Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F15972g45845119040.0
Kwal_55.216004424519981e-132
ACR082C4224509491e-125
YOR043W (WHI2)4864789151e-119
Scas_699.465125058601e-110
Scas_615.84474767851e-100
Sklu_1533.11921864127e-48
KLLA0D12210g105679657.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F15972g
         (451 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F15972g complement(1481761..1483137) similar to sp|P12611 S...   738   0.0  
Kwal_55.21600                                                         389   e-132
ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH] (503954..50...   370   e-125
YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in...   357   e-119
Scas_699.46                                                           335   e-110
Scas_615.8                                                            306   e-100
Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement         163   7e-48
KLLA0D12210g 1037870..1041040 similar to sp|P06777 Saccharomyces...    30   7.1  

>KLLA0F15972g complement(1481761..1483137) similar to sp|P12611
           Saccharomyces cerevisiae YOR043w WHI2 growth regulation
           protein singleton, start by similarity
          Length = 458

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/451 (83%), Positives = 378/451 (83%)

Query: 1   MSQNQPQTQSIITQVTPDGGGASGALLGQDGSYIDYEQYNEEDTLIHLNIQEKHYYITRT 60
           MSQNQPQTQSIITQVTPDGGGASGALLGQDGSYIDYEQYNEEDTLIHLNIQEKHYYITRT
Sbjct: 1   MSQNQPQTQSIITQVTPDGGGASGALLGQDGSYIDYEQYNEEDTLIHLNIQEKHYYITRT 60

Query: 61  QXXXXXXXXXXXXXXXGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDY 120
           Q               GVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDY
Sbjct: 61  QLMSLPESLLLCLFPSGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDY 120

Query: 121 LNFPVNEIFNRKGTXXXXXXXXXXXXXXXXXXXXXXQESEILHEKPGIIVLREDLDYYCV 180
           LNFPVNEIFNRKGT                      QESEILHEKPGIIVLREDLDYYCV
Sbjct: 121 LNFPVNEIFNRKGTNGSSSGGNNFFNFGSSNNSSSSQESEILHEKPGIIVLREDLDYYCV 180

Query: 181 PQVSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQV 240
           PQVSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQV
Sbjct: 181 PQVSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQV 240

Query: 241 DGTKSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETTQ 300
           DGTKSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETTQ
Sbjct: 241 DGTKSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETTQ 300

Query: 301 EFRXXXXXXXXXXXXXQKSIASTMTNDTSSNMKLTPTPSRTDVKRKSRLSVFXXXXXXXX 360
           EFR             QKSIASTMTNDTSSNMKLTPTPSRTDVKRKSRLSVF        
Sbjct: 301 EFRDAVAVAKAKYDDDQKSIASTMTNDTSSNMKLTPTPSRTDVKRKSRLSVFSENVRSRS 360

Query: 361 XXXXXXXXXXXXXXXPTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFE 420
                          PTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFE
Sbjct: 361 RSRNRSASRQRANESPTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFE 420

Query: 421 NDTLTIFPDNSKIQKLKVPVKIHIRRVWTLE 451
           NDTLTIFPDNSKIQKLKVPVKIHIRRVWTLE
Sbjct: 421 NDTLTIFPDNSKIQKLKVPVKIHIRRVWTLE 451

>Kwal_55.21600
          Length = 442

 Score =  389 bits (998), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 220/451 (48%), Positives = 263/451 (58%), Gaps = 25/451 (5%)

Query: 9   QSIITQVTPDGGGASGALLGQDGSYIDYEQYNEEDTLIHLNIQEKHYYITRTQXXXXXXX 68
           QS+ITQV+ D G     +  Q+  ++D      +D+LIHLNIQE HYYITR Q       
Sbjct: 2   QSVITQVSADQGPIP-VMQEQNQEFLD------DDSLIHLNIQENHYYITRDQLMSLPES 54

Query: 69  XXXXXXXXGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLNFPVNEI 128
                   GVFM+R GQ+ITNLT  DEVYI NF   CFEYIM+ Y +A  D LNFPV+EI
Sbjct: 55  LLLCLFPSGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLLNFPVDEI 114

