKDAFKIVITISRDRTMNFIEL 543
           ++G   G+L ++ D     Q     + H AAI  + +      K +IT S D+++ F   
Sbjct: 484 IIGTRAGELQLF-DLASSTQIANIEEAHDAAIWSLDLTSDG--KRLITGSADKSVKF--- 537

Query: 544 RAGEWNICETVKDNKGNIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETILSVK 603
               WN             QLE    +L   +SD+ V    +   D TL +S + ILSV+
Sbjct: 538 ----WNF------------QLE---QELVPGTSDKFVPKLGLH-HDTTLELSDD-ILSVR 576

Query: 604 NSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQI 663
            SP      +  + VS  D T+++F   S             G  + V    ++ DS  I
Sbjct: 577 VSP-----EDKFLAVSLLDNTVKVFFLDS-----MKFFLSLYGHKLPVLSIDISFDSKMI 626

Query: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTV--ANKFVTVTGNGCLFSWE 717
           + SS+ DK I+ +    G C    +AH D ++ +  V  ++ F + + +G +  W+
Sbjct: 627 ITSSA-DKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWD 681

>Scas_630.6
          Length = 621

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 76/166 (45%), Gaps = 18/166 (10%)

Query: 548 WNICE-----TVKDNKGNIIQLEMCDN--KLYTISSDRTVSCYRIDIVDNTLNVSKE-TI 599
           WNI E      +K ++ +I  L+   +  KL + S DR++  + +     +L +S E  +
Sbjct: 368 WNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGV 427

Query: 600 LSVKNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNAD 659
            +V  SP   +L    I     D++++I+D ++             G+G   + + V   
Sbjct: 428 TTVAVSPNEGKL----IAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFT 483

Query: 660 SD-QILCSSSLDKTIRCFSYT-----TGKCLNQYYAHADPVVGMTT 699
            D Q + S SLD+T++ ++       TGKC   Y  H D V+ + T
Sbjct: 484 KDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVAT 529

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 46/118 (38%), Gaps = 11/118 (9%)

Query: 129 ISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTI 188
           I  +CFS D +FL  G      RI             V V+  H   I  L + PD   +
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERK-----IVMVLKGHEQDIYSLDYFPDGQKL 398

Query: 189 FTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSALVTYGV--RQIKVW 244
            +  G   D  + IW L T    L  S ++    + ++   +  L+  G   R +++W
Sbjct: 399 VSGSG---DRSIRIWDLKTGQCSLTLSIEDGVTTVAVS-PNEGKLIAAGSLDRSVRIW 452

>YPL139C (UME1) [5307] chr16 complement(289668..291050) Negative
           regulator of meiosis [1383 bp, 460 aa]
          Length = 460

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 5/100 (5%)

Query: 401 NKTVLFCTSKGEISIINETIKPISNPSLNDIKVFKKINNDLAVLCSKKGDIKLFDGTKLS 460
           N T+    + G+I    E ++ I  P + +I+  K +NN +   CS  G I+ F G ++ 
Sbjct: 211 NATIKLIDNSGKIG---EVLRTIPVPGIKNIQEIKFLNNQIFATCSDDGIIR-FWGNEIG 266

Query: 461 KYELDISDLSSDEEITSLDFS-VNENYFVVGDSTGKLSVY 499
           K  L I + S D + T    S   +  F+ G S G L V+
Sbjct: 267 KKPLWILNDSLDGKTTCFAASPFVDTLFMTGTSGGALKVW 306

>Scas_707.22
          Length = 730

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 11/121 (9%)

Query: 609 LQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCSSS 668
           LQ  +  +I    D+ ++I+D  + S          +G G+    + +  D+D I+ S S
Sbjct: 362 LQFEDDYVITGADDRQLRIYD--ARSKKFLKELSGHEG-GV----WALKYDADGIIVSGS 414

Query: 669 LDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANK----FVTVTGNGCLFSWEIRPEEEA 724
            D+++R +    G C + +  H   V  +  V  K     VT + +  L  W++  EE+ 
Sbjct: 415 TDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLIKEEKF 474

