Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F15829g74172937940.0
Kwal_26.710574069928580.0
YAL023C (PMT2)75970028430.0
Scas_505.275270526930.0
CAGL0J08734g74273026810.0
ACR290W75571726140.0
YOR321W (PMT3)75370024120.0
Scas_643.2476971023900.0
CAGL0F00759g73470019600.0
Kwal_33.1547175574216990.0
KLLA0F21978g75768316510.0
YGR199W (PMT6)75971116430.0
CAGL0K00979g73069615420.0
Scas_408.1*3913269141e-116
CAGL0L07216g8586828961e-108
YDL095W (PMT1)8176898851e-107
KLLA0E01342g8386818501e-102
Kwal_23.36238766818481e-101
ADR279C8176157893e-93
YDL093W (PMT5)7436447432e-87
KLLA0B03762g7727107068e-82
CAGL0M00220g7656256882e-79
YJR143C (PMT4)7626576612e-75
ABL085W7576236523e-74
Scas_710.19196696471e-72
Scas_442.13093006045e-72
Kwal_47.167347926286342e-71
Scas_719.807626225583e-61
CAGL0L07172g7776205101e-54
Scas_329.12732393738e-40
Sklu_2215.66536173903e-39
Scas_30.11281063474e-38
AAL050W6573143174e-30
Kwal_33.143576574252491e-21
Scas_588.77264472293e-19
YDR307W6623551882e-14
KLLA0C14828g6293311812e-13
Scas_710.0d2711461131e-05
CAGL0J11044g7362181142e-05
Kwal_55.2178874961770.40
Scas_650.1165699702.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F15829g
         (729 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...  1466   0.0  
Kwal_26.7105                                                         1105   0.0  
YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...  1099   0.0  
Scas_505.2                                                           1041   0.0  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...  1037   0.0  
ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...  1011   0.0  
YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...   933   0.0  
Scas_643.24                                                           925   0.0  
CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...   759   0.0  
Kwal_33.15471                                                         659   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   640   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   637   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   598   0.0  
Scas_408.1*                                                           356   e-116
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   349   e-108
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   345   e-107
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   332   e-102
Kwal_23.3623                                                          331   e-101
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   308   3e-93
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   290   2e-87
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   276   8e-82
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   269   2e-79
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   259   2e-75
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   255   3e-74
Scas_710.1                                                            253   1e-72
Scas_442.1                                                            237   5e-72
Kwal_47.16734                                                         248   2e-71
Scas_719.80                                                           219   3e-61
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   201   1e-54
Scas_329.1                                                            148   8e-40
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       154   3e-39
Scas_30.1                                                             138   4e-38
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   126   4e-30
Kwal_33.14357                                                         100   1e-21
Scas_588.7                                                             93   3e-19
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    77   2e-14
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    74   2e-13
Scas_710.0d                                                            48   1e-05
CAGL0J11044g complement(1073988..1076198) weakly similar to sp|Q...    49   2e-05
Kwal_55.21788                                                          34   0.40 
Scas_650.11                                                            32   2.9  

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score = 1466 bits (3794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/729 (96%), Positives = 707/729 (96%)

Query: 1   MSASLSGDELQSSLRHRGKDXXXXXXXLPEAEDLSKQKHVNESPLLKLESILMPIIFTGL 60
           MSASLSGDELQSSLRHRGKD       LPEAEDLSKQKHVNESPLLKLESILMPIIFTGL
Sbjct: 1   MSASLSGDELQSSLRHRGKDVVEEVEVLPEAEDLSKQKHVNESPLLKLESILMPIIFTGL 60

Query: 61  AFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSW 120
           AFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSW
Sbjct: 61  AFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSW 120

Query: 121 DFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYT 180
           DFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYT
Sbjct: 121 DFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYT 180

Query: 181 TLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGL 240
           TLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGL
Sbjct: 181 TLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGL 240

Query: 241 LIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSH 300
           LIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSH
Sbjct: 241 LIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSH 300

Query: 301 SGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQ 360
           SGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQ
Sbjct: 301 SGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQ 360

Query: 361 QQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRA 420
           QQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRA
Sbjct: 361 QQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRA 420

Query: 421 PVQANAWEVSGYGDAKVGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQ 480
           PVQANAWEVSGYGDAKVGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQ
Sbjct: 421 PVQANAWEVSGYGDAKVGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQ 480

Query: 481 TGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIH 540
           TGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIH
Sbjct: 481 TGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIH 540

Query: 541 LNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPS 600
           LNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPS
Sbjct: 541 LNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPS 600

Query: 601 TIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTY 660
           TIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTY
Sbjct: 601 TIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTY 660

Query: 661 VHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFG 720
           VHH               FEISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFG
Sbjct: 661 VHHYLPALYFALLVLAYLFEISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFG 720

Query: 721 MSGPSTDYE 729
           MSGPSTDYE
Sbjct: 721 MSGPSTDYE 729

>Kwal_26.7105
          Length = 740

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/699 (72%), Positives = 592/699 (84%)

Query: 30  EAEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYY 89
           E +D  ++K V  +PLL+LESI MP+IFT + FF RMYKIG N+HVVWDEAHFGKFGSYY
Sbjct: 30  EVDDRIEEKSVEVNPLLRLESIAMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYY 89

Query: 90  LRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCV 149
           LRHEFYHDVHPPLGKMLVG SG++AGYNGSWDFPSGE+YP+Y+D+VKMR+FNA FSALC+
Sbjct: 90  LRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCI 149

Query: 150 PVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNV 209
           P+AYFTAK+IGFSLPTVWLFT LV+FENSY TLGRFILLDSMLLFFTV SMFCFV FHN 
Sbjct: 150 PLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQ 209

Query: 210 RSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYA 269
           RSKPF++KWWKWL  TG SLGCTISVKMVGL IIT+VGIYTV++LW +L D K+SKK YA
Sbjct: 210 RSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYA 269

Query: 270 AHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVA 329
            HW +R + LI+VPF +FLACFK+HFDLLSHSGTGDANMPSLFQA L GSDVG+GPRD+A
Sbjct: 270 GHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIA 329

Query: 330 LGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKN 389
           +GSS ++IKNQALGG LLHSH+Q YPEGS QQQVT YGHKDSNN W FDR R   P+ + 
Sbjct: 330 VGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEE 389

Query: 390 ETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIV 449
           ETE EFV  G+ YRLVH NTG+NLHTHP  AP+  + WEVSGYG A+VGDPKD W++E+V
Sbjct: 390 ETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVV 449

Query: 450 DQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTW 509
            Q G EDE++LHPLTSSFR+KNAE+GCYL+QTG  LP+WGFRQ+EVAC+KNPFKRDKRTW
Sbjct: 450 AQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTW 509

Query: 510 WNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQW 569
           WN+ET+ NEKLP RP +FKYPK +FIK+FIHLNLAMMATNNALVP+ +KLD LASSAWQW
Sbjct: 510 WNVETHTNEKLPGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQW 569

Query: 570 PTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPE 629
           PTLNVGIRLCGWG+  +KYFL+GSPASTW STIAV+ FM LV + L+RWQRQY DL++  
Sbjct: 570 PTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAVVGFMGLVVLLLLRWQRQYQDLSDAH 629

Query: 630 DINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKS 689
           D NLF+MGG YPLL WGLH++PF+IMSRVTYVHH               FE  +K  NK+
Sbjct: 630 DFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKT 689

Query: 690 KCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDY 728
           K G++ R  IY +Y AIVIYGFYYF+PISFG+SGPS++Y
Sbjct: 690 KGGQLARTLIYVTYGAIVIYGFYYFSPISFGLSGPSSNY 728

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/700 (72%), Positives = 589/700 (84%)

Query: 30  EAEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYY 89
           +AED SK+K   +S LL+LES++MP+IFT LA F RMYKIG N+HVVWDEAHFGKFGSYY
Sbjct: 44  DAEDFSKEKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYY 103

Query: 90  LRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCV 149
           LRHEFYHDVHPPLGKMLVG SGYLAGYNGSWDFPSGE YP+Y+D+VKMRLFNA FSALCV
Sbjct: 104 LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCV 163

Query: 150 PVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNV 209
           P+AYFTAK+IGFSLPTVWL T LVLFENSY+TLGRFILLDSMLLFFTV S F FV FHN 
Sbjct: 164 PLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQ 223

Query: 210 RSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYA 269
           RSKPF++KWWKWL  TG SLGCTISVKMVGL IITMVGIYTV+DLW  LAD  MS K Y 
Sbjct: 224 RSKPFSRKWWKWLLITGISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYI 283

Query: 270 AHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVA 329
            HW +R   LI+VPF +FL CFKIHFDLLSHSGTGDANMPSLFQA L+GSDVG+GPRD+A
Sbjct: 284 NHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIA 343

Query: 330 LGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKN 389
           LGSS ++IKNQALGG LLHSHIQTYP+GS QQQVT YG+KD+NN W F+R+R    + +N
Sbjct: 344 LGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSEN 403

Query: 390 ETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIV 449
           ET+ E++  G  YRLVH +TGRNLHTHP  APV    WEVSGYGD  VGD KD+W+IEI+
Sbjct: 404 ETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIM 463

Query: 450 DQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTW 509
           DQ+G ED  KLH LT+SFR+KN EMGCYL+QTGN+LP+WGFRQ EV C+KNPFKRDKRTW
Sbjct: 464 DQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTW 523

Query: 510 WNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQW 569
           WNIET+ NE+LPPRPE+F+YPKT+F+KDFIHLNLAMMATNNALVP+ +K D LASSAWQW
Sbjct: 524 WNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQW 583

Query: 570 PTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPE 629
           PTLNVG+RLCGWG+ N KYFL+G+PASTW S++AVLAFM  V + LIRWQRQY DL NP 
Sbjct: 584 PTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPS 643

Query: 630 DINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKS 689
           + N+FLMGG YPLLAWGLH++PF+IMSRVTYVHH               F+  ++KW++S
Sbjct: 644 NWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRS 703

Query: 690 KCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYE 729
           KCG++MR+ +Y  +MA+VI  F+YF+PISFGM GPS+++ 
Sbjct: 704 KCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFR 743

>Scas_505.2
          Length = 752

 Score = 1041 bits (2693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/705 (68%), Positives = 570/705 (80%), Gaps = 4/705 (0%)

Query: 28  LPEAEDLSKQKHVNE----SPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFG 83
           + E EDL K+    E    + LL++ESI+MP++FTGLA FIRMYKIG NDHVVWDEAHFG
Sbjct: 32  IDEKEDLKKEIVSTEKKESNTLLRVESIIMPLVFTGLAIFIRMYKIGINDHVVWDEAHFG 91

Query: 84  KFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNAL 143
           KFGSYYLRHEFYHDVHPPLGKMLVG SGYLAGYNGS+DF SG +YP+Y+D+VKMR+FNA 
Sbjct: 92  KFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSFDFSSGAEYPDYVDYVKMRIFNAA 151

Query: 144 FSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCF 203
           FSA+CVPVAYFTAK+IGFS+PTVWLFT  VLFENSYTTLG+FILLDSMLLFFTVLS  CF
Sbjct: 152 FSAMCVPVAYFTAKAIGFSIPTVWLFTITVLFENSYTTLGKFILLDSMLLFFTVLSYMCF 211

Query: 204 VKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKM 263
           V FHN RSKPF++KWWKW+  TG S+GC ISVKMVGL IIT+VGIYT++DLWN L D  M
Sbjct: 212 VIFHNQRSKPFSRKWWKWMLLTGLSMGCAISVKMVGLFIITVVGIYTIIDLWNFLGDKTM 271

Query: 264 SKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGE 323
           S K Y  HW +R + LI+VPF VFLACFKIHFDLL+HSGTGDANM SLFQANLIGSDVG 
Sbjct: 272 SWKAYIGHWLARIICLIIVPFLVFLACFKIHFDLLTHSGTGDANMSSLFQANLIGSDVGA 331

