Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F15994g42742019210.0
Kwal_55.215874644305381e-63
YOR042W (CUE5)4113084922e-57
CAGL0L09933g4083624694e-54
Scas_699.454503844612e-52
ACR083C3752503503e-37
YDR273W (DON1)365541563e-11
CAGL0M08580g197531081e-05
Scas_615.8d581371041e-04
Scas_686.929345691.5
ACL137C477108691.6
Kwal_14.209636352663.3
Kwal_27.9900500108663.7
CAGL0L12012g29331637.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F15994g
         (420 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...   744   0.0  
Kwal_55.21587                                                         211   1e-63
YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...   194   2e-57
CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...   185   4e-54
Scas_699.45                                                           182   2e-52
ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...   139   3e-37
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    65   3e-11
CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...    46   1e-05
Scas_615.8d                                                            45   1e-04
Scas_686.9                                                             31   1.5  
ACL137C [912] [Homologous to ScYGR211W (ZPR1) - SH] (111653..113...    31   1.6  
Kwal_14.2096                                                           30   3.3  
Kwal_27.9900                                                           30   3.7  
CAGL0L12012g complement(1290397..1291278) similar to sp|P32643 S...    29   7.9  

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/420 (92%), Positives = 387/420 (92%)

Query: 1   MSDKVEDVAIDVDSNEDKKIEDVKETVEEAATKASNVEAEVPADTETETENVKKAEKXXX 60
           MSDKVEDVAIDVDSNEDKKIEDVKETVEEAATKASNVEAEVPADTETETENVKKAEK   
Sbjct: 1   MSDKVEDVAIDVDSNEDKKIEDVKETVEEAATKASNVEAEVPADTETETENVKKAEKQEE 60

Query: 61  XXXXXXXXXXXSAPPLPVRKSVSPEEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQ 120
                      SAPPLPVRKSVSPEEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQ
Sbjct: 61  GQDHGQEDEDDSAPPLPVRKSVSPEEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQ 120

Query: 121 LDPAFNALLFISDPDFEKEAPLPTRPVQAPTRGVRREPKTQLEQDEELARQLDKKFNKHG 180
           LDPAFNALLFISDPDFEKEAPLPTRPVQAPTRGVRREPKTQLEQDEELARQLDKKFNKHG
Sbjct: 121 LDPAFNALLFISDPDFEKEAPLPTRPVQAPTRGVRREPKTQLEQDEELARQLDKKFNKHG 180

Query: 181 NSASXXXXXXXXXXXXXXXXXXXYGAGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKEL 240
           NSAS                   YGAGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKEL
Sbjct: 181 NSASERTARERRIRQRERDYERRYGAGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKEL 240

Query: 241 PQIRENLNRNIQETGKKISTWFSGITKNLVDDDPNYSESRPKYSQSRFNSFGDRYRDGND 300
           PQIRENLNRNIQETGKKISTWFSGITKNLVDDDPNYSESRPKYSQSRFNSFGDRYRDGND
Sbjct: 241 PQIRENLNRNIQETGKKISTWFSGITKNLVDDDPNYSESRPKYSQSRFNSFGDRYRDGND 300

Query: 301 NVDGQTKLQNAGISLHNDDLDFGSDDDIPPQLPSRAKKVVAETTYIDTPEQVRGKNNRSP 360
           NVDGQTKLQNAGISLHNDDLDFGSDDDIPPQLPSRAKKVVAETTYIDTPEQVRGKNNRSP
Sbjct: 301 NVDGQTKLQNAGISLHNDDLDFGSDDDIPPQLPSRAKKVVAETTYIDTPEQVRGKNNRSP 360

Query: 361 LKTLAPHSESPTRSTPTSKLNTSTDKTASTEEKSDVKLVTPTASNKNTEGPITLEDQDII 420
           LKTLAPHSESPTRSTPTSKLNTSTDKTASTEEKSDVKLVTPTASNKNTEGPITLEDQDII
Sbjct: 361 LKTLAPHSESPTRSTPTSKLNTSTDKTASTEEKSDVKLVTPTASNKNTEGPITLEDQDII 420