Query: 129 FNRK-GTXXXXXXXXXXXXXXXXXXXXXXQESEILHEKPGIIVLREDLDYYCVPQVSVEY 187
           F+R   +                       E+EILHEKP IIVLREDLDYYCVPQ+ + Y
Sbjct: 115 FDRGLSSPKEQSRFFGFPSSHSSMQNSSGGEAEILHEKPSIIVLREDLDYYCVPQMKLAY 174

Query: 188 PEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQVDGTKSST 247
           P  +    + ELL N M ++KLAAGS+L +QTSVF GL SSNR K+P K++  +  +   
Sbjct: 175 PPDTPQELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLCSSNRLKRPQKNSNGENKQ--- 231

Query: 248 GTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETTQEFRXXXX 307
              KLG AEQHLMDMLCSSGF   S WGNR+QE  KTVISSLSLCRLANETTQ+FR    
Sbjct: 232 ---KLGPAEQHLMDMLCSSGFHDSSTWGNRAQEPGKTVISSLSLCRLANETTQDFRDKVD 288

Query: 308 XXXXXXXXXQKSIASTMTNDTSSNMKLTPTPSRT------DVKRKSRLSVFXXXXXXXXX 361
                     KS+         S   LTP  SR+      D KRKSRLS           
Sbjct: 289 AAKRKHEDELKSLRGAQ----DSTYSLTPKGSRSSPSAQPDPKRKSRLSSLADNVRSRSA 344

Query: 362 XXXXXXXXXXXXXXPTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFEN 421
                         PTLYELVP+PDIN+KLLLFWKKPARKCWWG+E   LE+      ++
Sbjct: 345 SRNRSSSRQRVDQAPTLYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDS 404

Query: 422 DT-LTIFPDNSKIQKLKVPVKIHIRRVWTLE 451
            T   +   +  +  L VPVK+HIRRVWTLE
Sbjct: 405 STGELVLRQSGPVVSLSVPVKLHIRRVWTLE 435

>ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH]
           (503954..505222) [1269 bp, 422 aa]
          Length = 422

 Score =  370 bits (949), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/450 (47%), Positives = 261/450 (58%), Gaps = 42/450 (9%)

Query: 7   QTQSIITQVTPDGGGASGALLGQDGSYIDYEQ----YNEEDTLIHLNIQEKHYYITRTQX 62
           Q QSIITQV+P+        LG  GS +  EQ    Y +E+TLIHLNIQ +HYYITR Q 
Sbjct: 3   QPQSIITQVSPE------QQLG--GSQLMTEQIEPDYYDENTLIHLNIQGRHYYITREQL 54

Query: 63  XXXXXXXXXXXXXXGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLN 122
                         GVFM+R+GQ+ITNLTP+DEVYI NF  +CFE IM+ Y  A  D  N
Sbjct: 55  MSLPESLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLEN 114

Query: 123 FPVNEIFNRKGTXXXXXXXXXXXXXXXXXXXXXXQESEILHEKPGIIVLREDLDYYCVPQ 182
           FPV E F R+                         ES+ILHEKP IIVLREDLDYYCVP 
Sbjct: 115 FPVGE-FGRRAPHAGPKGFLGLTPSQSQPMS----ESQILHEKPAIIVLREDLDYYCVPS 169

Query: 183 VSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQVDG 242
           VS+   +GS +  ++ LL  LM Q+K AAGSHL +Q SVF GL SSNR ++P   +Q D 
Sbjct: 170 VSLALEDGSRE-GQDILLEQLMAQVKNAAGSHLCQQRSVFKGLYSSNRVRRPDAQHQPD- 227

Query: 243 TKSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETTQEF 302
                   +LG AEQHLMDMLC+SGF+  S WGNRSQE  KTVISSLSLCRL NET QEF
Sbjct: 228 --------QLGPAEQHLMDMLCASGFREHSDWGNRSQEPGKTVISSLSLCRLMNETVQEF 279