Query: 324 GPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFS 383
           GPRDVA+GSS I+IKNQALGG LLHSH   YPEGS QQQVT Y +KD+NN W FDR R  
Sbjct: 332 GPRDVAVGSSIISIKNQALGGALLHSHYNAYPEGSNQQQVTAYSYKDANNEWFFDRPRGE 391

Query: 384 APYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDD 443
             Y +NET+ E+V   ++YRLVH  TG+NLHTHP RAP+ +  WEVSGYGDA+ GD +D+
Sbjct: 392 PFYHENETDIEYVLGDSQYRLVHHKTGKNLHTHPVRAPISSTQWEVSGYGDAEQGDSRDN 451

Query: 444 WIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFK 503
           W+IEIVDQ+G ED+TKLHPLT+SFR+ N +M CYLSQTGN LP+WGF+Q EVACV+NPF+
Sbjct: 452 WLIEIVDQRGDEDKTKLHPLTTSFRIYNPDMDCYLSQTGNHLPEWGFKQFEVACVQNPFR 511

Query: 504 RDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLA 563
           RDKRTWWNIETN N+ LPPRP +FK+PKT+F KDFI LNLAMMATNNALVP+ EK D LA
Sbjct: 512 RDKRTWWNIETNENDVLPPRPADFKFPKTNFFKDFIQLNLAMMATNNALVPDPEKFDILA 571

Query: 564 SSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYS 623
           SSAWQWPTL  G+R+C WGE  +KYFL+G+PASTW S++AV+  MV + V LIRWQRQYS
Sbjct: 572 SSAWQWPTLYWGLRICSWGEDVVKYFLLGTPASTWGSSLAVVGLMVYIVVLLIRWQRQYS 631

Query: 624 DLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISM 683
           DL +P+D+N F+MG  YPLLAWGLH+ PF+IMSRVTYVHH               F+  +
Sbjct: 632 DLQDPKDLNTFMMGAFYPLLAWGLHYAPFVIMSRVTYVHHYLPALYFALIILAYVFDAGL 691

Query: 684 KKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDY 728
           K   K+K  +++R  IY +    VI  F+YF+PISFGM GP  +Y
Sbjct: 692 KFLTKTKSTQILRIVIYLAAYVTVIGCFWYFSPISFGMVGPMENY 736

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score = 1037 bits (2681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/730 (66%), Positives = 581/730 (79%), Gaps = 4/730 (0%)

Query: 2   SASLSGDELQSSLRHRGKDXXXXXXXLPEAEDLSKQK--HVNESPLLKLESILMPIIFTG 59
           S    G E   +     K        + E ED SK K   V++SPLL+LE+ LMP++FTG
Sbjct: 3   STGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVFTG 62

Query: 60  LAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGS 119
           LA F+RMY+IG N +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVG SGYLAGYNGS
Sbjct: 63  LALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGS 122

Query: 120 WDFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSY 179
           +DF SG +YPEY+DFVKMRLFNA FSA+CVP+AYFTAK+IGFSLP VWLFT +VLFENSY
Sbjct: 123 FDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFENSY 182

Query: 180 TTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVG 239
           +TLGRFILLDSMLLFFTV S+F FV FHN RS+PF++KWWKWL  TG +LGCTISVKMVG
Sbjct: 183 STLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKMVG 242

Query: 240 LLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLS 299
           L +IT+VGIYTV+DL  ML + KMS K Y  HW +R V LI VP AVF+ CFK+HFDLL 
Sbjct: 243 LFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDLLW 302

Query: 300 HSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQ 359
           HSGTGDANMPSLFQA L+GSDVG GPRDVA+GSS ++IKNQAL G LLHSH+QTYPEGS 
Sbjct: 303 HSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEGSN 361

Query: 360 QQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHR 419
           QQQVT Y +KD+NN W F R R  + +D NET+ E+V DGA YRLVH NT +NLHTH   
Sbjct: 362 QQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHSIA 421

Query: 420 APVQANAWEVSGYGDAKVGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLS 479
           APV    WEVSGYG+  +GD KD W++EIVDQKG E+ T++HPLT+SFRL+N E+ CYL+
Sbjct: 422 APVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCYLA 481

Query: 480 QTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFI 539
           QTGN LP+WGFRQ+E++CVK+PF+RDKRTWWN+E++ NEKLP  PE FKYP + F+KDFI
Sbjct: 482 QTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLPT-PEEFKYPGSGFLKDFI 540

Query: 540 HLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWP 599
           HLNLAMMATNNALVP ++K D LASSAW+WPTL+VG+RLCGWG+ N KYFL+G+P +TW 
Sbjct: 541 HLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWA 600

Query: 600 STIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVT 659
           S++AV++FM+L  V L+RWQRQY+D +N +D NLFLMGG YP+L WGLHFVPF+IMSRVT
Sbjct: 601 SSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVT 660

Query: 660 YVHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISF 719
           YVHH                + + K+W KSKCG +MR  ++   +A V+  F+YF+PISF
Sbjct: 661 YVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISF 720

Query: 720 GMSGPSTDYE 729
           GM+GP+ +Y 
Sbjct: 721 GMTGPAINYH 730

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score = 1011 bits (2614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/717 (67%), Positives = 567/717 (79%), Gaps = 5/717 (0%)

Query: 17  RGKDXXXXXXXLPEAEDLSKQKHVNE--SPLLKLESILMPIIFTGLAFFIRMYKIGANDH 74
           RGK        + E ED+SK + V +  +PL KLE+ +MP++FT LA + RM+KIGAN+ 
Sbjct: 29  RGKASAEDGAGVQE-EDVSKLREVQQERNPLYKLEAFVMPVLFTLLALYTRMHKIGANNR 87

Query: 75  VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDF 134
           VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVG SGY+AGYNGSWDFPSGE+YPEYID+
Sbjct: 88  VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGEEYPEYIDY 147

Query: 135 VKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLF 194
           VKMR+FNA+FSA+C PVAYFT K+IGFSLPTVWLF+ LV+FENSY TLGRFILLDSMLLF
Sbjct: 148 VKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENSYATLGRFILLDSMLLF 207

Query: 195 FTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDL 254
           FTV S + FV FHN R +PF +KWWKWLF+ G SLGCTISVKMVGL II++VGIYTVVDL
Sbjct: 208 FTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMVGLFIISVVGIYTVVDL 267

Query: 255 WNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQA 314
           WN L++  MS   +A H+++R + LI+VPF VFL CFK+HF+ LS SGTGDA MPSLFQA
Sbjct: 268 WNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFLSVSGTGDAMMPSLFQA 327

Query: 315 NLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNV 374
            L GS VG GPRD+A+GSS ++IKNQALGG LLHSH+QTYP GS QQQVTTYGH DSNN 
Sbjct: 328 GLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGSSQQQVTTYGHNDSNNN 387

Query: 375 WTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGD 434
           W FDR R    +  NETE EFV DG  YRLVH NTGRNLHTHP  APV    WEVSGYGD
Sbjct: 388 WVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPIPAPVSKTHWEVSGYGD 447

Query: 435 AKVGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNE 494
           A+VGDPKD+WIIE V Q   ED++ LH +++SFR+KN EMGCYL+QTG +LP+WGFRQ E
Sbjct: 448 AQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYLAQTGPSLPEWGFRQGE 507

Query: 495 VACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVP 554
           VAC+ NPFKRDKRTWWNIETNVNE+LPP PE+FKYPKTSF KDF+HLNLAMMATNNALVP
Sbjct: 508 VACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDFVHLNLAMMATNNALVP 567

Query: 555 NAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVY 614
           + +KLD+LASSAWQWPTLNVGIRLC W +   KYFLIGSPASTWPST AV  F ++   Y
Sbjct: 568 DPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTWPSTAAVGVFCLITVYY 627

Query: 615 LIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXX 674
           L++WQRQ       +D N+FLMGGIYPLL WGLH++PF +M RVTYVHH           
Sbjct: 628 LLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRVTYVHHYLPALYFALLI 687

Query: 675 XXXXFEISMKKWNKSKCG--KVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYE 729
               FE S++   +S+    K++ Y +Y  Y   +I GFYYF PI+ GM GPS++Y+
Sbjct: 688 LAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYPITVGMEGPSSNYK 744

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/700 (63%), Positives = 538/700 (76%), Gaps = 4/700 (0%)

Query: 30  EAEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYY 89
           +AE   K K  NES +  L++I+MPIIFT L  F RMYKIG N+HVVWDEAHFGKFGSYY
Sbjct: 39  DAELYDKVK--NESAVSHLDTIVMPIIFTVLGMFTRMYKIGRNNHVVWDEAHFGKFGSYY 96

Query: 90  LRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCV 149
           LRHEFYHDVHPPLGKMLVG SGYLAGYNGSWDFPSGE YP+YID+VKMRLF A+FS+LCV
Sbjct: 97  LRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEVYPDYIDYVKMRLFQAMFSSLCV 156

Query: 150 PVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNV 209
           P+AYFT ++IGFS  +VWLFT LV+FENSY TLG+FILLDSMLLFFTV S FC  KFH +
Sbjct: 157 PLAYFTGRAIGFSRLSVWLFTILVIFENSYATLGKFILLDSMLLFFTVSSYFCLAKFHTM 216

Query: 210 RSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYA 269
           R  PF+ +WW WL  TG +LGC ISVKMVGL II++VGIYT+ +LWN+L+D  +S KVY 
Sbjct: 217 RKSPFSARWWLWLCLTGLNLGCAISVKMVGLFIISVVGIYTISELWNLLSDRSVSWKVYV 276

Query: 270 AHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVA 329
            HW +R   LI++P  VFL CFKIHFDLLS+SG GD+ MPSLFQA+L G+ VG+GPRDVA
Sbjct: 277 NHWLARIFGLIIIPVCVFLLCFKIHFDLLSNSGPGDSTMPSLFQASLNGTKVGKGPRDVA 336

Query: 330 LGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKN 389
           LGSS I+IKNQALGG LLHSH+Q +PEGS+QQQVT YG+ D+NN W F R R   P+   
Sbjct: 337 LGSSIISIKNQALGGALLHSHVQPFPEGSEQQQVTVYGYSDANNEWFFQRIRGVEPWTDA 396

Query: 390 ETET-EFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEI 448
           E +T EFV  G  YRL+H  TG+NLHTH   AP+  + +EVS YGD  +GD KD+WIIEI
Sbjct: 397 ENKTIEFVKGGEMYRLMHRLTGKNLHTHEVPAPISKSEYEVSAYGDVDLGDYKDNWIIEI 456

Query: 449 VDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRT 508
           V+Q G ED T LHPL++SFR+KN+ +GCYL+Q+G  LP+WGFRQ EV C+K+  KRDKRT
Sbjct: 457 VEQVGEEDPTLLHPLSTSFRIKNSILGCYLAQSGKHLPEWGFRQGEVVCLKHASKRDKRT 516

Query: 509 WWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQ 568
           WWNIET+ NE+L P+ E+F YPKTSF ++F+ LN AMMATNNALVPN EK D +ASSAWQ
Sbjct: 517 WWNIETHENERL-PQGEDFVYPKTSFFRNFMQLNSAMMATNNALVPNPEKFDGIASSAWQ 575

Query: 569 WPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNP 628
           WPTLNVG+RLC W E++IKYFL+GSPAS WPS+IAV A ++ V    ++WQRQ   L++P
Sbjct: 576 WPTLNVGVRLCEWSEKSIKYFLLGSPASVWPSSIAVCALIIHVIFLTLKWQRQCVILSDP 635

Query: 629 EDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNK 688
            + ++F+M   YPLLAW LH++PF++MSRV Y HH               F++  K+W  
Sbjct: 636 VERDVFVMAAFYPLLAWLLHYMPFVVMSRVVYAHHYLPTLYFALMILSYYFDMITKRWAT 695

Query: 689 SKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDY 728
              GK +R   Y  Y +IVI GF+YF+P SFGM GP  DY
Sbjct: 696 RNTGKFLRLGAYIVYGSIVIAGFFYFSPFSFGMDGPVDDY 735

>Scas_643.24
          Length = 769

 Score =  925 bits (2390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/710 (62%), Positives = 538/710 (75%), Gaps = 13/710 (1%)