Query: 725 D 725
           D
Sbjct: 475 D 475

>YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in
           telomere silencing, interacts with Sir4p and targets
           Sir4p from telomeres to other sites, component of Set3p
           complex, has WD (WD-40) repeats [1608 bp, 535 aa]
          Length = 535

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 659 DSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVA-NKFVTVTGNGCLFSWE 717
           D++++L S+S D T+R +    G   N +Y H+  +V  + V  +K ++ + +G +  W 
Sbjct: 369 DTNKLLLSASDDGTLRIWHGGNGNSQNCFYGHSQSIVSASWVGDDKVISCSMDGSVRLWS 428

Query: 718 IR 719
           ++
Sbjct: 429 LK 430

>Scas_631.17
          Length = 474

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 663 ILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKF--VTVTGNGCLFSWEIRP 720
           +LCS  LD     +   TGK +     HA P+  +    + +   T  G+G +  W+IR 
Sbjct: 331 LLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRK 390

Query: 721 EEE 723
             E
Sbjct: 391 TTE 393

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 651 VNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTV--ANKFVTVT 708
           V H   +  +  +L SSSLD T+R ++  TG+ + +   H D V  M+         TV 
Sbjct: 142 VGHILYHPTAKDVLASSSLDYTVRIWNVETGEDIYK-LKHPDMVTSMSFSYDGTHLATVA 200

Query: 709 GNGCLFSWEIRPEE 722
            +  L  W +R E+
Sbjct: 201 RDKKLRVWNVREEK 214

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 90/207 (43%), Gaps = 25/207 (12%)

Query: 528 IVITISRDRTMNFIELRAGEWNICETVKDNKGNIIQLEMCDN--KLYTISSDRTVSCYRI 585
           +V+  +R   +   +L +    +  T + +   I  L++  N  +L T S+D++   +  
Sbjct: 436 LVVVGTRQGELQLFDLASS--TLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDF 493

Query: 586 DIVDN-----------TLNVSKETILSVKNSPLRLQLTNSD--IIVSRSDKTMQIFDKTS 632
           ++V+             L +  +T L + +  L +++++ D  + VS  D T+++F   S
Sbjct: 494 EVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDS 553

Query: 633 NSTPXXXXXXXXQGDGILVNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHAD 692
                        G  + V     + DS ++L +SS DK I+ +    G C    +AH D
Sbjct: 554 -----LKFYLSLYGHKLPVLSIDFSVDS-KMLITSSADKNIKIWGVDFGDCHKSIFAHQD 607

Query: 693 PVVGMTTVAN--KFVTVTGNGCLFSWE 717
            ++ +   A+   F +   +G +  W+
Sbjct: 608 SIMSVRFEADTHNFFSCGKDGAVKRWD 634

>Scas_719.52
          Length = 628

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 651 VNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTV--ANKFVTVT 708
           V H   +  ++ +L SSSLD T++ ++  TG+ +     H D V  M+     N   TV 
Sbjct: 143 VGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVIT-LKHPDMVTSMSFSYGGNHLATVC 201

Query: 709 GNGCLFSWEIR 719
            +  L  W+IR
Sbjct: 202 RDKKLRVWDIR 212

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 100/235 (42%), Gaps = 42/235 (17%)

Query: 488 VVGDSTGKLSVY---KDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNFIELR 544
           ++G   G+L ++      + E   + H+AAI  + +      K ++T S D+T+ F + +
Sbjct: 440 ILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDG--KRLVTASADKTVKFWDFK 497

Query: 545 AGEWNICETVKDNKGNIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETILSVKN 604
                                  + +L   + D+ V   ++ I D TL++  E +  VK 
Sbjct: 498 V----------------------EQELVAGTLDKFVPKMKL-IHDTTLDLG-EDLWCVKI 533

Query: 605 SPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQIL 664
           SP      +  + VS  D T+++F   S             G  + V    ++ DS +++
Sbjct: 534 SP-----EDRFLAVSLLDNTVKVFFLDS-----MKFFLSLYGHKLPVLSMDISHDS-KLI 582

Query: 665 CSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTV--ANKFVTVTGNGCLFSWE 717
            +SS DK I+ +    G C    +AH D ++ +  +  ++ F + + +G +  W+
Sbjct: 583 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWD 637

