Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F16016g28327915210.0
Sklu_1159.12822799951e-137
ACR084C2932779801e-134
Kwal_55.215822842739451e-129
Scas_699.442822809301e-127
YOR040W (GLO4)2852789181e-125
CAGL0I00924g2742718921e-121
YDR272W (GLO2)2742738541e-115
KLLA0A00979g343171690.86
CAGL0G07172g86677672.0
Kwal_55.20793520109662.1
YML049C (RSE1)136145653.0
AFR173W55934644.1
YGL192W (IME4)60034644.1
Kwal_14.159164071635.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F16016g
         (279 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320 S...   590   0.0  
Sklu_1159.1 YOR040W, Contig c1159 273-1121                            387   e-137
ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W (...   382   e-134
Kwal_55.21582                                                         368   e-129
Scas_699.44                                                           362   e-127
YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 ...   358   e-125
CAGL0I00924g complement(75399..76223) similar to sp|Q05584 Sacch...   348   e-121
YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825...   333   e-115
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    31   0.86 
CAGL0G07172g complement(678730..681330) some similarities with Y...    30   2.0  
Kwal_55.20793                                                          30   2.1  
YML049C (RSE1) [3921] chr13 complement(174220..178305) U2 snRNP-...    30   3.0  
AFR173W [3365] [Homologous to ScYGL192W (IME4) - SH] complement(...    29   4.1  
YGL192W (IME4) [1801] chr7 (142250..144052) Positive transcripti...    29   4.1  
Kwal_14.1591                                                           29   5.7  

>KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320
           Saccharomyces cerevisiae YOR040w GLO4 glyoxalase II
           (hydroxyacylglutathione hydrolase), start by similarity
          Length = 283

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/279 (100%), Positives = 279/279 (100%)

Query: 1   MIKQSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSI 60
           MIKQSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSI
Sbjct: 1   MIKQSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSI 60

Query: 61  EALVNTHHHYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKI 120
           EALVNTHHHYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKI
Sbjct: 61  EALVNTHHHYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKI 120

Query: 121 LCIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGN 180
           LCIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGN
Sbjct: 121 LCIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGN 180

Query: 181 TGDTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIA 240
           TGDTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIA
Sbjct: 181 TGDTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIA 240

Query: 241 DELSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279
           DELSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM
Sbjct: 241 DELSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279

>Sklu_1159.1 YOR040W, Contig c1159 273-1121
          Length = 282

 Score =  387 bits (995), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/279 (65%), Positives = 214/279 (76%), Gaps = 1/279 (0%)

Query: 1   MIKQSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSI 60
           MIK  IR MHVKAIKMRWLTGGVNYSYLLSTQDK KSWLIDPAE LEV+  L   E  SI
Sbjct: 1   MIKIYIRSMHVKAIKMRWLTGGVNYSYLLSTQDKTKSWLIDPAEPLEVLPKLTDKEIGSI 60

Query: 61  EALVNTHHHYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKI 120
           EA+VNTHHHYDH+GGN+  +AAL + G N   VI GS  SP A ++P +L +Y LG+L++
Sbjct: 61  EAVVNTHHHYDHSGGNIPVIAALKKAGQNAVSVICGSHTSPGATEVPQDLQKYKLGDLEV 120

Query: 121 LCIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGN 180
           LCIRTPCHTQDS CY+V+D +T E+ IFTGDTLFT GCGRFFEGT EEMD ALN  LL +
Sbjct: 121 LCIRTPCHTQDSVCYFVKDFDTGERCIFTGDTLFTAGCGRFFEGTGEEMDRALNRNLLEH 180

Query: 181 TGDTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIA 240
           TG+  NW   KVYPGHEYT  NV F+R  IY    +N  F+KLE F  ++EVTTG FT+ 
Sbjct: 181 TGE-ENWSTTKVYPGHEYTKSNVEFVRAAIYKTPGENKAFDKLEHFCDKNEVTTGCFTLK 239

Query: 241 DELSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279
           DEL FNPFMRL+ P+VR+ VGD+QG W +A+VMDKLR M
Sbjct: 240 DELDFNPFMRLNCPMVRKSVGDAQGAWPKARVMDKLRQM 278

>ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W
           (GLO2) - SH] (507338..508219) [882 bp, 293 aa]
          Length = 293

 Score =  382 bits (980), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/277 (64%), Positives = 217/277 (78%), Gaps = 5/277 (1%)

Query: 4   QSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEAL 63
           + +RKMHVKAIKMRWLTGGVNYSYL+STQDKK SWLIDPAE LEV+  L  DE +SI A+
Sbjct: 17  RQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRAI 76

Query: 64  VNTHHHYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGN-LKILC 122
           VNTHHHYDHAGGN++  AAL  +G  +  VIAGS  SP++ DIP++L +YTLG+ +++LC
Sbjct: 77  VNTHHHYDHAGGNLAIRAALKREGVAVP-VIAGSTTSPVSTDIPEHLQKYTLGDSVEVLC 135

Query: 123 IRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTG 182
           IRTPCHTQDS CY++RD +T +QA+FTGDTLFT GCGRFFEGTAEEMD ALN RLL +  
Sbjct: 136 IRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHVQ 195

Query: 183 DTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADE 242
           D +     KVYPGHEYT GNV FIR+ IY+ + DN  F++LESF   + VTTG FT+ DE
Sbjct: 196 DHA---ATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDE 252

Query: 243 LSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279
             +NPFMRLDDP +RR+VGD    W RA VM KLR+M
Sbjct: 253 TEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLRSM 289

>Kwal_55.21582
          Length = 284

 Score =  368 bits (945), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 174/273 (63%), Positives = 202/273 (73%), Gaps = 1/273 (0%)

Query: 7   RKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEALVNT 66
           R MHVKAIKMRWLTGGVNY YLLSTQDK KSWLIDPAE LEVM  L ++EA +++A+VNT
Sbjct: 9   RSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVVNT 68

Query: 67  HHHYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKILCIRTP 126
           HHHYDH+GGN + +  L + G +   VI GS  SP A  IP NL EY+LG+LKI CIRTP
Sbjct: 69  HHHYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDLKIKCIRTP 128

Query: 127 CHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTGDTSN 186
           CHTQDS CYYV DP T E+ IFTGDTLFT GCGRFFEGT EEMD ALN  +L   G+  N
Sbjct: 129 CHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGE-PN 187

Query: 187 WKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADELSFN 246
           W   KVYPGHEYT  NV F+R  +Y    +N   ++LE    +H+VTTG FTI DEL++N
Sbjct: 188 WDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELAYN 247

Query: 247 PFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279
           PFMRLDDP VR  + DS G  +RAQVMD+LR M
Sbjct: 248 PFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKM 280

>Scas_699.44
          Length = 282

 Score =  362 bits (930), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 169/280 (60%), Positives = 214/280 (76%), Gaps = 3/280 (1%)

Query: 1   MIKQSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSI 60
           M++Q + KM+VK IKMRW TGGVNYSYLLS+QDK+ SWLIDPAE+ EV+  L   E  +I
Sbjct: 1   MLRQ-VGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNI 59

Query: 61  EALVNTHHHYDHAGGNVSTLAALNEKGN-NISRVIAGSQRSPIANDIPDNLHEYTLGNLK 119
            A+VNTHHHYDH+ GN+S +  L + GN +I ++IAGS+ SP  ++IP +L +Y LGNL+
Sbjct: 60  RAIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLE 119

Query: 120 ILCIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLG 179
           ++C+RTPCHTQDS CYYV+D +T EQ +FTGDTLFTGGCGRFFEG  +EMD ALN  +L 
Sbjct: 120 VVCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILE 179

Query: 180 NTGDTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTI 239
             G+  NW   +VYPGHEYT  NV FIR ++Y +  DN+  +KLE F K HEVTTG FT+
Sbjct: 180 GVGE-PNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTL 238

Query: 240 ADELSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279
            DEL FNPFMRLDDPIVR+ VGD++  W R++VM+ LR M
Sbjct: 239 DDELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKM 278

>YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 bp,
           285 aa]
          Length = 285

 Score =  358 bits (918), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 169/278 (60%), Positives = 209/278 (75%), Gaps = 4/278 (1%)