Query: 32  EDLSKQKH-VNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYL 90
           E++ KQ+    ESPL K+E+ +MPI+FTGL+FF RMYKIG N+HVVWDEAHFGKFGSYYL
Sbjct: 46  ENVKKQQPPSEESPLCKVEAWVMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYL 105

Query: 91  RHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVP 150
           RHEFYHDVHPPLGKMLVG SGYLAGYNGSWDFPSGE+YP+Y+D+VKMRLF A FS+LCVP
Sbjct: 106 RHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVP 165

Query: 151 VAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVR 210
           +AY TAK+IGFS+P VWLFT LVLFENSY TLGRFILLDSML FFTV S   F+ FH  R
Sbjct: 166 MAYITAKAIGFSIPAVWLFTCLVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQR 225

Query: 211 SKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNML---ADTKMSK-- 265
             PF+ KWW  L   GF+LGC ISVKMVGL IIT+VGIYTV DLW +L   A  K  K  
Sbjct: 226 KNPFSIKWWTTLALLGFNLGCAISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQ 285

Query: 266 --KVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGE 323
             KVY  HW +R V LI++PF VFL CF+IHF LLSHSGTGDANMPSLFQA L GSDVG+
Sbjct: 286 AWKVYGCHWIARIVCLIIIPFLVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGK 345

Query: 324 GPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRF- 382
           GPRDVALGSS ++IKNQALGG LLHSH+QT+P+GS QQQVT Y + D NN+W FDR R  
Sbjct: 346 GPRDVALGSSFVSIKNQALGGALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIP 405

Query: 383 -SAPY-DKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDA-KVGD 439
            + P+ ++ ET+ E+V  G  YRLVH +T +NLH     APV  N WEV+G+G   +VGD
Sbjct: 406 GNQPWSNETETDIEYVRVGNEYRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGD 465

Query: 440 PKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVK 499
             D+WIIE+++Q G ED++ +HPLT++F +K+A +GCYL+QT   LP+WGFRQ+E+ C  
Sbjct: 466 DMDNWIIEVIEQAGDEDKSMIHPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSH 525

Query: 500 NPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKL 559
              K DKRTWWN+E++ NEKLP    +F YPKT+F KDF+ LN  MMATNNALVP+++K 
Sbjct: 526 KISKNDKRTWWNVESHENEKLPDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKY 585

Query: 560 DKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQ 619
           D LAS+AWQWPTLNVG+RLCGW +  +KYFL+GSPASTWPST++V+  M+ + V   RWQ
Sbjct: 586 DSLASAAWQWPTLNVGLRLCGWNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQ 645

Query: 620 RQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXF 679
           RQ ++  N + +N F+MG  YPLLAWGLHF+PF+IM+RVTYVHH               F
Sbjct: 646 RQLTNFANDKALNTFMMGAFYPLLAWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFF 705

Query: 680 EISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYE 729
           E  +++  K    K + Y     Y A+VI GF+YF+PISFGM GPS +Y 
Sbjct: 706 EAIIRR-PKGTLAKYITYITLVLYFAVVIGGFFYFSPISFGMDGPSKNYR 754

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/700 (53%), Positives = 482/700 (68%), Gaps = 4/700 (0%)

Query: 31  AEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYL 90
           A D  +QK  N+   L+LE + MPI+FT LA  +R+Y++     V WDEAHFGKFGSYYL
Sbjct: 27  ANDNKEQKASNKQFWLRLERVAMPIVFTLLALLVRLYRLDVVKKVTWDEAHFGKFGSYYL 86

Query: 91  RHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVP 150
           RH FYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSG+ YP+Y+ FVKMR+F    SALCVP
Sbjct: 87  RHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVP 146

Query: 151 VAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVR 210
           + YF AK+IGFSLPTVWL T LVL ENSYTTLG+ ILLDS+LLFFTV +  CF KFH+  
Sbjct: 147 MTYFAAKAIGFSLPTVWLTTILVLCENSYTTLGKLILLDSLLLFFTVATFMCFQKFHSYH 206

Query: 211 SKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAA 270
            KPF+ +W  WLF TG S+GC ISVKMVGL +IT+VGI+T+V+LW +L D  ++ K YA 
Sbjct: 207 RKPFSFQWCLWLFLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYAN 266

Query: 271 HWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVAL 330
           HW +R + LI+ PF +F  CFKIHF LL  SG GD  MP  FQA L G+++G+GPRDV++
Sbjct: 267 HWIARIICLIVTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSI 326

Query: 331 GSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNE 390
           GS+ IT++N    G  LHSH QTYPEGS+Q+QVT Y + D NN W   R      +  N+
Sbjct: 327 GST-ITLQNMKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVND 385

Query: 391 TETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVD 450
           TE E + +G   RLVH  TG NLH+H   AP+    +EVSGYG+  +GD KD W++EI+ 
Sbjct: 386 TEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIK 445

Query: 451 QKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWW 510
             G ED+  +HP+T+  R ++A + CYL+Q+   LP+WGF Q EV C++ P K D +T W
Sbjct: 446 DDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMW 505

Query: 511 NIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWP 570
            ++T+ +  L   PENF YP+ SF  DF  LN  MMATNNAL  + +K D L S +W+WP
Sbjct: 506 IVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWP 564

Query: 571 TLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVY-LIRWQRQYSDLTNPE 629
           TL   +R+  W E + +Y L+GSPASTWPST+AVL F+V   +Y +++W RQ     N  
Sbjct: 565 TLYRSLRINSWNENDTRYLLLGSPASTWPSTVAVL-FLVFALLYKVLKWNRQMQIFQNEH 623

Query: 630 DINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKS 689
           D  LF+ GG+YPLL W LHF PF+IM RV YVHH               F+  ++ +NK+
Sbjct: 624 DEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNKT 683

Query: 690 KCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYE 729
           K  +++++ IY  YM++VI GF  FAP S+GM+G   +Y+
Sbjct: 684 KTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENYK 723

>Kwal_33.15471
          Length = 755

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/742 (45%), Positives = 460/742 (61%), Gaps = 37/742 (4%)

Query: 13  SLRHRGKDXXXXXXXLPEAEDL--------SKQK------HVNESPLLKLESILMPIIFT 58
           +LR R K+       +P  E L        SK K       ++ + LL++  +   I+ T
Sbjct: 14  NLRERQKNFTENELSIPPNESLDSDVDEKNSKNKTKFASSSISRNVLLQVTGV---ILLT 70

Query: 59  GLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNG 118
            L+F++R  KI AND VVWDEAHFGKFGSYY+++EFYHDVHPPLGKML+  S YLAG+NG
Sbjct: 71  ILSFYVRFNKIDANDEVVWDEAHFGKFGSYYIKNEFYHDVHPPLGKMLIALSQYLAGFNG 130

Query: 119 SWDFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENS 178
            + F SG  YP  +++  MR FNA F ALC P+   TAK++GFS    +    +V  E S
Sbjct: 131 DFAFDSGAPYPSGMNYKFMRQFNATFGALCAPIMLLTAKNLGFSNLGSYFLGMMVALELS 190

Query: 179 YTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMV 238
           +  L +FILLDSMLLFFT  +  C  + H VR++PFT++W  W+   G S+GC  SVK V
Sbjct: 191 FVALSKFILLDSMLLFFTATTFHCITELHKVRNRPFTRRWSLWMLLLGLSVGCVCSVKWV 250

Query: 239 GLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLL 298
           GL I  + GIYTVVDL++   D ++S+  Y  HW  R + LI++PF V+L CFKIHF +L
Sbjct: 251 GLFITVIAGIYTVVDLFSYHYDKELSRLSYYKHWLVRIIDLIVIPFLVYLFCFKIHFAIL 310

Query: 299 SHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGS 358
             SGTGDA   +LFQ NL G+ +  GPR+VA G SE+TI++  L   LLHSH+Q YP GS
Sbjct: 311 HKSGTGDAATNTLFQVNLDGNKIEIGPRNVAFG-SEVTIRSHGLSPNLLHSHVQLYPFGS 369

Query: 359 QQQQVTTYGHKDSNNVWTFDRQRF----SAPYDKNETETEFVTDGARYRLVHLNTGRNLH 414
            Q QVT YGH D NN W     R     +A     + +++ +T+G+  RLVH NTG NLH
Sbjct: 370 GQHQVTGYGHSDDNNNWVIKYPREGGLKAAENGLQDVQSDLLTEGSEIRLVHKNTGANLH 429

Query: 415 THPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVDQKGP-------EDETKLHPLTSSF 467
           +H   A V   ++EVSGYGD ++GD KDDW++EIV Q          ED + LHP+++SF
Sbjct: 430 SHEIPAHVSKGSFEVSGYGDEEIGDIKDDWVVEIVQQLDSDNSSFPKEDPSLLHPISTSF 489

Query: 468 RLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENF 527
           RL++  +GCYL+ TG   P WGF+Q E+ C     KRDK TWWNIE + N  L  + E +
Sbjct: 490 RLRHKYLGCYLATTGLAYPAWGFKQAEIVCKHTWMKRDKSTWWNIEDHWNPNL-EKSEGY 548

Query: 528 KYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIK 587
             PK+ F  DFI +N AM ++NNALVP+ +K D LAS AWQWPTL+VG+R+C W    +K
Sbjct: 549 VPPKSKFWPDFILINFAMASSNNALVPDEDKYDSLASEAWQWPTLHVGLRMCSWSNDTVK 608

Query: 588 YFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGL 647
           YFL+GSP  TW ST+++  F++++     +WQRQ  +LT  E ++   M G+ P LAW L
Sbjct: 609 YFLLGSPFQTWLSTLSLFIFVLILLRLAFKWQRQTVNLTGNE-LSEISMQGVLPFLAWLL 667

Query: 648 HFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKVMRYTIYGSYMAIV 707
           H++PF++M RVTYVHH                E  + K         + Y +Y +  A  
Sbjct: 668 HYLPFVLMGRVTYVHHYVPALYFAILVFGFVLETCLPK------RYFLNYIVYTALYAGC 721

Query: 708 IYGFYYFAPISFGMSGPSTDYE 729
           IY +  F+PI+ G+ GP+ +++
Sbjct: 722 IYIYVLFSPIAQGIDGPAHNFK 743

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/683 (46%), Positives = 434/683 (63%), Gaps = 17/683 (2%)

Query: 55  IIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLA 114
           ++ T ++F +R YKI  ++ VVWDEAHFGKFGSYYL+HEFYHDVHPPLGKML+G   YLA
Sbjct: 66  LLLTLVSFVLRFYKIDRSNIVVWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIGLGEYLA 125

Query: 115 GYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVL 174
           G++G++DF S   YP+ ++F  MR FNA+FS+LC P+A++ A+++ FS+PTV+L   +V 
Sbjct: 126 GFDGNFDFSSNSSYPDEVNFKIMRQFNAIFSSLCTPLAFYAARNLNFSMPTVYLVALMVC 185

Query: 175 FENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTIS 234
           FE+SY  LG+F+LLDSMLLFFTVL+ +C  + + +R    T KW  W+  TGFS+GC  S
Sbjct: 186 FEHSYIVLGKFVLLDSMLLFFTVLTFYCLSQLYRLRECQLTVKWLAWILATGFSIGCVCS 245

Query: 235 VKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIH 294
           VK VGLLI  +VGIYTV +L+ +  D  +SK  Y  HW  R   LI+ P  +++  FKIH
Sbjct: 246 VKWVGLLITALVGIYTVSELYCLHCDRSLSKTKYLGHWIVRISALIVFPLILYMVFFKIH 305

Query: 295 FDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTY 354
           F LL  +GTGD++  SLFQANL G+ +   PRD+A GS  I++++  L  GLLHSH QTY
Sbjct: 306 FTLLYKTGTGDSSTHSLFQANLEGAQIKPSPRDIAFGSC-ISLRSHGLSPGLLHSHPQTY 364

Query: 355 PEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNE----TETEFVTDGARYRLVHLNTG 410
           P+GS Q+QVT Y ++D NN W     R S      E        F+ DG   RLVH  T 
Sbjct: 365 PDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEERVYSDNILFLKDGDLLRLVHEKTK 424