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 50/119 (42%), Gaps = 5/119 (4%)

Query: 580 VSCYRIDIVDNTLNVSKETILSVKNSPLRLQLTNSDIIVSRSDKTMQIFDKTSNSTPXXX 639
           +S   I ++  TL      + S+  SP +  +    ++    DKT+  +  T        
Sbjct: 17  MSTDEILVLRGTLEGHNGWVTSLSTSPAQPNM----LLSGSRDKTLITWKLTGEDQQYGV 72

Query: 640 XXXXXQGDGILVNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMT 698
                +G   +V    V  D    L S+S DKT+R +   +GKC+ ++  H   V+ ++
Sbjct: 73  PVRSFKGHSHIVQDCTVTHDGKYAL-SASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVS 130

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 610 QLTNSDIIVSRSDKTMQI--FDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCSS 667
           +  +S  +VS + K  QI  +D +SN+            D  + +      D+D +L SS
Sbjct: 182 EFIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASS 241

Query: 668 SLDKTIRCFSYTTGKCLNQYYAHADPV 694
           S D T++ +     +CL  +  H++ V
Sbjct: 242 SRDATVKVWRVNDSRCLQSFSPHSEWV 268

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 74/168 (44%), Gaps = 25/168 (14%)

Query: 569 NKLYTISSDRTVSCYRIDIVDNTLNVSKE-TILSVKNSPLRLQLTNSDIIVSRS-DKTMQ 626
           NKL + S DRT+  + +     +L +S E  + +V  SP      N + + + S D+T++
Sbjct: 428 NKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSP-----GNGNYVAAGSLDRTVR 482

Query: 627 IFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSD-QILCSSSLDKTIRCFSY------- 678
           ++D  S             G G   + + V    D + + S SLD++++ ++        
Sbjct: 483 VWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGAS 542

Query: 679 ------TTGKCLNQYYAHADPVVGMTTVANKFVTVTGN---GCLFSWE 717
                 T G C   Y  H D V+ +TT  N    ++G+   G +F W+
Sbjct: 543 TSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIF-WD 589

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 63/159 (39%), Gaps = 19/159 (11%)

Query: 129 ISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTI 188
           I  +CFS D KFL  G       I ++ +A       V V+  H   I  L +    + +
Sbjct: 376 IRSVCFSPDGKFLATG--AEDKLIRIWDIAQRK---IVMVLRGHEQDIYSLDYFQSGNKL 430

Query: 189 FTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSALVTYGV-RQIKVW--- 244
            +  G   D  + IW L T    L  S ++    + ++    + +    + R ++VW   
Sbjct: 431 VSGSG---DRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSN 487

Query: 245 ------KFENTNNTA-NNKLTIPRTRTAIKGKNIVLGTL 276
                 + ++   T   +K ++        GKNIV G+L
Sbjct: 488 SGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSL 526

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 175 GISQLQFHPDDSTIFTSLG---LIN---DGFLHIWKLSTNS-IRLVASNKNSTIVLGLNW 227
           G+ +L+ H D  T F   G   LI+   DG + +W L T+  I    ++      L +  
Sbjct: 155 GLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAV-- 212

Query: 228 YKDSALVTYGV-RQIKVWKFENTNNTANNKLT 258
            KD  L+T G   Q+K+WK +  N+    KLT
Sbjct: 213 -KDDLLITTGTDSQVKIWKLDIENDKMGGKLT 243

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 41/208 (19%), Positives = 95/208 (45%), Gaps = 26/208 (12%)

Query: 528 IVITISRDRTMNFIELRAGEWNICETVKD-NKGNIIQLEMCDN--KLYTISSDRTVSCYR 584
           +VI  +R+  +   +L +   ++ +T++D +   I  L++  +  +L T S+D+TV  + 
Sbjct: 444 LVILGTRNGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD 501

Query: 585 IDIVDN-----------TLNVSKETILSVKNSPLRLQLTNSD--IIVSRSDKTMQIFDKT 631
             + ++            L +  +T L + +  L ++++  D  + +S  D T+++F   
Sbjct: 502 FKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLD 561