>Kwal_55.21587
          Length = 464

 Score =  211 bits (538), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 164/430 (38%), Positives = 218/430 (50%), Gaps = 74/430 (17%)

Query: 17  DKKIE---DVKETVEEAATKASN-VEAEVPADTETETENVKKAEKXXXXXXXXXXXXXXS 72
           DK +E    VKET E A +KA++ +E E P   ET  +  ++ EK              +
Sbjct: 29  DKAVEADLKVKETPESADSKAADEIELEKPEPKETPDKPQEETEKSATEANEPQENTKEA 88

Query: 73  A---------PPLPVRKSVSPEEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDP 123
                     P LP RK+ +   Q+  ENP+L QL EAFP I+ KYVKAVLIASQG LDP
Sbjct: 89  PVAPNDEEVRPALPKRKTST---QNVHENPILAQLTEAFPGIDAKYVKAVLIASQGALDP 145

Query: 124 AFNALLFISDPDFEKEAPLPTRPVQAPTRGVRREPK--TQLEQDEELARQLDKKFNK-HG 180
           AFNALLF+SDP FE EA +PT   Q+   G  R P   +QL+QDE LARQLD +FNK H 
Sbjct: 146 AFNALLFLSDPSFEAEATVPTAVPQSSQSGNSRSPTAVSQLQQDEILARQLDAQFNKGHA 205

Query: 181 NSASXXXX--------XXXXXXXXXXXXXXXYGAGAIPPKGRRDSDGYDNFEDDGEDDVF 232
              +                           +GAG + P+ +R  +  +  ED  ++D  
Sbjct: 206 RRGAPRSMDDERRARERRIRERQREFERRTAHGAGPLSPEEQRRYERME-AEDQEDNDFL 264

Query: 233 SNFVDKELPQIRENLNRNIQETGKKISTWFSGITKNLVDDD---------PNYSE----- 278
           S  VDK+LP++RE + R +QETG+K++ W SG  KN   D          P +S+     
Sbjct: 265 SQLVDKDLPELREKVGRQVQETGRKVNDWLSGFRKNWAQDQSSQQQSSQYPEFSDRQQSQ 324

Query: 279 -----------------SRPKYSQSRFNSFGDRYRDGNDNVDGQTKLQNAGISLHN---D 318
                            +RP++  +RFNSFG +   G+D+     KL + GISL+N    
Sbjct: 325 RRDTSSRRSSDSEFEDYTRPEHRTARFNSFGAKV--GDDSTTSSAKLASHGISLYNKGDK 382

Query: 319 DLDFGSDDDIPPQLPSR--AKKVVAETTYIDTPEQVRGKNNRSPLKTLAPHSESPTRSTP 376
           D++  SD DI PQLPSR  AK +  ETTYIDTPE       R   + L P    P   TP
Sbjct: 383 DVEDESDADIAPQLPSRNKAKDIQPETTYIDTPE----AGTRKKWQPLPPE---PINVTP 435

Query: 377 TSKLNTSTDK 386
            SK+N +  K
Sbjct: 436 -SKVNATASK 444

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score =  194 bits (492), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 128/308 (41%), Positives = 172/308 (55%), Gaps = 55/308 (17%)

Query: 74  PPLPVRKSVSPEEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISD 133
           PPLP R+    EE+  KENP+L++LK+AFPN+EEKY+KAV+IASQG L PAFNALLF+SD
Sbjct: 83  PPLPARRKS--EEEPSKENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSD 140

Query: 134 PDFEKEAPLPTRPVQAPTRGVRREPKTQLEQDEELARQLDKKFNKHGNSASXXXXXXXXX 193
           P+  K+  LPT+PV+       R  +TQLEQDE LARQLD++FN   +S S         
Sbjct: 141 PESGKDIELPTQPVRKNPEAPARRRQTQLEQDELLARQLDEQFN---SSHSRRRNRDRAT 197

Query: 194 XXXXXXXXXXYGAGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQIRENLNRNIQE 253
                     +      P  R       + ED  E+D +S FV+K+LP++ +   R++Q+
Sbjct: 198 RSMHEQRRRRHN-----PNERE-----QHHEDSEEEDSWSQFVEKDLPELTDRAGRSLQD 247

Query: 254 TGKKISTWF---------SGITKN---------------LVDDDPNYSESRPKY-SQSRF 288
           T  K+S W          SG  +N               +VD       SRP+   + RF
Sbjct: 248 TANKVSNWISDAYRRNFASGNEQNDNQHGHQDQQEWEPEIVDLSQGGKNSRPQQPERRRF 307

Query: 289 NSFGDRYRDGNDNVDGQTKLQNAGISLHNDDLDFGSDDDIPPQLPSRAK------KVVAE 342
           NSFG +         G   L++ GI+LHN+D  F  D+D+PPQLP+R K      KVVAE
Sbjct: 308 NSFGVQV--------GDDSLESHGITLHNED-GFEDDEDVPPQLPTRTKSGESTGKVVAE 358

Query: 343 TTYIDTPE 350
           TTYIDTP+
Sbjct: 359 TTYIDTPD 366

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score =  185 bits (469), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 184/362 (50%), Gaps = 100/362 (27%)

Query: 91  ENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPLPTRPVQA- 149
           ENP+L QLKEAFPNIEE+YVKAV+IASQG LDPAFNALLF+SDP+  K+  LP  PVQ  
Sbjct: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135

Query: 150 PTRGVRREPKTQLEQDEELARQLDKKFNKHGNSASXXXXXXXXXXXXXXXXXXXYGAGAI 209
           P+   RR+ +TQLEQDE LARQLDK++N+                           AG  
Sbjct: 136 PSLPPRRK-QTQLEQDEMLARQLDKEYNRKRRGERRHHNERE--------------AG-- 178

Query: 210 PPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQIRENLNRNIQETGKKISTWFSGITKNL 269
                R+ + Y+N  DD E+D +S FV+K+LP+I      ++QET  K+ TWF+G+ KN 
Sbjct: 179 -----RNYERYNN--DDLEEDSWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNF 231

Query: 270 V------------------DDDPNYS------ESR-------PKY---------SQSRFN 289
           +                  D D +Y       E R       P Y         ++ RFN
Sbjct: 232 IGEGEENDSAYYQDDSHGRDLDEDYGTYVEQQERRQRRGVQDPGYRRGDEQRLNARHRFN 291

Query: 290 SFGDRYRDGNDNVDGQTKLQNAGISLHNDDLDFGSDDDIPPQLPSRAK------------ 337
           SFG       D+V+G       GISL +++     D+++PPQLPSRA+            
Sbjct: 292 SFG---ASATDDVEG-------GISLRDEEFGEDEDEEVPPQLPSRARSNDSKKDSEEVK 341

Query: 338 -------KVVAETTYIDTPEQVRGKNNRSPLKTLAPHSESPTRSTPTSKLNTSTDKTAST 390
                  KVVAETTYIDTPE     N     +   P    P  +TPT K+N ST K  + 
Sbjct: 342 PQEGKKDKVVAETTYIDTPE-----NKEKTKRKWQPLPPEPLNATPT-KVNASTKKNKNE 395

Query: 391 EE 392
            E
Sbjct: 396 SE 397

>Scas_699.45
          Length = 450

 Score =  182 bits (461), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/384 (35%), Positives = 187/384 (48%), Gaps = 122/384 (31%)

Query: 73  APPLPVRKSVSPEEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFIS 132
            PPLP R+   PE + E ENP+LKQLKEAFPNIEEKYVK VLIASQG LDPAF ALLF+S
Sbjct: 94  GPPLPTRRKTEPEAE-ESENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLS 152