Query: 411 RNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVDQ-----KGPEDETKLHPLTS 465
            NLHTH   + V    +EVSGYG+  VGD KDDWIIE+V+Q        E++  +HPLT+
Sbjct: 425 NNLHTHQIPSHVSKGHYEVSGYGNDAVGDLKDDWIIEVVEQLPTGNNTMENKALIHPLTT 484

Query: 466 SFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPE 525
           SFRL+N E+GCYL+ TG + P WG+ Q E+ C     +RDK TWWN+E ++N  L    +
Sbjct: 485 SFRLRNKELGCYLAATGLSYPGWGYNQAEIVCKYPWNQRDKSTWWNVEDHINSNLHI-DQ 543

Query: 526 NFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQN 585
            F  P T F  DF+ +N AM A+NNAL+P+ +K D++AS  W+WP L  G+R+C W ++ 
Sbjct: 544 TFTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDRIASEPWEWPILYKGLRMCNWNDKT 603

Query: 586 IKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAW 645
           +KY+L+GSP +TW ST A+   ++LV++ L R+QRQ   L   +  NLF   G+   + W
Sbjct: 604 VKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQSLQLNEKKAWNLFACAGL-SFIGW 662

Query: 646 GLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKVMRYTIYGSYMA 705
            LH+ PF IM RVTY+HH                + ++   N     + ++   Y S  A
Sbjct: 663 LLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVDFALANSN-----RYLKVVAYSSLYA 717

Query: 706 IVIYGFYYFAPISFGMSGPSTDY 728
              + ++YFAP   GM  P+  Y
Sbjct: 718 GCTFTYWYFAPFCQGMPEPNLTY 740

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/711 (45%), Positives = 453/711 (63%), Gaps = 20/711 (2%)

Query: 30  EAEDLSKQKHVNESPLLK-LESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSY 88
           + E+  + K   E   LK L  ++ P++ T  +F++R   I  N++VVWDEAHFGKFGSY
Sbjct: 44  QLEEKHRTKKNEEYTALKILRDVIGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKFGSY 103

Query: 89  YLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALC 148
           Y++HE+YHDVHPPLGKML+  S ++AG++G +DF S   YPE ++F  MR FNA F ALC
Sbjct: 104 YIKHEYYHDVHPPLGKMLIALSEWMAGFDGQFDFSSNNAYPENVNFKLMRQFNATFGALC 163

Query: 149 VPVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHN 208
            PVA+FTAK +GF+  TV+L  T+V  E+SY  L +FILLDSMLLFF++ +  C +K + 
Sbjct: 164 TPVAFFTAKWMGFNYFTVYLIATMVTLEHSYIVLSKFILLDSMLLFFSMTTFACMIKLYT 223

Query: 209 VRSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVY 268
           +R +  TKKW  W+  TG S+GC  SVK VGL I  +VG+YT ++L+ +  D ++ +  Y
Sbjct: 224 LRKQQMTKKWSLWMLLTGLSIGCVCSVKWVGLFITVVVGLYTCIELFLLYCDKELPRIKY 283

Query: 269 AAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDV 328
             HW  R + LI++PF ++L CFKIHF LL  SGTGD+   +LFQ NL G+ +  GPRDV
Sbjct: 284 YKHWLIRIINLIVIPFLIYLYCFKIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDV 343

Query: 329 ALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSA-PYD 387
           A G SE+TI++  L   LLHSHIQ YPEGS Q+Q+T YG  DSNNVW F+  R S    D
Sbjct: 344 AFG-SELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELD 402

Query: 388 KNET---ETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDW 444
           +N T   +   +TDG   RL H NTG NLH+H   + V    +EVSGYG   VGD KDDW
Sbjct: 403 QNGTLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDW 462

Query: 445 IIEIVDQKGP-------EDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVAC 497
           I+EIV Q          E+ T LHP+++ FRL++  +GCYL+ TG T P WGF+Q E+ C
Sbjct: 463 IVEIVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVC 522

Query: 498 VKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAE 557
             +  +RDK TWWN+E + N  L    E++  PK++F  DFI  N AM ++NNALVP+ +
Sbjct: 523 KDSWSRRDKSTWWNVEDHWNHNLET-AEDYVPPKSNFWTDFILTNFAMASSNNALVPDED 581

Query: 558 KLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIR 617
           K D L+S AW+WPTL+ G+R+C W     +Y+L+GSP +TW ST++++ F  ++   L R
Sbjct: 582 KYDSLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYR 641

Query: 618 WQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXX 677
           W+RQ   L++ + I    + GI+P ++W  H++PF +M RVTYVHH              
Sbjct: 642 WRRQTLYLSD-DQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGF 700

Query: 678 XFEISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDY 728
             + ++     ++   +++Y IY S     IY +  FAPI  GM G   +Y
Sbjct: 701 VLDFTL-----TRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEY 746

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/696 (46%), Positives = 436/696 (62%), Gaps = 25/696 (3%)

Query: 47  KLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 106
           K   ++  + FT L+F +R   I  N+ VVWDEAHFGKFGSYY+RHEFYHDVHPPLGKML
Sbjct: 33  KYRDLIACLGFTVLSFVLRFQGIDKNNSVVWDEAHFGKFGSYYIRHEFYHDVHPPLGKML 92

Query: 107 VGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTV 166
           +  S +LAG++G +DF SG QYP+ ++F  MR FNA F ALC PV +FTAK++  S P V
Sbjct: 93  IALSEWLAGFDGEFDFESGHQYPDGVNFKFMRQFNATFGALCTPVVFFTAKTMNLSWPIV 152

Query: 167 WLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTG 226
           +L T +V  E+S+  L +FILLDSMLLFFT  +  C VK   +R    T++W  WL  TG
Sbjct: 153 YLVTLMVTLEHSFIALSKFILLDSMLLFFTATTFACMVKLIQLRGCQLTRQWLWWLLLTG 212

Query: 227 FSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAV 286
            S+GC  SVK VGL I  +VG++T++DL     + K S+K+Y  HW  R + LI++PF V
Sbjct: 213 LSIGCVCSVKWVGLFITLVVGLFTIIDLLEHYWNKKESRKIYYKHWILRIINLIIIPFLV 272

Query: 287 FLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGL 346
           +L CFKIHF LL  SGTGDA+  SLFQ NL G+ +   PR V  G SE+TI++  L   L
Sbjct: 273 YLFCFKIHFLLLYKSGTGDASTNSLFQVNLEGTQIQNSPRTVMYG-SEVTIRSHGLSPNL 331

Query: 347 LHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPY---DKNETETEF--VTDGAR 401
           LHSH+Q YP+GS+Q+QVT YGH D NN W     R +  Y   D      E   V DG  
Sbjct: 332 LHSHVQLYPDGSRQRQVTGYGHSDGNNNWMIKFGRTTGRYLDEDNKRLNGELVPVRDGDT 391

Query: 402 YRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVDQK-------GP 454
            RL H+  G NLH+H   + V    +EVSGYG  +VGD KDDWIIEI++Q        G 
Sbjct: 392 IRLFHVRMGCNLHSHTISSHVSKGNYEVSGYGSEEVGDEKDDWIIEIMEQLDSANTNFGK 451

Query: 455 EDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIET 514
           ED   LHP+++ FRL++ ++GCYL+ TG + P WGF Q E+ C  +  KRDK TWWN+E 
Sbjct: 452 EDNEVLHPISTMFRLRHKDLGCYLASTGLSYPTWGFHQAEIVCKYSWGKRDKSTWWNVED 511

Query: 515 NVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNV 574
           + N++L    E +  PK+ F  DFI +N AM ++NNALVP+ +K D LAS AW+WP L+ 
Sbjct: 512 HWNDQLVV-DEEYVPPKSKFWTDFILINFAMASSNNALVPDEDKYDYLASKAWEWPILHK 570

Query: 575 GIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLF 634
           G+RLCGW    ++Y+L+GSP +TW S+IA+L  ++L  V  I+W+RQ S + N E     
Sbjct: 571 GLRLCGWSSAGVRYYLLGSPFNTWLSSIALLVNILLGMVVAIKWRRQ-SIVINEESCWKL 629

Query: 635 LMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKV 694
               ++P LAW  +F+P+++M RVTYVHH                E  +  +   K    
Sbjct: 630 FTLLLFPFLAWLANFMPYVMMGRVTYVHHYMPALYFAIIAFGSITEYLLADYCTVKA--- 686

Query: 695 MRYTIYGSYMAIV--IYGFYYFAPISFGMSGPSTDY 728
                + +++++V   Y ++YFAPI  G+ G  + Y
Sbjct: 687 -----FLAFLSMVGCTYIYWYFAPICQGLHGIGSHY 717

>Scas_408.1*
          Length = 391

 Score =  356 bits (914), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 168/326 (51%), Positives = 233/326 (71%), Gaps = 1/326 (0%)

Query: 48  LESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV 107
           + S + P++ T L+F +R + IG N+HVVWDEAHFGKFGSYY+ HEFYHDVHPPLGKML+
Sbjct: 61  MRSYIGPLLLTILSFQLRFHDIGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKMLI 120

Query: 108 GFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVW 167
             S YLAG++G ++F S E YPE ++++ MR FNA+F ALCVPV  FT +S+GF+  T +
Sbjct: 121 ALSEYLAGFDGHFNFDSNEAYPEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLTSY 180

Query: 168 LFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGF 227
           L T +V  E+SY  L +FILLDS+LLFFT+ +  C VK + ++ +  TK+W  W+  TG 
Sbjct: 181 LVTLMVTLEHSYIVLSKFILLDSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLTGL 240

Query: 228 SLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVF 287
           S+GC  SVK VGL I  +VG++T+++L+    D  + +  Y  HW  R + LI++PF ++
Sbjct: 241 SVGCVCSVKWVGLFITIIVGLFTIMELFTHHYDKTLPRVKYYKHWMIRIIDLIIIPFLIY 300

Query: 288 LACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLL 347
           + CFKIHF LL  SGTGD+   +LFQ NL G+ +  GPRDV  G SE+TI++  L   LL
Sbjct: 301 MFCFKIHFTLLYKSGTGDSATNTLFQVNLEGTTIENGPRDVMYG-SEVTIRSHGLSPNLL 359

Query: 348 HSHIQTYPEGSQQQQVTTYGHKDSNN 373
           HSH+Q YP+GS+Q+Q+T YGH DS++
Sbjct: 360 HSHVQLYPDGSRQRQITGYGHSDSSS 385

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  349 bits (896), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 231/682 (33%), Positives = 344/682 (50%), Gaps = 28/682 (4%)

Query: 48  LESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLV 107
           L+  LM  I   +  F+R+YK+     VV+DE HFG F S Y++ +F+ DVHPPL KML 
Sbjct: 58  LKEKLMVAILLIITAFVRLYKLSWPSSVVFDEVHFGGFASKYIKGDFFMDVHPPLAKMLF 117

Query: 108 GFSGYLAGYNGSWDF-PSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTV 166
              G LAGY G + F P GE+YP+ + F  MRLF+A      V + Y T ++ G  L   
Sbjct: 118 AGVGALAGYTGDFSFKPIGEEYPDTVPFYTMRLFSASLGVFTVLMLYLTLRASGVRLGVA 177

Query: 167 WLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTG 226
           +LF  +  FENS+ T+ R+ILLD+ L+ F   +++ + K     +  F  +  K L  TG
Sbjct: 178 YLFALVFAFENSFVTISRYILLDAPLICFIAAAVYSYKKSELYPTNSF--RALKSLLATG 235

Query: 227 FSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAV 286
            +LG   S K VGL  +  VG+  V  LW M+ D   S          + V L+ VP  +
Sbjct: 236 IALGLASSSKWVGLFTVAWVGLLCVWKLWFMIGDLNKSPCTIVKAAIGKLVLLLGVPILL 295