Query: 4   QSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEAL 63
           Q IR MHVK IKMRWLTGGVNYSYLLST+D++ SWLIDPAE LEV   L ++E KSI+A+
Sbjct: 6   QQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAI 65

Query: 64  VNTHHHYDHAGGNVSTLAALNEK--GNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKIL 121
           VNTHHHYDH+GGN++  + L ++  G++I ++I GS+ SP   ++PDNL +Y LGNL++ 
Sbjct: 66  VNTHHHYDHSGGNLALYSILCQENSGHDI-KIIGGSKSSPGVTEVPDNLQQYHLGNLRVT 124

Query: 122 CIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNT 181
           CIRTPCHT+DS CYY++D ET EQ IFTGDTLF  GCGRFFEGT  +MD ALN  +L   
Sbjct: 125 CIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAV 184

Query: 182 GDTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIAD 241
           G+T NW  VK+YPGHEYT GNVSFIR  IY     N  F+ LE + K +E TTGHFT+ D
Sbjct: 185 GET-NWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRD 243

Query: 242 ELSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279
           EL +NPFMRLDD  VR  VGD+ G + R+ VM +LR +
Sbjct: 244 ELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281

>CAGL0I00924g complement(75399..76223) similar to sp|Q05584
           Saccharomyces cerevisiae YDR272w GLO2 glyoxalase II,
           start by similarity
          Length = 274

 Score =  348 bits (892), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 168/271 (61%), Positives = 192/271 (70%), Gaps = 1/271 (0%)

Query: 9   MHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEALVNTHH 68
           MHVK IKMRW TGGVNYSYL+S QD+  SWLIDPAE  EV  +L   E +S+ ALVNTHH
Sbjct: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60

Query: 69  HYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKILCIRTPCH 128
           HYDHAGGN S L    E      +VI GS+       IP +  +  +GNL + CIRTPCH
Sbjct: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPCH 120

Query: 129 TQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTGDTSNWK 188
           TQDS CYY+RDPET E+ IFTGDTLFT GCGRFFEGT EEMD ALN  +L   G  +NW 
Sbjct: 121 TQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGK-NNWS 179

Query: 189 NVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADELSFNPF 248
           +  VYPGHEYT  NV F+R+ IY   + N  F++LE F  EHEVTTG FT+ADEL FNPF
Sbjct: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239

Query: 249 MRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279
           M+LDDPIVR  VGDS+  WT A VMDKLR M
Sbjct: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270

>YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825
           bp, 274 aa]
          Length = 274

 Score =  333 bits (854), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 193/273 (70%), Gaps = 5/273 (1%)

Query: 9   MHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEALVNTHH 68
           M VK+IKMRW +GGVNY YLLS    KKSWLIDPAE  EV+ +L  DE  S+EA+VNTHH
Sbjct: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60

Query: 69  HYDHAGGNVSTLAALNEKGNNISRV--IAGSQRSPIANDIPDNLHEYTLGNLKILCIRTP 126
           HYDHA GN   L  L EK N  S+V  I GS+  P    IP+NL +  LG+L+I CIRTP
Sbjct: 61  HYDHADGNADILKYLKEK-NPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTP 119

Query: 127 CHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTGDTSN 186
           CHT+DS CYYV+DP T E+ IFTGDTLFT GCGRFFEGT EEMD ALN  +L   G   N
Sbjct: 120 CHTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVG-RQN 178

Query: 187 WKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADELSFN 246
           W   +VYPGHEYT+ NV F+R  IY +  +N   ++LE F  +HEVT G FT+ DE+ FN
Sbjct: 179 WSKTRVYPGHEYTSDNVKFVRK-IYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFN 237

Query: 247 PFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279
           PFMRL+DP V++  GD+   W RAQ+MDKLR M
Sbjct: 238 PFMRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 31.2 bits (69), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 65/171 (38%), Gaps = 16/171 (9%)

Query: 120 ILCIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLG 179
           +L   T   T D  C  ++DPE  E  +     +  G    F E       + +  R++ 
Sbjct: 69  LLKTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITGFMESMLIIPFENIKTRMIE 128