Query: 632 SNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHA 691
           S             G  + V    ++ DS  I+ SS+ DK I+ +    G C    +AH 
Sbjct: 562 S-----MKFYLSLYGHKLPVLSIDISFDSKMIITSSA-DKNIKIWGLDFGDCHKSLFAHQ 615

Query: 692 DPVVGMTTV--ANKFVTVTGNGCLFSWE 717
           D ++ +  +  ++ F + + +  +  W+
Sbjct: 616 DSIMNVKFLPQSHNFFSCSKDAVVKYWD 643

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%)

Query: 663 ILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGM 697
           +LCS+S+D++I+ +   TG  L    AH++PVV +
Sbjct: 111 LLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSI 145

>CAGL0F07337g complement(714870..716735) similar to sp|P26309
           Saccharomyces cerevisiae YGL116w CDC20 cell division
           control protein, hypothetical start
          Length = 621

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 47/115 (40%), Gaps = 15/115 (13%)

Query: 121 KIKDRI--------KDISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQH 172
           +IKD I         ++  L + AD   L  G  G+   ++++         P FV   H
Sbjct: 364 RIKDHIVNTWDEHTGEVCGLSYKADGLQLASG--GNDNTMMIWDT---RTSMPQFVKKDH 418

Query: 173 SYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNW 227
           S  +  L + P ++ +  S G   D  +H W  ST   +L   N  S  V  L+W
Sbjct: 419 SAAVKALAWSPTNAGLLASGGGQTDQQIHFWN-STTGAKLHTINTGSQ-VSSLHW 471

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 3/79 (3%)

Query: 646 GDGILVNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTV--ANK 703
           G    V H   +  ++ +L SSS D T++ ++  TGK +     H D V  M+     N 
Sbjct: 138 GHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMIT-LKHPDMVTSMSFSYDGNY 196

Query: 704 FVTVTGNGCLFSWEIRPEE 722
             TV  +  L  W IR E+
Sbjct: 197 LATVARDKKLRVWNIREEK 215

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 661 DQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPV--VGMTTVANKFVTVTGNGCLFSW 716
           ++ L S+S DKT+R +S  T  CL  Y  H  PV  V  + + + F+T + +     W
Sbjct: 565 NRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLW 622

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 6/64 (9%)

Query: 660 SDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVAN---KFVTVTG--NGCLF 714
            D+IL S S D+T+R ++   GKC + +  H   V  +  V +   K+V VTG  +  L 
Sbjct: 417 GDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYV-VTGSRDNTLH 475

Query: 715 SWEI 718
            W++
Sbjct: 476 VWKL 479

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 661 DQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPV--VGMTTVANKFVTVTGNGCLFSW 716
           ++ L S+S DKT+R +S  T  CL  Y  H  PV  V  + + + F T + +     W
Sbjct: 554 NRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLW 611

>CAGL0B02013g 184252..187614 highly similar to tr|Q03897
           Saccharomyces cerevisiae YDR128w, start by similarity
          Length = 1120

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 9/75 (12%)

Query: 138 AKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQF---HPDDSTIFTSLGL 194
           AK   V  T +Q + L++++A  S D    V+H HS  I+ + F   HPD   I  +  +
Sbjct: 80  AKPFWVVSTSNQ-KALIWNLARPSTDAIEHVLHSHSRAITDINFNFQHPD---ILATCSI 135

Query: 195 INDGFLHIWKLSTNS 209
             D ++H W L + S
Sbjct: 136 --DTYVHAWDLRSTS 148

>Sklu_2315.8 YPL071C, Contig c2315 13843-14286
          Length = 147

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 66  QESHSPTNIAKDYYG---LIKPEHSISIKGDTWNDSDEASEKAVTIGSDLSPARCSPSKI 122
           + SHSP NI    Y    LI+   ++SI  DT +   +  EKA    S  +     P+ I
Sbjct: 2   KRSHSPDNIGISNYKRQRLIQDLENLSISTDTLSRRTQTKEKASLTSSKHAGLHIVPNAI 61

Query: 123 KDRI 126
           KDRI
Sbjct: 62  KDRI 65

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 2/89 (2%)