Query: 287 FLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDV-GEGPRDVALGSSEITIKNQALGGG 345
           ++A F +HF  L H G+G +  PS F+A L G+ +  +   DV +GS  +T+K+ +  GG
Sbjct: 296 YVAFFYVHFQALIHDGSGSSFFPSEFRATLEGNQIPSDVVYDVGVGSI-VTLKHLSTEGG 354

Query: 346 LLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLV 405
            LHSH   YP GS+QQQ+T Y   D NN W  +R        K+      + +G    L+
Sbjct: 355 YLHSHSHAYPTGSEQQQITLYPFLDDNNKWVIERSHLPGASLKDFIG---LKNGESISLL 411

Query: 406 HLNTGRNLHTHPHRAPVQANA-W--EVSGYGDAK-VGDPKDDWIIEIVDQKGPE---DET 458
           HL TG  LH+H H+ PV  +A W  EVSGYG     GD  D W IEI DQ   +    + 
Sbjct: 412 HLATGVRLHSHDHKPPVSESADWQKEVSGYGYLGFTGDINDHWTIEI-DQSSSKPGIAQH 470

Query: 459 KLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNE 518
           ++  + + F+L++A  GCYL      LP+WGF Q EV C      + +   W IE + N 
Sbjct: 471 EVRAIDTKFKLRHA-TGCYLFSHEVKLPKWGFDQQEVTCATQ--GKPELLLWYIEGSENP 527

Query: 519 KLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRL 578
           +LP       Y   +FI+ FI  +  M   N  L           S A++WP +  GI  
Sbjct: 528 QLPENTPRISYKPMNFIEKFIENHKKMWKINKGLTGT----HYYESLAYEWPLMRRGIGY 583

Query: 579 CGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGG 638
             WGE + K +L+G+  + W  +  +L +  ++A     +      L +   IN F +  
Sbjct: 584 --WGEHHRKIYLLGNAVTWWAVSAFILVYAAILAFEAGSFLVGKPILQDKNVIN-FHVQV 640

Query: 639 IYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKVMRYT 698
           ++ LL + +H+VPF +M R  ++HH               F+I +    K++  K   Y 
Sbjct: 641 LHYLLGFAIHYVPFFLMGRQLFLHHYLPAYYFGILALAHAFDIIITFVCKNR--KQAAYA 698

Query: 699 IYGSYMAIVIYGFYYFAPISFG 720
           +   + A  IY F+  +PI++G
Sbjct: 699 LLILFTAASIYFFHAHSPIAYG 720

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  345 bits (885), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 235/689 (34%), Positives = 349/689 (50%), Gaps = 35/689 (5%)

Query: 45  LLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGK 104
           ++ L+  L+          IR++ +   D VV+DE HFG F S Y+R  ++ DVHPPL K
Sbjct: 44  MVTLKEKLLVACLAVFTAVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAK 103

Query: 105 MLVGFSGYLAGYNGSWDFPS-GEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSL 163
           ML      L G+ G +DF + G+ +P    +V MR F+A   AL V + Y T +  G  +
Sbjct: 104 MLYAGVASLGGFQGDFDFENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRM 163

Query: 164 PTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLF 223
               +       ENSY T+ R+ILLD+ L+FF   +++ F K+    +       +K L 
Sbjct: 164 WVALMSAICFAVENSYVTISRYILLDAPLMFFIAAAVYSFKKYEMYPANSLNA--YKSLL 221

Query: 224 YTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLAD-TKMSKKVYAAHWASRFVFLILV 282
            TG +LG   S K VGL  +T VG+  +  LW M+ D TK SK ++   +A +  FL+ V
Sbjct: 222 ATGIALGMASSSKWVGLFTVTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFA-KLAFLLGV 280

Query: 283 PFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEG-PRDVALGSSEITIKNQA 341
           PFA++L  F IHF  L+  G G +     F++ L  + + +    DV +GS  I++++ +
Sbjct: 281 PFALYLVFFYIHFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVVADVGIGSI-ISLRHLS 339

Query: 342 LGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEF--VTDG 399
             GG LHSH   YP GS+QQQ T Y H D+NN W    + ++AP    E+ T F  +TDG
Sbjct: 340 TMGGYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLL--ELYNAP---GESLTTFQNLTDG 394

Query: 400 ARYRLVHLNTGRNLHTHPHRAPV-QANAW--EVSGYGDAKV-GDPKDDWIIEIVDQKGPE 455
            + RL H  T   LH+H H+ PV +++ W  EVS YG +   GD  DDW++EI D+K   
Sbjct: 395 TKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWVVEI-DKKNSA 453

Query: 456 ---DETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNI 512
               + ++  L + FRL++A  GCYL      LP WGF Q EV C  +   R   T W +
Sbjct: 454 PGVAQERVIALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVTCASS--GRHDLTLWYV 511

Query: 513 ETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALV-PNAEKLDKLASSAWQWPT 571
           E N N  LP   +   Y   SFI  FI  +  M   N  LV P+  +     S    WP 
Sbjct: 512 ENNSNPLLPEDTKRISYKPASFISKFIESHKKMWHINKNLVEPHVYE-----SQPTSWPF 566

Query: 572 LNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDI 631
           L  GI    WGE N   +L+G+    W  T  +  F ++V   L  WQ     L + + +
Sbjct: 567 LLRGISY--WGENNRNVYLLGNAIVWWAVTAFIGIFGLIVITELFSWQLGKPILKDSKVV 624

Query: 632 NLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKSKC 691
           N F +  I+ LL + +H+ P  +M R  ++HH                +I +    +SK 
Sbjct: 625 N-FHVQVIHYLLGFAVHYAPSFLMQRQMFLHHYLPAYYFGILALGHALDIIVSYVFRSK- 682

Query: 692 GKVMRYTIYGSYMAIVIYGFYYFAPISFG 720
            + M Y +  +++A  +Y F  F+PI +G
Sbjct: 683 -RQMGYAVVITFLAASVYFFKSFSPIIYG 710

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  332 bits (850), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 225/681 (33%), Positives = 340/681 (49%), Gaps = 31/681 (4%)

Query: 52  LMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSG 111
           L+ I    +A  +R++ +   + VV+DE HFGKF + Y++  F+ DVHPPL KML    G
Sbjct: 55  LVVIALAVIASVVRLWNLSDPNSVVFDEVHFGKFAAKYIKGIFFTDVHPPLAKMLFAGIG 114

Query: 112 YLAGYNGSWDFPS-GEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFT 170
            LAG+ G ++F   G  +P    +  MR F+A      V + YFT ++ G  +   ++ +
Sbjct: 115 SLAGFTGDFEFKDIGLAFPASTPYFAMRFFSAFLGLATVLLMYFTLRASGIRIWIAFVAS 174

Query: 171 TLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLG 230
            +   ENS+ T+ R+ILLD+ L+FF   + + + K+    S+ F    +K L  TG SLG
Sbjct: 175 LMFALENSFVTISRYILLDAPLIFFIAAAAYSYKKYEIHPSESFNS--YKALLATGLSLG 232

Query: 231 CTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLAC 290
             +S K VGL  I  VG  ++  LW  + D K   +    H   +   L+  P A++L  
Sbjct: 233 LAVSSKWVGLFTIAWVGALSLFKLWFDIGDLKKPVQSTLRHTVVKATLLLAAPAALYLFF 292

Query: 291 FKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEG-PRDVALGSSEITIKNQALGGGLLHS 349
           F IHF  L ++  G     S F++ LIG+++    P DV +GSS ++I++    GG LHS
Sbjct: 293 FYIHFQTLIYNSDGAGFFSSAFRSTLIGNNIPSNIPYDVGVGSS-VSIRHTGTMGGYLHS 351

Query: 350 HIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNET--ET-EFVTDGARYRLVH 406
           H   Y  GS+QQQVT Y H D+NN W  +       YD+ E   ET E + DG + RL H
Sbjct: 352 HKHIYETGSKQQQVTLYSHLDANNDWVIEL------YDQPEVIPETFEGLKDGTKIRLRH 405

Query: 407 LNTGRNLHTHPHRAPV-QANAW--EVSGYG-DAKVGDPKDDWIIEIVDQKGPEDETK--L 460
             T R LH+H H+ PV +++ W  EVS YG D   GD  DDW+IEI  +     E +  +
Sbjct: 406 RLTDRRLHSHDHKPPVSESSDWQKEVSAYGADNFTGDANDDWVIEIDHEASAPGEAQEYV 465

Query: 461 HPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKL 520
             L + FRL++A  GC L      LP+WGF Q EV C  +       T W +E N N  L
Sbjct: 466 KALDTKFRLRHAMTGCRLFSHEVKLPKWGFEQQEVTCASSGVP--SLTLWYVEHNSNPLL 523

Query: 521 PPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCG 580
           P       Y   +F++ FI  +  M   N     N ++     S    WP L  GI    
Sbjct: 524 PEDAAKISYQTPTFLEKFIESHQRMWHINK----NLKEHHVYQSDPATWPLLLRGISY-- 577

Query: 581 WGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIY 640
           W + + + +L+G+    W  T  +  F++++   L+ WQ   S L +   +N  +    Y
Sbjct: 578 WSQDHKQIYLLGNAVVWWSVTAFIGVFVLVIVAELLAWQLGKSILQDKHVLNFHIQTFQY 637

Query: 641 PLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKVMRYTIY 700
            LL WGLH+ P  +M R  ++HH                EI +    K+K  K + Y + 
Sbjct: 638 -LLGWGLHYAPSFLMGRQLFLHHYLPAYYFGILAFAHALEIIVSYVFKNK--KTVGYGVV 694

Query: 701 GSYMAIVIYGFYYFAPISFGM 721
            +++A     FY + P+ +G+
Sbjct: 695 ITFLAAATAFFYVYKPLIYGL 715

>Kwal_23.3623
          Length = 876

 Score =  331 bits (848), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 225/681 (33%), Positives = 338/681 (49%), Gaps = 40/681 (5%)

Query: 56  IFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAG 115
           + TG+   IR+Y +   + VV+DE HFG F + Y++  F+ DVHPPL KML    G +AG
Sbjct: 103 VITGV---IRLYGLSNPNSVVFDEVHFGGFAAKYIKGIFFMDVHPPLAKMLFAAIGSIAG 159

Query: 116 YNGSWDFPS-GEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVL 174
           + G +DF   G+ +PE   +  MRLF AL   L V + Y T +  G  +P  ++ +    
Sbjct: 160 FTGDFDFEKIGQHFPESTPYYFMRLFPALLGTLTVLLMYLTLRCSGVRIPIAFIASLCFA 219

Query: 175 FENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWW---KWLFYTGFSLGC 231
            ENS+ T+ R+ILLD+ LLFF   +++ F K+     + + +  W   K L   G +LG 
Sbjct: 220 IENSFVTISRYILLDAPLLFFIASAVYSFKKY-----EIYPQGSWGSLKALLSGGLALGM 274

Query: 232 TISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACF 291
            +S K VGL  I  VG+  +  LW M+ D            + + +F + +P A++   F
Sbjct: 275 ALSSKWVGLFTIAWVGVLCIWRLWFMVGDLSKPLSSTLKEASRKLMFFLALPLALYAVFF 334

Query: 292 KIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGP-RDVALGSSEITIKNQALGGGLLHSH 350
            +HF+ L+ +  G     S F+  L G+ + +    DV +GS+ I++++ A  GG LHSH
Sbjct: 335 YVHFETLTINSDGAGFFSSAFRTTLHGNTIPKDILADVGIGST-ISMRHVATMGGYLHSH 393

Query: 351 IQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEF--VTDGARYRLVHLN 408
              Y +GSQQQQVT Y H D NN W  +      P   N+  T F  + DG   RL H  
Sbjct: 394 NHMYEKGSQQQQVTLYPHLDGNNDWVIE-----LPDQPNKAVTSFEGLKDGTVIRLKHAI 448

Query: 409 TGRNLHTHPHRAPVQANA-W--EVSGYG-DAKVGDPKDDWIIEIVDQKGPED---ETKLH 461
           T R LH+H H+APV  +A W  EVS YG +   GD  DDW IEI DQ   E    + ++ 
Sbjct: 449 TQRRLHSHDHKAPVSESADWQKEVSCYGFEDFEGDGNDDWTIEI-DQDASEPGEAQKRVK 507