Query: 180 NTGDTSNWKNVKVYPGHEYTAGNVSF--------IRNYIY--LKKSDNDHFNKLESFTKE 229
           N    SN    +V  G +    + S         IR  +Y  +KK  N  + K   +  E
Sbjct: 129 NALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQVKKEINPRYEKFLYY--E 186

Query: 230 HEVTTGHFTIADEL----SFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKL 276
              +T  FT   E+     F  F +   P + RQVG+S   +T    + ++
Sbjct: 187 KHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQM 237

>CAGL0G07172g complement(678730..681330) some similarities with
           YALI0E14399g Yarrowia lipolytica, hypothetical start
          Length = 866

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 167 EEMDDALNFRLLGNTGDTSNWKNVKV---YPGHEYTAGNVSFIRNYIYLKKSDNDHFNKL 223
           +E  +AL  ++     D +  K +K    Y  H Y  G+   +   +Y K    D +N+L
Sbjct: 673 QEAQEALYLKIKQKIADQNAAKALKNNVNYQTHAYQPGDQVVVHQSVY-KPPKRDEYNQL 731

Query: 224 ESFTKE-HEVTTGHFTI 239
           +  +K+ H V  G FTI
Sbjct: 732 KQISKKPHYVWYGPFTI 748

>Kwal_55.20793
          Length = 520

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 17/109 (15%)

Query: 150 GDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTGDTSNWKN------VKVYPGHEYTAGNV 203
           G T+ TG  G +   + E +       L+G  G++S W N      V V    E +    
Sbjct: 402 GRTIVTGRTGHWLNHSKEHL-------LVGIKGNSS-WLNRQSDIDVIVSASRETSRKPD 453

Query: 204 SFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADELSFNPFMRLD 252
                Y  +++    H  KLE F ++H    G FTI ++LS +  +  D
Sbjct: 454 EL---YGMIERLVGPHARKLEIFGRDHNTRPGWFTIGNQLSGDCVLEPD 499

>YML049C (RSE1) [3921] chr13 complement(174220..178305) U2
           snRNP-associated protein involved in pre-mRNA splicing,
           indirectly involved in ER to Golgi transport [4086 bp,
           1361 aa]
          Length = 1361

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 5   SIRKMHVKAIKMRWLTGGVNYSYLLSTQ---DKKKSWLI-DPAET 45
           SI   H    K+  LT  VNYS L+ST    +  K WLI DPA T
Sbjct: 499 SIATKHFTNNKIITLTNAVNYSNLISTSLPPNATKLWLIPDPATT 543

>AFR173W [3365] [Homologous to ScYGL192W (IME4) - SH]
           complement(756263..757942) [1680 bp, 559 aa]
          Length = 559

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 219 HFNKLESFTKEHEVTTGHFTIADELSFNPFMRLD 252
           H  KLE F ++H V  G FTI ++L+      LD
Sbjct: 460 HARKLEIFGRDHNVRPGWFTIGNQLTGTCIHELD 493

>YGL192W (IME4) [1801] chr7 (142250..144052) Positive transcription
           factor for IME1 and IME2, mediates control of meiosis by
           carrying signals regarding mating type (a/alpha) and
           nutritional status, might act as a methyltransferase
           that modifies mRNA [1803 bp, 600 aa]
          Length = 600

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 219 HFNKLESFTKEHEVTTGHFTIADELSFNPFMRLD 252
           H  KLE F ++H    G FTI ++L+ N    +D
Sbjct: 481 HARKLEIFGRDHNTRPGWFTIGNQLTGNCIYEMD 514

>Kwal_14.1591
          Length = 640

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 110 LHEYTLGNLKILCIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEM 169
           L +Y  G  K+L I  P H +D T Y   + ET  Q ++T D L      +  E    + 
Sbjct: 489 LKDYVNG--KLLYINPPPHLEDDTPYTREECETFNQDLYTFDKLPATRQEQLAEAAKNKN 546

Query: 170 DDALNF-RLLG 179
            D+L+  R LG
Sbjct: 547 IDSLDLARDLG 557

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,927,064
Number of extensions: 449831
Number of successful extensions: 1252
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1239
Number of HSP's successfully gapped: 24
Length of query: 279
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 179
Effective length of database: 13,134,309
Effective search space: 2351041311
Effective search space used: 2351041311
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)