Query: 615 DIIVSRS-DKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQILCSSSLDKTI 673
           +++VS S DKT+  +  T N           +G   +V    V+AD +  + S+S DKT+
Sbjct: 32  NLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAV-SASWDKTL 90

Query: 674 RCFSYTTGKCLNQYYAHADPVVGMTTVAN 702
           R ++  TG    ++  H   V+ +   AN
Sbjct: 91  RLWNLATGNSEARFVGHTGDVLSVAIDAN 119

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 46/117 (39%), Gaps = 9/117 (7%)

Query: 129 ISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTI 188
           I  +CFS D KFL  G      RI             V  +  H   I  L + P  + +
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKK-----IVMTLKGHEQDIYSLDYFPSGNKL 463

Query: 189 FTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSALVTYGV-RQIKVW 244
            +  G   D  + IW L+T +  L  S ++    + ++  +   +    + R ++VW
Sbjct: 464 VSGSG---DRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVW 517

>Scas_629.12
          Length = 671

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 46/119 (38%), Gaps = 13/119 (10%)

Query: 129 ISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFP-VFVIHQHSYGISQLQFHPDDST 187
           I  +CFS D +FL  G      RI       D  +   V V+  H   +  L + P+   
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIW------DIQERKIVMVLKGHEQDVYSLDYFPNGEK 443

Query: 188 IFTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVLGLNWYKDSALVTYGV--RQIKVW 244
           + +  G   D  + IW L T    L  S +     + ++   D   +  G   R ++VW
Sbjct: 444 LVSGSG---DRTVRIWDLRTGQCSLTLSIEYGVTTVAVS-PNDGKFIAAGSLDRAVRVW 498

>Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement
          Length = 587

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 28/64 (43%), Gaps = 2/64 (3%)

Query: 164 FPVFVIHQHSYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSIRLVASNKNSTIVL 223
            P FV   H+  +  + + PD   +  + G   D ++H W  +T +   V+S    + V 
Sbjct: 408 MPQFVKRNHTAAVKAISWCPDVPNLLATGGGQTDKYIHFWNTTTGA--RVSSINTGSQVS 465

Query: 224 GLNW 227
            L W
Sbjct: 466 SLQW 469

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 25/37 (67%)

Query: 663 ILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTT 699
           +LC++S+D++I+ +   +G  L    AH+DPVV + T
Sbjct: 110 LLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSIDT 146

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 663 ILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGM 697
           ILCSSS+D++I+ +   +G  L    AH+D VV +
Sbjct: 124 ILCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSI 158

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 9/90 (10%)

Query: 120 SKIKDRIKDISCLCFSADAKFLIVGETGHQPRILLYSMAPDSNDFPVFVIHQHSYGISQL 179
            K++   K ++ + ++   K L+     +  R+         N  P  V + HS  I+  
Sbjct: 317 GKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVW-----RGGNLNPSHVFYGHSQSITSA 371

Query: 180 QFHPDDSTIFTSLGLINDGFLHIWKLSTNS 209
            +  DD+ I TS+    DG + +W L++NS
Sbjct: 372 HWVDDDTIISTSM----DGSIRVWSLASNS 397

>Scas_512.3
          Length = 534

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 661 DQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMT 698
           D+ + S S+D +IR F   +GK L  Y  H   V G+T
Sbjct: 158 DRYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVT 195

>Kwal_27.12239
          Length = 316

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 663 ILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGM 697
           +LCS S+D++I+ +   +G  L    AH++PVV +
Sbjct: 113 LLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSI 147

>Scas_718.6*
          Length = 546

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 657 NADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFV-TVTGNGCLFS 715
           N +S  +L SS  D +IR +      C N +Y H+  ++ ++ + +  V + + +G +  
Sbjct: 378 NVNSRLLLTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRI 437

Query: 716 WEI 718
           W +
Sbjct: 438 WSV 440

>Kwal_56.23920
          Length = 937

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 78/176 (44%), Gaps = 23/176 (13%)

Query: 559 GNIIQLEMCDN--KLYTISSDRTVSCYRI-----------DIVDNTLNVSKETILSVKNS 605
           G I  L+M  +  +L T S+D+TV  +             D  +  L +  +T L + + 
Sbjct: 468 GAIWSLDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDD 527