Query: 462 PLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLP 521
            L + FRLK+  M C+L      LP+WGF Q EV C      +   T W IE N +  L 
Sbjct: 508 ALDTKFRLKHNIMNCHLFSHEVKLPKWGFEQQEVTCASQ--GKPYLTLWYIEGNSHPLLT 565

Query: 522 PRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGW 581
              E   Y K +F +  I  +  M   N  LV    +     S    WP L  GI    W
Sbjct: 566 GDQERVSYKKPNFFEKLIESHQRMWHINKNLV----EPHIYESKPHSWPFLLRGINY--W 619

Query: 582 GEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYP 641
           GE + + +L+G+    W  T  +  F  +V   L  WQ     L + + +N F +  I+ 
Sbjct: 620 GENHKQVYLLGNAIVWWSVTAFIALFATIVVFELFAWQLGKPILQDSKVVN-FHVQVIHY 678

Query: 642 LLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKVMRYTIYG 701
           LL +GLH++P  +M R  ++HH                +I++    + +  +V+ Y + G
Sbjct: 679 LLGYGLHYIPSFLMGRQLFLHHYLPAYYFGILAFAHALDITVTYVFRKR--EVIGYAVIG 736

Query: 702 SYMAIVIYGFYYFAPISFGMS 722
            + + V+Y F  +  + +G +
Sbjct: 737 VFFSAVVYFFVSYRALIYGTA 757

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  308 bits (789), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 200/615 (32%), Positives = 304/615 (49%), Gaps = 27/615 (4%)

Query: 59  GLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNG 118
           G+A  +R+Y +   D VV+DE HFG + S Y++  F+ DVHPPL KML+  +G LAGY G
Sbjct: 57  GVAAAVRLYNLAYPDSVVFDEVHFGGYASKYIQGAFFLDVHPPLAKMLLAGAGKLAGYGG 116

Query: 119 SWDFPS-GEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFEN 177
            + F   G  YP  + +  MR   A    L V + + T ++ G      +  + +   EN
Sbjct: 117 EFGFEDIGIDYPATVPYQVMRFLPAALGVLTVLLMFLTLRASGVRKWVAFAVSLVFTVEN 176

Query: 178 SYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKM 237
           S+ T+ R+ILLDS LLFF   +++ F +    ++     +++K L  TG +LG  +S K 
Sbjct: 177 SFVTISRYILLDSPLLFFIAAAVYSFKRLELHQTGSL--QYYKCLAATGMALGLAMSSKW 234

Query: 238 VGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDL 297
           VG      VG+ +V+ LW  + D            A +   L ++P  +++  F+IHF  
Sbjct: 235 VGFFTFAWVGVVSVMQLWFQVGDLNKPVPSILKQSAIKASILCVLPMCLYVLFFRIHFQS 294

Query: 298 LSHSGTGDANMPSLFQANLIGSDVGEGPRDVALG---SSEITIKNQALGGGLLHSHIQTY 354
           L +      N  S F+  L G  +   P ++  G    S +TI++    GG LHSH   Y
Sbjct: 295 LPNVTDAAGNFSSAFRTTLHGHTI---PANIYAGVGIGSTVTIRHIGTMGGYLHSHNHMY 351

Query: 355 PEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLH 414
             GS+QQQVT Y H D NN W  +    S   +   T  E +  G + RL H+ TG  LH
Sbjct: 352 QGGSEQQQVTLYPHLDQNNHWYIEHYNAS---NTVPTTFEGLEHGTKIRLKHVLTGHRLH 408

Query: 415 THPHRAPVQANA-W--EVSGYGDAKV-GDPKDDWIIEIVDQKGP--EDETKLHPLTSSFR 468
           +H H+ PV  ++ W  EVSGYG  +  GD  DDWI+EI  +K    E   ++  + + FR
Sbjct: 409 SHDHKPPVSVSSDWQKEVSGYGFPEFEGDANDDWIVEIDQEKSTPGEARERVRAIETKFR 468

Query: 469 LKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFK 528
           L++A  GC L      LP+WGF Q EV C      R   T W IE N N  L    E   
Sbjct: 469 LRHAMTGCMLFSHQVKLPKWGFEQQEVTCATQ--GRPDLTLWYIEENTNPLLSEDSEKIS 526

Query: 529 YPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKY 588
           Y   +F +  + ++  M   N +L           S   QWP L  GI    W + + + 
Sbjct: 527 YKTPNFWEKLVEIHRKMWHINKSLT----DAHMYQSDPIQWPFLLRGISY--WSKDSRQV 580

Query: 589 FLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLH 648
           +L+G+    +  T+ V+ F ++    L  WQ     L++ + +N F +  I+ LL + +H
Sbjct: 581 YLLGNAVVWYSVTLFVVIFGLICVGELFVWQLGKPILSDTKILN-FHIQTIHYLLGYFIH 639

Query: 649 FVPFIIMSRVTYVHH 663
           ++P  +M R  ++HH
Sbjct: 640 YLPSFLMGRQMFLHH 654

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  290 bits (743), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 207/644 (32%), Positives = 310/644 (48%), Gaps = 36/644 (5%)

Query: 31  AEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYL 90
            ++LS  + V  S    L   L+  IFT +   +R++ I   + VV+ E   G F S Y+
Sbjct: 31  CDNLSSLRTVTSSKEKLLVGCLL--IFTAI---VRLHNISLPNSVVFGENEVGTFVSQYV 85

Query: 91  RHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GEQYPEYIDFVKMRLFNALFSALCV 149
            + F+ DVHPPL  ML      + GY G +++ + G +Y   + +V MR F+A    + V
Sbjct: 86  NNIFFTDVHPPLVAMLYATVSSVFGYKGLFNYGNIGTEYTANVPYVAMRFFSATLGIVSV 145

Query: 150 PVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNV 209
            V Y T +  G  +    +       ENS+ TL RF L++   +FF    M C V F   
Sbjct: 146 LVLYLTLRVSGVKIAVAAICAVCFAIENSFVTLSRFTLIEGPFVFF----MACAVYFFR- 200

Query: 210 RSK---PFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKK 266
           RS+   P + K  K L     +LG  +S K  GL  I   GI  +  +W M+ D      
Sbjct: 201 RSELYLPNSCKANKSLLAASIALGFAVSSKWAGLFTIAWAGIIVLWRVWFMIGDLSRPIG 260

Query: 267 VYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDV-GEGP 325
               + A +F  L+ +P  ++   F +H   L+ +G   +  P+ F+  L  ++V  E  
Sbjct: 261 SSIKYMAFQFTCLLAIPAFIYFLIFSVHIKTLNVNGISSSFFPAEFRKTLKYNNVIKETV 320

Query: 326 RDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAP 385
            +VA+GS+ +++ +    GG LHSH+  YP GS QQQVT Y H D NN W  +       
Sbjct: 321 AEVAVGSA-VSLNHVGTAGGYLHSHLHNYPAGSMQQQVTLYPHIDQNNKWIIELAEHP-- 377

Query: 386 YDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANA-W--EVSGYG-DAKVGDPK 441
            ++N T  + +TDG   +L  L  G  LH+H H+ PV  NA W  EVS YG +   GD  
Sbjct: 378 -NENVTSFQNLTDGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQKEVSCYGYEGFEGDIN 436

Query: 442 DDWIIEIVDQK---GPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACV 498
           DDWIIEI  ++   GP  E  +  + + FRLK+   GCYL      LP+WGF Q EV C 
Sbjct: 437 DDWIIEIDKKRSEPGPAQE-HIRAIETKFRLKHYLTGCYLFSHPEKLPEWGFGQQEVTCA 495

Query: 499 KNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEK 558
              F R+  T W IE N NE   P PE   Y K SF + F+ ++  M   NN +    + 
Sbjct: 496 Y--FAREDLTSWYIEENENEISLPNPEKVSYKKMSFWQKFVAIHKFMFYLNNYM----DT 549

Query: 559 LDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRW 618
               +S    WP +  GI    W E   + + +G+    W  T  +  F++ VAV L+ W
Sbjct: 550 SHAYSSEPKTWPLMLRGIDF--WNENGREVYFLGNAVLWWSVTAFICTFIIGVAVELLAW 607

Query: 619 QRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVH 662
           +   + L +   IN       Y LL +  H+ P+  + +  +++
Sbjct: 608 KLGVNILRDKHIINFHYQVFQY-LLGFAAHYFPYFFVGQKLFLY 650

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  276 bits (706), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 219/710 (30%), Positives = 325/710 (45%), Gaps = 59/710 (8%)

Query: 52  LMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSG 111
           +M  + TGLA  +R+++I     VV+DE HFGKF SYYL   ++ DVHPP+ KML+   G
Sbjct: 63  VMNYLVTGLALVLRLWRISEPREVVFDEVHFGKFASYYLERTYFFDVHPPMAKMLIAAIG 122

Query: 112 YLAGYNGSWDFPS-GEQYPE-YIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLF 169
           +L GYNGS+ F   G  Y   Y  FV  R  +A+   L V V + T K + F   T ++ 
Sbjct: 123 WLTGYNGSFKFDDIGYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIA 182

Query: 170 TTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVR-SKPFTKKWWKWLFYTGFS 228
             L+  +N++ T  R ILLD+ML+F   LS++C+V+F+ ++ + PF+ +W+ WL+ TGFS
Sbjct: 183 AFLIAVDNAHVTDTRLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSEWYLWLYLTGFS 242

Query: 229 LGCTISVKMVGLLIITMVGIYTVVDLWNML-ADTKMSKKVYAAHWASRFVFLILVPFAVF 287
           L   +S K VGLL    +G+  VV+LW +L   + +S +    H   R   LI+ PF V+
Sbjct: 243 LSMVMSTKYVGLLTYCTIGLAVVVNLWQLLDIRSGLSMRKVVKHTLVRINGLIIFPFVVY 302

Query: 288 LACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSE----ITIKNQALG 343
           L  F  HF +L+ SG GDA M S FQ  L+     + P  V + S      ITIK++A  
Sbjct: 303 LFWFWCHFAILNQSGPGDAFMSSDFQDTLL-----DAPGAVEIKSINYHDIITIKHKA-T 356

Query: 344 GGLLHSHIQTYPE-------GSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFV 396
              LHSH+  YP         S  QQVT Y H+D NN W         P      +   V
Sbjct: 357 DAFLHSHLAKYPVRYEDGRISSNGQQVTCYSHEDINNQW-----EILPPSGSKFKKGAPV 411

Query: 397 TDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIVDQKGPED 456
              A  RL H+ T   L  H   +P      EV+   + +      D+ +       P++
Sbjct: 412 KLDADIRLRHVGTNTYLLAHDVASPYYPTNEEVTTVSEEEANGESYDFTLFRFQPILPKN 471

Query: 457 ETKLHPL-TSSFRLKNAEMGCYL-SQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIET 514
             ++     S+FR+ + +    L +     LP+WGF Q EV    N   +D    W +++
Sbjct: 472 SGRVAKTKNSAFRIFHVQTAVALWTHNDKLLPEWGFSQQEVN--GNKKVQDPENNWFVDS 529

Query: 515 NVN--EKLPPRPENFKYPKT-SFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPT 571
            VN  E    R    K P +  F + +  L   M   NN L          AS+   WP 
Sbjct: 530 IVNMPENDSRRIYTPKVPTSMPFFQKWYELQFLMFEHNNKLSSE----HPFASNPQSWPL 585

Query: 572 LNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDI 631
              G+      E   + F  G+    W   ++V  ++ LV   LI  QR    L      
Sbjct: 586 SLSGVSFWTKEEGRKQIFFTGNIVGWWFEIVSVALYLGLVVADLITRQRAVYALNKMARQ 645

Query: 632 NLFLMGGI-YPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKS- 689
            L+  G + + +  W +H+ PF +M+R  ++HH               +EI     N+S 
Sbjct: 646 KLY--GPMAFLIFGWCIHYFPFFLMARQKFLHHYLPAHLILAMFSAALWEIVFTD-NQSL 702