Query: 303 RXXXXXXXXXXXXXQKSIASTMTNDTSSNMKLTPTPSRTDVKRKSRLSVFXXXXXXXXXX 362
           R             Q + A    ++          P   D KRKSRLS F          
Sbjct: 280 R------------DQVAAARRRYDEDHVTPDAASAPPSRDQKRKSRLSTF--TDNVRSRS 325

Query: 363 XXXXXXXXXXXXXPTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFEND 422
                        P+LY+LVP+P+INTKLLLFWKKPARKCWWG E + ++V     ++++
Sbjct: 326 SSRTRSSSRAPREPSLYDLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHYDSE 385

Query: 423 TLT-IFPDNSKIQKLKVPVKIHIRRVWTLE 451
           + T +   NS +  L +PV +HIRRVWTLE
Sbjct: 386 SGTLVLSRNSPLCVLTIPVNLHIRRVWTLE 415

>YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in
           growth regulation and stress response [1461 bp, 486 aa]
          Length = 486

 Score =  357 bits (915), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/478 (43%), Positives = 274/478 (57%), Gaps = 39/478 (8%)

Query: 11  IITQVTPDGGGASGALLGQDGSYIDYEQYNEED---TLIHLNIQEKHYYITRTQXXXXXX 67
           IITQV+PD   ++  L  Q        + NEED   +LIHLNIQE HY+ITR Q      
Sbjct: 4   IITQVSPDNAESAPILQEQQQQQNSQYEGNEEDYGDSLIHLNIQENHYFITRDQLMSLPE 63

Query: 68  XXXXXXXXXGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLNFPVNE 127
                    GVF+DR GQ+ITNLT DDEVYI NF  +CFEYIM++Y +AH D  N PV +
Sbjct: 64  SLLLCLFPSGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLYNHPVEK 123

Query: 128 IFNRKGTXXXXXXXXXXXXXXXXXXXXXXQESEILHEKPGIIVLREDLDYYCVPQVSVEY 187
            F+R  +                       E +ILH+KP IIVLREDLDYYCVPQ   ++
Sbjct: 124 FFDRPSS-SFVSNAKGFFGLSSNNSISSNNEQDILHQKPAIIVLREDLDYYCVPQEEFQF 182

Query: 188 PEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSNQVDG----- 242
            + +++   E+LL + M Q+K+AAGS+L  +TS+F GL SSNR K+  +  +++      
Sbjct: 183 -DSTNEENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGLYSSNRLKQQQQQQKIEKGSNSS 241

Query: 243 TKSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETTQEF 302
           + + + + KLG AEQHLMDMLCSSGF  E+ WGNR+QE  KTVISSLSLCRLANETT+ F
Sbjct: 242 SNTKSTSKKLGPAEQHLMDMLCSSGFTKETCWGNRTQETGKTVISSLSLCRLANETTEGF 301

Query: 303 RXXXXXXXXXXXXXQK-----------------SIASTMTNDTSSNMK-LTP---TPSRT 341
           R              K                 S++++ +N T S  + LT     P+  
Sbjct: 302 RQKFNEAKAKWEAEHKPSQDNFITPMQSNISINSLSASKSNSTISTARNLTSGSTAPATA 361

Query: 342 DVKRKSRLSVFXXXXXXXXXXXXXXXXXXXXXXXPTLYELVPKPDINTKLLLFWKKPARK 401
             KRKSRLS                         P LY+LVPKP+IN KLLLFW+KPARK
Sbjct: 362 RDKRKSRLSKLADNVRSHSSSRHSSQTRSKPPELPKLYDLVPKPNINAKLLLFWRKPARK 421

Query: 402 CWWGQELVDLEVDFPAIFENDTLT----IFPDN----SKIQKLKVPVKIHIRRVWTLE 451
           CWWG+E ++LEV+    +++++      I P N    +++ K+ VPV++HIRRVWTLE
Sbjct: 422 CWWGEEDIELEVEVFGSWKDESKKIIELILPTNVDPEAELHKIIVPVRLHIRRVWTLE 479

>Scas_699.46
          Length = 512

 Score =  335 bits (860), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/505 (40%), Positives = 275/505 (54%), Gaps = 63/505 (12%)