Query: 606 PLRLQLT--NSDIIVSRSDKTMQIFDKTSNSTPXXXXXXXXQGDGILVNHFYVNADSDQI 663
            L ++++  N  + VS  D T+++F   S             G  + V    ++ DS ++
Sbjct: 528 VLAVKISPDNRLLAVSLLDNTVKVFFMDS-----MKFFLSLYGHKLPVLSIDISFDS-KL 581

Query: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTV--ANKFVTVTGNGCLFSWE 717
           L +SS DK I+ +    G C    +AH D ++ +  V  ++ F + + +  +  W+
Sbjct: 582 LITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWD 637

>Kwal_23.5035
          Length = 744

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 13/133 (9%)

Query: 436 KINNDLAVLCSKKGDIKLFDGTKLSKYELDISDLSS-DEEITSLDFSVNENYFVVGDSTG 494
           +  +D  +  +    I+++D    +K E  I+ LS  D  + +L +  ++   V G +  
Sbjct: 377 QFEDDYVITGADDKMIRVYD----AKTEKFITQLSGHDGGVWALKYG-HDGILVSGSTDR 431

Query: 495 KLSVY--KDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNFIEL---RAGEWN 549
            + V+  K   C +  K H++ +  + I E +  K ++T SRD T++  +L    A ++N
Sbjct: 432 SVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYN 491

Query: 550 --ICETVKDNKGN 560
             +CE       N
Sbjct: 492 PEVCEVFNTTDAN 504

>Kwal_27.12667
          Length = 721

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 647 DGILVNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCL 684
           D I   HF  N+     L S S D+TIR +  TTGKCL
Sbjct: 503 DEITALHFEGNS-----LVSGSQDRTIRQWDLTTGKCL 535

>Scas_571.4
          Length = 601

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 3/70 (4%)

Query: 651 VNHFYVNADSDQILCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANK--FVTVT 708
           V H   +     +L SSSLD T++ ++   GK +     H+D V  M    +     T+T
Sbjct: 151 VGHVLFHPRIRNVLASSSLDFTVKIWNIKKGKVIGT-LQHSDMVTAMAFDPDGAYLATIT 209

Query: 709 GNGCLFSWEI 718
            N  L  W+I
Sbjct: 210 RNKKLTIWDI 219

>AGR067W [4377] [Homologous to ScYDR128W - SH]
           complement(842182..845559) [3378 bp, 1125 aa]
          Length = 1125

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/86 (17%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 151 RILLYSMAPDSNDFPVFVIHQHSYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLSTNSI 210
           + +++++A  S++     +H H+  I+ + FHP    +  +  +  D ++H W +  +  
Sbjct: 92  KAIVWNLARSSSNAVEHELHGHTRAITDINFHPIHPELLATCSI--DTYVHAWDMRCSQR 149

Query: 211 RLVASNKNSTIVLGLNW-YKDSALVT 235
               ++  S+    + W +KD+ ++ 
Sbjct: 150 PFYGTSDWSSGASQVKWNFKDANIIA 175

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 9/99 (9%)

Query: 437 INNDLAVLCSKKGDIKLFDGTKLSKYELDISDLSSDEEITSLDFSVNENYFVVGDSTGKL 496
           + +   ++ S     +++D   L  + L ISD  +DEEI+ L+      ++V     GK+
Sbjct: 41  LGSTFYIVTSVGKSFQIYDANNL--HLLFISDRETDEEISCLEAHF---HYVYAGFGGKV 95

Query: 497 SVYKDNVCEYQSKVHSAAINGIQIYEKDAFKIVITISRD 535
            +YK  + E+  +V     NG ++ +   F   + +S D
Sbjct: 96  GIYKRGILEHTIEVG----NGCKVTKLCVFGDYLCVSTD 130

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 87/195 (44%), Gaps = 20/195 (10%)