Query: 690 -----------------KCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMS 722
                            K   +  Y    S +  V   F YFAP+ +G+S
Sbjct: 703 DFDLDEEDSKNPHDAEPKVYTIAYYLFCLSVIVNVGGCFIYFAPLVYGLS 752

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  269 bits (688), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 198/625 (31%), Positives = 301/625 (48%), Gaps = 36/625 (5%)

Query: 56  IFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAG 115
           + T +AF +R YKI     VV+DE HFGKF SYYL   F+ DVHPPL KM++ F G+L  
Sbjct: 64  LVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLCN 123

Query: 116 YNGSWDFPS-GEQYPEY-IDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLV 173
           Y+GS+ F   G  Y ++   F+  R FNAL   L V + + + K + F   T +L + LV
Sbjct: 124 YDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASMLV 183

Query: 174 LFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSK-PFTKKWWKWLFYTGFSLGCT 232
             +N++ T  R ILLD++LL     +++ +++F+ ++ K PF+  W+ WL+ TGFSL C 
Sbjct: 184 AIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSCV 243

Query: 233 ISVKMVGLLIITMVGIYTVVDLWNML-ADTKMSKKVYAAHWASRFVFLILVPFAVFLACF 291
           IS K +G++    +GI  VV+LW +L  + K+S ++   H   R   LIL+PF ++L  F
Sbjct: 244 ISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLIKHIGRRLNGLILIPFIIYLFWF 303

Query: 292 KIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHI 351
            +HF +L+ SG GD  M S FQ  L  S+  +  ++V      +T +NQ   G  LHSH+
Sbjct: 304 YVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEVQFFDI-VTFENQD-TGAFLHSHL 361

Query: 352 QTYP-------EGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRL 404
             YP         SQ QQVT Y H+D NN W         P   ++ + + +  G  +RL
Sbjct: 362 ARYPLRYEDDRVSSQGQQVTCYTHEDVNNQWEI------LPV-ADKAKGDNIRFGDEFRL 414

Query: 405 VHLNTGRNLHTHPHRAPVQANAWEVSG-YGDAKVGDPKDDWIIEIVDQKGPEDETKLHPL 463
            H+ T   L  H   +P+     E++  + D  +G   +  I         ++   +   
Sbjct: 415 RHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFRFQPINKKDEGHIIKSK 474

Query: 464 TSSFRLKNAEMGCYL-SQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIET--NVNEKL 520
            +  R+ + E    L S     LP WGF Q EV   K     D    W I++  N++EK 
Sbjct: 475 NAVLRIIHKETVVALWSHNDELLPDWGFGQQEVNGNKK--MTDSGNAWTIDSIMNLDEKR 532

Query: 521 PP-RPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLC 579
               P+  K     F   ++ L   M   NN L          AS    WP    G+   
Sbjct: 533 SAYAPKEIK--SMPFFNKWLELQKLMFEQNNKLTSE----HPFASQPESWPGSMSGVSFW 586

Query: 580 GWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGI 639
              E+  + + IG+    W   I+   ++ ++    I  QR Y  L       L+  G +
Sbjct: 587 TKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRGYFALNKVTREKLY--GPL 644

Query: 640 -YPLLAWGLHFVPFIIMSRVTYVHH 663
            Y    W  H+ PF +M R  ++HH
Sbjct: 645 AYLFCGWACHYFPFFLMGRQKFLHH 669

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  259 bits (661), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 202/657 (30%), Positives = 307/657 (46%), Gaps = 44/657 (6%)

Query: 29  PEAEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSY 88
           P+ E +++   +   P  +        I T LAF  R YKI     VV+DE HFGKF SY
Sbjct: 31  PKCEQVAEHWLLQPLPEPESRYSFWVTIVTLLAFAARFYKIWYPKEVVFDEVHFGKFASY 90

Query: 89  YLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFP----SGEQYPEYIDFVKMRLFNALF 144
           YL   ++ DVHPP  KM++ F G+L GY+GS+ F     S E +P    ++  R FNA+ 
Sbjct: 91  YLERSYFFDVHPPFAKMMIAFIGWLCGYDGSFKFDEIGYSYETHPA--PYIAYRSFNAIL 148

Query: 145 SALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFV 204
             L VP+ + T K + F   T    + LV  + ++ T  R ILLD++L+     +M+C+V
Sbjct: 149 GTLTVPIMFNTLKELNFRAITCAFASLLVAIDTAHVTETRLILLDAILIISIAATMYCYV 208

Query: 205 KFHNVR-SKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTK- 262
           +F+  +  +PFT  W+ WL  TG SL   IS K VG++  + +G   VV+LW +L D K 
Sbjct: 209 RFYKCQLRQPFTWSWYIWLHATGLSLSFVISTKYVGVMTYSAIGFAAVVNLWQLL-DIKA 267

Query: 263 -MSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDV 321
            +S + +  H++ R   L+L+PF ++L  F +HF +L+ SG GDA M + FQ  L  S +
Sbjct: 268 GLSLRQFMRHFSKRLNGLVLIPFVIYLFWFWVHFTVLNTSGPGDAFMSAEFQETLKDSPL 327

Query: 322 GEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPE-------GSQQQQVTTYGHKDSNNV 374
               + V      ITIK+Q      LHSH+  YP+        S  QQVT Y H D NN 
Sbjct: 328 SVDSKTVNYFDI-ITIKHQD-TDAFLHSHLARYPQRYEDGRISSAGQQVTGYTHPDFNNQ 385

Query: 375 WTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYG- 433
           W         P+  +  + + V      RL H+ T   L  H   +P      E++    
Sbjct: 386 W-----EVLPPHGSDVGKGQAVLLNQHIRLRHVATDTYLLAHDVASPFYPTNEEITTVTL 440

Query: 434 DAKVGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYL-SQTGNTLPQWGFRQ 492
           +   G+   + +      K  ++   L   T SFRL + +    L +     LP WGF+Q
Sbjct: 441 EEGDGELYPETLFAFQPLKKSDEGHVLKSKTVSFRLFHVDTSVALWTHNDELLPDWGFQQ 500

Query: 493 NEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKT----SFIKDFIHLNLAMMAT 548
            E+   K     D    W ++  VN            PK      F+K +I    +M   
Sbjct: 501 QEINGNKKVI--DPSNNWVVDEIVNLD---EVRKVYIPKVVKPLPFLKKWIETQKSMFEH 555

Query: 549 NNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFM 608
           NN L          AS  + WP    G+     G++  + + IG+    W   I++  F+
Sbjct: 556 NNKLSSE----HPFASEPYSWPGSLSGVSFWTNGDEKKQIYFIGNIIGWWFQVISLAVFV 611

Query: 609 VLVAVYLIRWQRQYSDLTNPEDINLF--LMGGIYPLLAWGLHFVPFIIMSRVTYVHH 663
            ++   LI   R Y  L       L+  LM   +  ++W  H+ PF +M+R  ++HH
Sbjct: 612 GIIVADLITRHRGYYALNKMTREKLYGPLM---FFFVSWCCHYFPFFLMARQKFLHH 665

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  255 bits (652), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 182/623 (29%), Positives = 289/623 (46%), Gaps = 34/623 (5%)

Query: 58  TGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYN 117
           T +AF +R +K+     VV+DE HFGK  SYYL   ++ DVHPP  KML+ F G+L GY+
Sbjct: 55  TAIAFAVRFHKLYHPSEVVFDEVHFGKCASYYLERTYFFDVHPPFSKMLIAFVGWLVGYD 114

Query: 118 GSWDFPS-GEQYPEY-IDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLF 175
           G++ F   G  Y  + + ++  R  +A+   L VP+ +   + + F   T      LV  
Sbjct: 115 GAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAV 174

Query: 176 ENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSK-PFTKKWWKWLFYTGFSLGCTIS 234
           +N++    R ILLD+ L+    LS++ +++F+  + + P + +W+ WL+ TG SL   IS
Sbjct: 175 DNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVIS 234

Query: 235 VKMVGLLIITMVGIYTVVDLWNML-ADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKI 293
            K VG+    M+G   +V+LW +L     +S +++  H+  RF  L+  PFAV+L  F +
Sbjct: 235 TKYVGVFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQRFNGLVCFPFAVYLFWFYV 294

Query: 294 HFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQT 353
           HF +L+ SG GD  M S FQ  L  S + +  +DV     +I        G LLHSH   
Sbjct: 295 HFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHY--YDIVTFQHRDTGALLHSHNAY 352

Query: 354 YP-------EGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVH 406
           YP         SQ QQVT Y H+D NN W    +        + T    + D    RL H
Sbjct: 353 YPLRYEDGRVSSQGQQVTGYSHEDINNQW----EILPTKELSSRTGQPVLLDDV-LRLRH 407

Query: 407 LNTGRNLHTHPHRAPVQANAWEVSGYGDAKV-GDPKDDWIIEIVDQKGPEDETKLHPLTS 465
           + TG  L TH   +P      EV+   +    G+     + ++      +    +   TS
Sbjct: 408 IATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDGGHTVKSKTS 467

Query: 466 SFRLKNAEMGCYL-SQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVN---EKLP 521
            FR+ + +    L +     LP+WGF+Q EV   K     D    W + + +N   E+  
Sbjct: 468 MFRMFHVDTAVALWTHNDVFLPEWGFKQQEVNGNKK--VTDPANIWTVNSILNLSEERKV 525

Query: 522 PRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGW 581
             P+  K  K  F   ++ L  +M   NN L          AS    WP    G+     
Sbjct: 526 YIPK--KVTKMPFFSKWLELQRSMFEHNNKLSSE----HPFASQPESWPGSLSGVSFWTN 579

Query: 582 GEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGI-Y 640
             +  + +  G+    W   I++  F+ ++    I  QR +  L       ++  G + +
Sbjct: 580 DTERRQIYFTGNIIGWWIELISLALFVGILLADAITRQRSFFVLGKLAREKIY--GPLCF 637

Query: 641 PLLAWGLHFVPFIIMSRVTYVHH 663
             + W +H+ PF +M R  ++HH
Sbjct: 638 LYIGWAIHYFPFFLMGRQKFLHH 660

>Scas_710.1
          Length = 919

 Score =  253 bits (647), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 196/669 (29%), Positives = 312/669 (46%), Gaps = 31/669 (4%)

Query: 3   ASLSGDELQSSLRHRGKDXXXXXXXLPEAEDLSKQKHVNESPLLKLESILMPIIFTGLAF 62
           + L  D +Q+    +G+        +P  +    Q  V    +     I++ +       
Sbjct: 11  SELEKDTIQAIEIKKGR-------VIPFIDTEPSQDLVQLRTISTTHEIILVLSLLAFTA 63

Query: 63  FIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDF 122
            IR++ +G  + VV+DEA +G   S YL++  + DVHPPL K+L     +  G+ G ++F
Sbjct: 64  LIRLHDLGWPNGVVFDEAVYGNIVSKYLKNILFVDVHPPLIKLLYAGIAHFLGFEGQFEF 123

Query: 123 PS-GEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYTT 181
              G  +P    +  MRLF+A   +L V + Y T ++ G  +      +  ++ ENS+ T
Sbjct: 124 NDIGVPFPTTTPYYAMRLFSATLGSLTVLLMYLTLRASGVRIWVALAGSICLVIENSFVT 183

Query: 182 LGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGLL 241
           + R I+L+  L+FF   +++ F K  ++        +   +     +LG  IS K VG+ 
Sbjct: 184 VSRHIMLEGPLMFFIAAAVY-FTKKSDLFKADSCNSYIN-IGIAAVALGLAISSKWVGVA 241

Query: 242 IITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLS-H 300
            +   G+  V  LW M+ +  M           +   LI +P  +++  F  HF     +
Sbjct: 242 TLIWAGLICVWRLWFMVGNLSMPVCGSFKVALIKAFTLIFLPIILYILTFYFHFQYTGIN 301