Query: 9   QSIITQVTPDGG----GASGALLGQDGSYIDYEQYNEE--DTLIHLNIQEKHYYITRTQX 62
           Q+IITQV  +      G       Q+ S+ D +  ++E  D+LIHLNIQE HY+ITR Q 
Sbjct: 2   QNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQL 61

Query: 63  XXXXXXXXXXXXXXGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLN 122
                         GVF+DR GQ+I+NL+PDDEVYI NF  +CFEYIM+VY +A  D LN
Sbjct: 62  MSLPESLLLCLFPSGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLLN 121

Query: 123 FPVNEIFNRK---------------GTXXXXXXXXXXXXXXXXXXXXXXQESEILHEKPG 167
           +PV + F++                G+                       E ++LH+KP 
Sbjct: 122 YPVEKYFDKASNHKLINSAKGFFGFGSSNSLSNVNSNTSSGTAASTTTTSEHDLLHQKPA 181

Query: 168 IIVLREDLDYYCVPQVSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKS 227
           IIVLREDLDYYCVPQ + ++ +  S    ++LLH  M Q+K+AAGS+L K+TS+F GL S
Sbjct: 182 IIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLFS 241

Query: 228 SNRAKKP-TKSNQVDGTKSSTGTV--KLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKT 284
           SNR K    K++Q +  K+S  +   KLG AEQHLMDMLCSSGF   S+WGNR+QE  KT
Sbjct: 242 SNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGKT 301

Query: 285 VISSLSLCRLANETTQEFRXXXXXXXXXXXXXQKSIASTMTNDTSS------NMKLTPTP 338
           VISSL+LCRLANE+TQEFR             + ++     +D SS      N   +  P
Sbjct: 302 VISSLALCRLANESTQEFR-DMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVP 360

Query: 339 SRT--------------------DVKRKSRLSVFXXXXXXXXXXXXXXXXXXXXXXX--- 375
           SR+                    + ++K+RL+                            
Sbjct: 361 SRSSTSVNIASNSNSSSKQSGPRESRKKNRLATLADNVRSHSTSRNSSLTRLRSSKSLEL 420

Query: 376 PTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFENDTLTI----FPDNS 431
           P LY+LVPKPDIN KLLLFW+KPARKCWWG+E +++E++    + +    I     P   
Sbjct: 421 PKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLPHED 480

Query: 432 K-----IQKLKVPVKIHIRRVWTLE 451
           K     + K+++PV++HIRRVWTLE
Sbjct: 481 KDIEQQLNKIRIPVRLHIRRVWTLE 505

>Scas_615.8
          Length = 447

 Score =  306 bits (785), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 195/476 (40%), Positives = 251/476 (52%), Gaps = 70/476 (14%)

Query: 9   QSIITQVTPDGGGASGALLGQDG-SYIDYEQYNEEDTLIHLNIQEKHYYITRTQXXXXXX 67
           ++IITQV P  G      + Q G    D   Y+  ++L+HLNIQE HY++TR Q      
Sbjct: 2   ENIITQV-PQNGAVPNGFINQSGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQLMTLPE 60

Query: 68  XXXXXXXXXGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLNFPVNE 127
                    GVF+DR  Q+ITNLT +DEV+I NF   CFEYIM+ Y +A+ D LNFPV E
Sbjct: 61  SLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLLNFPVLE 120

Query: 128 IFNRKGTXXXXXXXXXXXXXXXXXXXXXXQESEILHEKPGIIVLREDLDYYCVPQVSVEY 187
            F                           ++  ILHE P IIVLREDLDYYCVPQ+  E+
Sbjct: 121 QF------PSIRNANNHTRYQHPQTQQQFEQDAILHENPSIIVLREDLDYYCVPQLEFEF 174

Query: 188 ---PEGSSDME---KEELLHNLMVQIKLAAGSHLLKQTSVFLGLKSSNRAKKPTKSN-QV 240
              PEG   ++   K++LL + M Q+K+AAGS+LL QTS+F GL  SN+  +   S   +
Sbjct: 175 EPLPEGRPPLDQYMKDDLLQHCMSQLKVAAGSYLLNQTSIFQGLYLSNKIHQHEVSQVPL 234