Query: 436 KINNDLAVLCSKKGDIKLFDGTKLSKYELDISDLSSDEEITSLDFS-VNENYFVVGDSTG 494
           +  N L +  S     K++D  KL KY+L       + E +  D + V+++  +   +  
Sbjct: 109 RFQNGLLLSSSWDKTAKIWDNNKL-KYDL------RNHEASVWDSTMVSDDIILTASADK 161

Query: 495 KLSVYKDN-VCEYQSKVHSAAINGIQIYEKDAFKIVITISRDRTMNFIELRAGEWNICET 553
            + V+ +  + +  S +H   I  ++    D F    + S D T+  + L     N+ E 
Sbjct: 162 SIGVWMEGKLIKKLSNIHDDVIRHLEYISNDIFA---SCSNDGTIKLLNLEGEIKNVFEG 218

Query: 554 VKDNKGNIIQLEMCDNKLYTISSDRTVSCYRIDIVDNTLNVSKETILSVKNSPLRLQLTN 613
              ++  +  ++  +N L++   D TV  + I+   +T  V +   +SV N  L   L N
Sbjct: 219 ---HESFVYCVKHMNNTLFSCGEDSTVRIWSIN--GSTKQVIRIPAVSVWNLDL---LPN 270

Query: 614 SDIIVSRSDKTMQIF 628
            D ++  SD T++IF
Sbjct: 271 GDFVICCSDNTIRIF 285

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 656 VNADSDQILCSSSLDKTIRCFSYT-TGKCLNQYYAHA 691
           V      +L S S DKTIRC+     GKC+N   +HA
Sbjct: 284 VKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHA 320

>Scas_620.7
          Length = 576

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 463 ELDISDLSSDEEITSLDFSVNENYFVVGDSTGKLSVYKDNVCEYQSKVHSAAINGIQIYE 522
           EL  +DLS D  I+     +     V GDST ++ V+ D +C Y +     +I GIQ   
Sbjct: 218 ELKNTDLSQDLSISRPSSRLKWGIEVPGDSTQRIYVWFDALCNYVT-----SIGGIQSVI 272

Query: 523 KDA 525
           ++A
Sbjct: 273 REA 275

>CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces
           cerevisiae YGR200c subunit of elongating RNA polymerase
           II holoenzyme, start by similarity
          Length = 793

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 50/113 (44%), Gaps = 16/113 (14%)

Query: 172 HSYGISQLQFHPDDSTIFTSLGLINDGFLHIWKLS----TNSIRLVASNKNSTIVLGLNW 227
           HS  I++L+F PD   +   L +  D    +W+ +    T +++      +S I+    W
Sbjct: 610 HSLTITRLRFSPDSKYL---LSVCRDRKWAVWERNFDDNTFTLKYTDEKPHSRIIWDGEW 666

Query: 228 ----YKDSALVTYGVRQIKVWKFENTNNTANN-----KLTIPRTRTAIKGKNI 271
               + +  L T   R++KVW  E + + A +     KL  P T  +I  K I
Sbjct: 667 APLEFGNVFLTTSRDRKVKVWSLETSESNAFSMLHFIKLNSPITAISIYNKVI 719

>YOR229W (WTM2) [5020] chr15 (768409..769812) Transcriptional
           modulator protein involved in meiotic regulation and
           silencing, member of WD (WD-40) repeat family [1404 bp,
           467 aa]
          Length = 467

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 420 IKPISNPSLNDIKVFKKINNDLAVLCSKKGDIKLFDGTKLSKYELDISDLSSDEEITSLD 479
           ++ +  P  N     +  NN L   CS    ++ +D     K    +S+   +  +TS D
Sbjct: 238 LRTVHVPGTNVAHSVRFFNNHLFASCSDDNILRFWDTRTADKPLWTLSE-PKNGRLTSFD 296

Query: 480 FS-VNENYFVVGDSTGKLSVY 499
            S V EN FV G STG + ++
Sbjct: 297 SSQVTENLFVTGFSTGVIKLW 317

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,676,066
Number of extensions: 1318297
Number of successful extensions: 4649
Number of sequences better than 10.0: 115
Number of HSP's gapped: 4783
Number of HSP's successfully gapped: 130
Length of query: 849
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 739
Effective length of database: 12,788,129
Effective search space: 9450427331
Effective search space used: 9450427331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)