Query: 133 DPDFEKEAPLPTRPVQA---PTRGVRREPKTQLEQDEELARQLDKKFNKHGNSASXXXXX 189
           DP+  K+  LPT+P+ A   P    RR+  TQLEQD  LARQL++++NK  +        
Sbjct: 153 DPNSSKDIELPTKPIAANATPALPQRRK-LTQLEQDALLARQLNEEYNKAHD-------- 203

Query: 190 XXXXXXXXXXXXXXYGAGAIPPKGRRDSDGY---------------DNFEDDGEDDVFSN 234
                               PP+G    +G                D+ +   EDD ++ 
Sbjct: 204 --------------------PPRGAVRDNGRRTRPQQQRRQRTANDDDLDFSQEDDSWAQ 243

Query: 235 FVDKELPQIRENLNRNIQETGKKISTWFSGITKNLV-DDDPN---------------YSE 278
           FV+K+LP I      ++QET  K+ +WFS   KN++ ++DPN               +++
Sbjct: 244 FVEKDLPDITARAKGSLQETAMKVGSWFS---KNVIGEEDPNQPQPQGMNNRNGNSDFTD 300

Query: 279 SRPKYSQS------------------RFNSFGDRYRDGNDNVDGQTKLQNAGISLHNDDL 320
            + K  Q                   RFNSFG +         G+  L++ GI+LH+++ 
Sbjct: 301 EQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQV--------GEDSLESHGIALHDNEN 352

Query: 321 DFGSDDDIPPQLPSRAK---------------------KVVAETTYIDTPEQVRGKNNRS 359
               D+D+PPQLP+R K                     KVVA+TT+IDTPE        S
Sbjct: 353 LSDEDEDVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDTPE-------GS 405

Query: 360 PLKTLAPHSESPTRSTPTSKLNTS 383
                 P +  P   TPT K+N S
Sbjct: 406 AKPKWQPVAPEPLNGTPT-KINAS 428

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/250 (40%), Positives = 134/250 (53%), Gaps = 39/250 (15%)

Query: 90  KENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPLPTRPVQA 149
           KEN +L +LK AFPN+EEK VKAV+IASQG LDPAF+ALLF+SDP FE+EA LPT+   A
Sbjct: 98  KENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEAALPTQAAPA 157

Query: 150 PTRGVRREPKTQLEQDEELARQLDKKFNKHGNSASXXXXXXXXXXXXXXXXXXXYGAGAI 209
               V   P +QL+QDE LARQLD++FNK    A                          
Sbjct: 158 AQATV---PISQLQQDEMLARQLDEQFNKKDLRAERAARERRIREREEEFQRKQQ----- 209

Query: 210 PPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQIRENLNRNIQETGKKISTWFSGITKNL 269
             + R +  GY + +D+       +F+D         LNR +QET KK+  W+ GI KN 
Sbjct: 210 --RLRSEYGGYGSEDDE-------DFIDV--------LNRGLQETSKKVGKWWDGIKKNF 252

Query: 270 VDD----DPNYSESRPKYSQSRFNSFGDRYRDGNDNVDGQTKLQNAGISLHNDDLDFGSD 325
            ++    D   S   P+  Q RFNSFG R     D+    T+ Q  G+SLH++      D
Sbjct: 253 NEELDGPDARASAGPPRARQQRFNSFGAR-----DDETYPTEQQLRGVSLHDE-----HD 302

Query: 326 DDIPPQLPSR 335
           D+  P+LP R
Sbjct: 303 DEPAPRLPPR 312

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 41/54 (75%)

Query: 94  MLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPLPTRPV 147
           +LK+LK AFP +++  +KA+LIASQG L+PAFN+LL+ S P+   +  LP +P+
Sbjct: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEENTDFALPMKPI 139

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 37/53 (69%)