Query: 241 DGT-KSSTGTVKLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKTVISSLSLCRLANETT 299
            G+ KSST    LG AEQHLMDMLCSSGF  ES WGNR+QE  KT+ISSLSLCRL NE+T
Sbjct: 235 HGSGKSST----LGPAEQHLMDMLCSSGFLPESQWGNRTQEFGKTIISSLSLCRLYNEST 290

Query: 300 QEFRXXXXXXXXXXXXXQKSIASTMTN-----DTSSNMKLTPTP------SRTDVKRKSR 348
           ++FR               ++   M N     D++   K    P      S  ++    R
Sbjct: 291 EDFR--------------NAVTREMKNWKKNKDSNDGTKRFSMPIMEDGNSGRNIDDNVR 336

Query: 349 LSVFXXXXXXXXXXXXXXXXXXXXXXXPTLYELVPKPDINTKLLLFWKKPARKCWWGQEL 408
            SV                          +Y+LVPKP IN KLLLFW+KPARK WW  E 
Sbjct: 337 NSVMIADDININSMPD------------DVYKLVPKPTINNKLLLFWRKPARKSWWSAEN 384

Query: 409 VDLEVDFPAIF------ENDTLTIFPDNSKIQK-------LKVPVKIHIRRVWTLE 451
           V+LEV+               L +  +N+           +K+P+K+HIRRVWTLE
Sbjct: 385 VELEVEIYGSIVNVNGVNKVVLRVPQENANANDNEFVTNTVKIPIKLHIRRVWTLE 440

>Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement
          Length = 192

 Score =  163 bits (412), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 87/186 (46%), Positives = 113/186 (60%), Gaps = 6/186 (3%)

Query: 37  EQYNEEDTLIHLNIQEKHYYITRTQXXXXXXXXXXXXXXXGVFMDRDGQIITNLTPDDEV 96
           ++Y+++D+LIHLNIQE HYYITR                 GVFMDR GQ+ITNLT DDEV
Sbjct: 6   QEYSDDDSLIHLNIQENHYYITRDHLMSLPESLLLCLFPSGVFMDRMGQVITNLTSDDEV 65

Query: 97  YIPNFSTECFEYIMDVYNQAHTDYLNFPVNEIFNRKGTXXXXXXXXXXXXXXXXXXXXXX 156
           YI NF  +CFEYIM+ Y+ A  D + +  +E FN+                         
Sbjct: 66  YIGNFPPDCFEYIMETYSAAQEDLVKYTFDETFNKNPN---DKEHGRFFGFSCSSAPSSS 122

Query: 157 QESEILHEKPGIIVLREDLDYYCVPQVSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLL 216
            E++ILHEKP IIVLREDLDYYCV Q  V +   +S+ EK+ LL +LM ++K+AAGS+L 
Sbjct: 123 NEADILHEKPSIIVLREDLDYYCVRQPEVTF---ASEEEKDTLLTHLMAEVKIAAGSYLS 179

Query: 217 KQTSVF 222
            Q S+F
Sbjct: 180 NQCSIF 185

>KLLA0D12210g 1037870..1041040 similar to sp|P06777 Saccharomyces
           cerevisiae YPL022w RAD1 component of the nucleotide
           excision repairosome singleton, start by similarity
          Length = 1056

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 178 YCVPQVSVEYPEGSSDMEKE---ELLHNLMV--QIKLAAGSHLLKQTSVFLGLKSSNRAK 232
           Y     S  +P     M++E   EL H +M    +K+   S  L+  ++FL LK++    
Sbjct: 895 YASAASSTVHPISGKLMQEEIQRELSHLVMKYPSLKIVWSSSPLQTVNIFLDLKTNREQP 954

Query: 233 KPTKSNQVDGTKSSTGTVK 251
            P K  Q   TK  TG  K
Sbjct: 955 DPVKCVQFGSTKKQTGKNK 973

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,734,137
Number of extensions: 469721
Number of successful extensions: 1410
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1392
Number of HSP's successfully gapped: 11
Length of query: 451
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 346
Effective length of database: 12,961,219
Effective search space: 4484581774
Effective search space used: 4484581774
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 63 (28.9 bits)