Query: 90  KENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISDPDFEKEAPL 142
           ++N   ++L +AFP +++  ++A+L+A++G L PAFNALL ++  D +   P+
Sbjct: 26  EQNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSLTGEDIQLGLPM 78

>Scas_615.8d
          Length = 581

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 31/37 (83%)

Query: 97  QLKEAFPNIEEKYVKAVLIASQGQLDPAFNALLFISD 133
           +L +AFP+++   +K++L AS+G++ PAF+ALLF+++
Sbjct: 286 ELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTN 322

>Scas_686.9
          Length = 293

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 5/45 (11%)

Query: 242 QIRENLNRNIQETGKKISTWFSGITKNLVDDDPNYSESRPKYSQS 286
           QI+EN    ++ETG KI   +S +T  L+ DDP+  +S  K SQ+
Sbjct: 64  QIQENFGEFMKETGMKI---YSRVT--LIIDDPSKGQSLSKISQA 103

>ACL137C [912] [Homologous to ScYGR211W (ZPR1) - SH]
           (111653..113086) [1434 bp, 477 aa]
          Length = 477

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 52/108 (48%), Gaps = 11/108 (10%)

Query: 206 AGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQIRENLNRNIQETGKKISTWFSGI 265
            GAIP KGR+ +   D+ ED   D + S      +P++  ++ +     G K +T   G+
Sbjct: 326 GGAIPDKGRKITLICDDAEDLSRDILKSETCSVSIPELHLDIQQGT--LGGKFTT-LEGL 382

Query: 266 TKNLVDDDPN-----YSESRPKYSQSRFNSFGDRYRDGNDNVDGQTKL 308
              + ++  +      S+S  + +++R+ SF  + R+    +DG+ K 
Sbjct: 383 LTQVYEELESRVFTQTSDSMDEATRNRWTSFFSKLREA---IDGKIKF 427

>Kwal_14.2096
          Length = 363

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 225 DDGEDDVFSNFVDKELPQIRENLNRNIQETGKKISTWFSGITKNLVDDDPNY 276
           D GE++ +S  +  +   I   + +N+Q+T  ++  +  GI   L+ DDP Y
Sbjct: 241 DSGEEECYSIMLRTDYKDILAEIRKNLQKT-DQLFVFLDGIAPFLILDDPVY 291

>Kwal_27.9900
          Length = 500

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 52/108 (48%), Gaps = 11/108 (10%)

Query: 206 AGAIPPKGRRDSDGYDNFEDDGEDDVFSNFVDKELPQIRENLNRNIQETGKKISTWFSGI 265
            GAIP KGR+ +   D+ ED   D + S      +P++  ++ +     G + +T   G+
Sbjct: 351 GGAIPEKGRKITLICDDPEDLSRDILKSETCSLNIPELHLDIQQGT--LGGRFTT-LEGL 407

Query: 266 TKNLVDDDPN-----YSESRPKYSQSRFNSFGDRYRDGNDNVDGQTKL 308
            + + D+  N      S+S  + +++R+ SF  R +     +DG+ K 
Sbjct: 408 LQQVRDELRNRVFTQTSDSMDEETKNRWESFFGRLQSA---LDGKVKF 452

>CAGL0L12012g complement(1290397..1291278) similar to sp|P32643
           Saccharomyces cerevisiae YER175c, start by similarity
          Length = 293

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 272 DDPNYSESRPKYSQSRFNSFGDRYRDGNDNV 302
           D   YS+SRP Y QS + +   RY  GN N+
Sbjct: 10  DSNRYSKSRPSYPQSFYEALS-RYHKGNRNI 39

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.305    0.126    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,606,931
Number of extensions: 696791
Number of successful extensions: 3366
Number of sequences better than 10.0: 148
Number of HSP's gapped: 3292
Number of HSP's successfully gapped: 168
Length of query: 420
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 316
Effective length of database: 12,995,837
Effective search space: 4106684492
Effective search space used: 4106684492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 63 (28.9 bits)