Query: 301 SGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQ 360
           S       P         S V     ++A+GS  IT+++    GG LHSH   Y +GS Q
Sbjct: 302 SDVSQLFTPEFRTTLANNSVVNNVVAEIAVGSM-ITLRHPGTHGGYLHSHDAFYEKGSNQ 360

Query: 361 QQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRA 420
           QQ+T Y + D N+ WT   + +  P + N T  + +TDG + RL+H NTG  LH+H H+ 
Sbjct: 361 QQITCYPYVDKNDNWTV--ELYDVPLE-NITSFQNLTDGTKIRLLH-NTGCRLHSHDHKP 416

Query: 421 PVQANA-W--EVSGYG-DAKVGDPKDDWIIEIVDQKGPEDETKLH--PLTSSFRLKNAEM 474
           PV  N+ W  EVS YG     GD  DDWIIEI        E++ H   + + FRLK+A M
Sbjct: 417 PVSENSDWQKEVSCYGYPGFEGDANDDWIIEIDKDASIPGESQEHVRAIETKFRLKHAIM 476

Query: 475 GCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSF 534
           GCYL      LP+ GF Q EV C  +    D  T W++E N N  +    E   Y   SF
Sbjct: 477 GCYLFSHNTMLPKLGFEQQEVTCAYSGI--DSLTLWSVENNENPFVSDDAERVSYEPLSF 534

Query: 535 IKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSP 594
            K F+  +  M+   + +    +      S    WP +  GI    W EQ+   +L+G+ 
Sbjct: 535 WKKFVETHKRMLEIASGM----DNTHMYESKPATWPFMLRGIDF--WSEQHQDIYLLGNA 588

Query: 595 ASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGIYPLLAWGLHFVPFII 654
              W  T  ++ F  +V   L+  Q  Y    +P  IN F +  I  LL + L+F+P ++
Sbjct: 589 VLWWSVTAFIVGFAGIVVWELVSLQLGYEFSKDPHVIN-FHIQVIQYLLGFLLNFIPSLL 647

Query: 655 MSRVTYVHH 663
           +    +++H
Sbjct: 648 LENQIFLYH 656

>Scas_442.1
          Length = 309

 Score =  237 bits (604), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 179/300 (59%), Gaps = 18/300 (6%)

Query: 438 GDPKDDWIIEIVDQKGP-------EDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGF 490
           GD  DDWI+EIVDQ          ED+  +HP+++ FRL++  +GCYL+ TG   P WGF
Sbjct: 6   GDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGF 65

Query: 491 RQNEVACVKNPFKRDKRTWWNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNN 550
           +Q E+ C K+   RDK TWWN+E + N++LP   E++  PK+ F  DFI +N AM ++N+
Sbjct: 66  QQAEIVCKKSWSHRDKATWWNVEDHWNDQLPIE-EDYVPPKSKFWTDFILINFAMASSNS 124

Query: 551 ALVPNAEKLDKLASSAWQWPTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVL 610
           ALVP+A+K D LAS  W+WPTL+ G+RLC W     KY+L+GSP +TW ST+++  F+ +
Sbjct: 125 ALVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFI 184

Query: 611 VAVYLIRWQRQYSDLTNPEDINLFLMG--GIYPLLAWGLHFVPFIIMSRVTYVHHXXXXX 668
           ++    +W+RQ+ +L   ++  L+ +G  GI+P LAW  HF PF++M RVTYVHH     
Sbjct: 185 ISKIAYQWRRQHLNL---QEDQLWRLGIQGIFPFLAWITHFFPFVMMGRVTYVHHYLPAL 241

Query: 669 XXXXXXXXXXFEISMKKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDY 728
                      + S+      +    ++Y IY +      Y +  FAPI  G+ G    Y
Sbjct: 242 YFAILTFGFVLDYSI-----GRANPFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKY 296

>Kwal_47.16734
          Length = 792

 Score =  248 bits (634), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 192/628 (30%), Positives = 288/628 (45%), Gaps = 44/628 (7%)

Query: 58  TGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYN 117
           T LA  +R  K+     VV+DE HFGKF SYYL   ++ DVHPP  KML+ F G+L GYN
Sbjct: 90  TLLAAVVRFRKLSYPREVVFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYN 149

Query: 118 GSWDFPS-GEQYPEY-IDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLF 175
           G++ F   G  Y      FV  R  +A+   L VP+ + T K + F   T  L   LV  
Sbjct: 150 GTFKFDDIGLSYDSNPAPFVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAI 209

Query: 176 ENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSK-PFTKKWWKWLFYTGFSLGCTIS 234
           + ++    R ILLD+ LL     S++C+V+F+ ++ K PF+  W+ WL+ TG SL   +S
Sbjct: 210 DCAHVIDSRLILLDATLLIAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMS 269

Query: 235 VKMVGLLIITMVGIYTVVDLWNML-ADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKI 293
            K +G++    +G    V+LW +L     ++ + +  H   R   LI  PF ++L  F +
Sbjct: 270 TKYIGVMTYATIGSAVAVNLWQLLDVRAGLTIRQFVKHVLQRLNGLIFAPFVLYLFWFWV 329

Query: 294 HFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQT 353
           HF +L  SG GD  M S FQ  L  S +    R V      IT+K++ +    LHSH++ 
Sbjct: 330 HFAILIRSGPGDDFMSSQFQETLSDSPLAREARQVNYFDI-ITLKHK-VTDAYLHSHLER 387

Query: 354 YP-------EGSQQQQVTTYGHKDSNNVW-TFDRQRFSAPYDKNETETEFVTDGARYRLV 405
           YP         S  QQVT Y  +D NN W     ++  A     E +   + D  R+R  
Sbjct: 388 YPIRYEDGRVSSNGQQVTGYTLEDVNNQWEVLPTKQLPA----REGQPVHLDDVVRFR-- 441

Query: 406 HLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGD---PKDDWIIEIVDQKGPEDETKLHP 462
           H+ T   L  H   +P+     E++   +        P+  + ++ V++   ED  K   
Sbjct: 442 HVVTNTFLLAHDVASPLYPTNEEITTVEEEMANGANYPETLFRLQSVNKGDSEDVLKSK- 500

Query: 463 LTSSFRLKNAEMGCYL-SQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEKLP 521
             S FR+ + +    L +     LP+WGF+Q EV   K     D    W  ET VN    
Sbjct: 501 -ASVFRIVHIDTTVALWTHNDVLLPEWGFKQQEVNGNKKII--DPENSWFAETIVNID-- 555

Query: 522 PRPENFKYPKTS----FIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIR 577
               +   PKT     F   ++ L   M   NN L  +       ASS   WP    G+ 
Sbjct: 556 -EARSVYVPKTRKKLPFFTKWMELQRLMFEHNNKLSSS----HPFASSPESWPGSLSGVS 610

Query: 578 LCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTN--PEDINLFL 635
                 + I+ + IG+    W   +++  F  + A  L+  +R    L     + +N  L
Sbjct: 611 FWTKDSERIQIYFIGNIIGWWFQVVSIALFCGVTAADLLVRRRGIFPLNKMAKQKLNAPL 670

Query: 636 MGGIYPLLAWGLHFVPFIIMSRVTYVHH 663
               +  + W  HFVPF +M R  ++HH
Sbjct: 671 S---FLFVGWLCHFVPFFLMGRQKFLHH 695

>Scas_719.80
          Length = 762

 Score =  219 bits (558), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 182/622 (29%), Positives = 282/622 (45%), Gaps = 32/622 (5%)

Query: 58  TGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYN 117
           T +AF  R Y I     VV+DE HFGKF SYYL   ++ DVHPP  KM + F G+L GYN
Sbjct: 60  TLIAFVARFYMIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYN 119

Query: 118 GSWDFPS-GEQYPEY-IDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLF 175
           GS+ F   G  Y      ++  R FNA+   L V + + T K + F   T +    LV  
Sbjct: 120 GSFKFDEIGSSYQTNPAPYIAYRSFNAMLGTLTVSIMFNTLKELNFKAITCFFGALLVAV 179

Query: 176 ENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSK-PFTKKWWKWLFYTGFSLGCTIS 234
           +N++ T  R ILLD++LL     S + FV+F+  + + PF+ +W+ WL  TG SL   IS
Sbjct: 180 DNAHVTETRLILLDAILLISIAASFYSFVRFYKAQLRAPFSPQWYIWLHLTGLSLSFVIS 239

Query: 235 VKMVGLLIITMVGIYTVVDLWNML-ADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKI 293
            K +G++    +G   +V+LW +L     ++ + +  H+  R   L+  PF ++L  F +
Sbjct: 240 TKYIGVMTYAAIGTGVIVNLWQLLDLRANLTLRAFFRHFVKRLNGLVFAPFCIYLFWFWV 299

Query: 294 HFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQT 353
           HF +LS SG GDA M + FQ  L  S +    ++V      IT+K++      LHSH   
Sbjct: 300 HFAILSKSGPGDAFMSAEFQETLGDSPMSILSKEVHFYDI-ITLKHKD-TEAFLHSHQAF 357

Query: 354 YPE-------GSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRLVH 406
           YP         S+ QQVT +   D +N W     R     + +  +   V      RL H
Sbjct: 358 YPLRYEDGRISSEGQQVTGFTGTDISNDWEVLPTR-----ELDSHKGVPVVLNEPIRLRH 412

Query: 407 LNTGRNLHTHPHRAPVQANAWEVSGYGDAKV-GDPKDDWIIEIVDQKGPEDETKLHPLTS 465
           + +   L  H   +P      E++   +    G+     +      K  ++   +     
Sbjct: 413 VASNTYLLAHDVASPFYPTNEEITTVSEEIANGESYQQTVFTFQPLKKGDEGHVVKTKGV 472

Query: 466 SFRLKNAEMGCYL-SQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIE--TNVNEKLPP 522
            F++ +      L +     LP WGF Q EV   KN    D    W+++  TN++E    
Sbjct: 473 QFKIYHPNTDVVLWTHNDVLLPDWGFEQQEVNGSKN--FGDPTNAWSVDEITNLDEDRKK 530

Query: 523 RPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGIRLCGWG 582
                  P  SF + +  L  +M   NN L  +AE     AS    WP    G+      
Sbjct: 531 FTPKVVKP-MSFFRKWSELQKSMFEQNNKL--SAEH--PFASQPQSWPAGLCGVSFWTKS 585

Query: 583 EQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLMGGI-YP 641
           E+  + F   +    W   I++  F+ ++    I  +R Y  L       L+  G + + 
Sbjct: 586 EERKQIFFTANIIGWWFQVISMSVFIGILLADQISRKRGYFVLGKITREKLY--GPLAFL 643

Query: 642 LLAWGLHFVPFIIMSRVTYVHH 663
            ++WG H+ PF +M R  ++HH
Sbjct: 644 FISWGCHYAPFFLMHRQKFLHH 665

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  201 bits (510), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 167/620 (26%), Positives = 274/620 (44%), Gaps = 26/620 (4%)

Query: 47  KLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML 106
           K + ILM I+    A   R Y IG    +V+DE       S Y    F  DV PPLGKM+
Sbjct: 58  KSDGILMAIV-ALFAIVTRFYDIGFPKAIVYDEGFVIAEVSKYFNKTFSIDVFPPLGKMI 116

Query: 107 VGFSGYLAGYNGSWDF-PSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPT 165
             F G   G++ S+ + P G Q+     ++  R   A   A  V   + T ++ G S P 
Sbjct: 117 YYFVGKYTGFDTSYKYHPVGTQFENASVYLPERYLAAGLGACVVVFFFMTLRASGVSRPI 176

Query: 166 VWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYT 225
             +F+  +  ENS+ T  R++ LD+  LFF   +++   K  N+R+   + ++     + 
Sbjct: 177 AGIFSVALSLENSFITASRYVHLDAPFLFFVAAAIYFTKKSDNLRAG--SGRYIFTFTHA 234

Query: 226 GFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFA 285
              LG  IS K  GL ++  V I T+  LW +  D  +        +    + L LVP  
Sbjct: 235 ACLLGLAISTKWAGLFVLAWVAIVTLWRLWLLAGDLSVPICRTVKVFIFNLLVLSLVPAV 294

Query: 286 VFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDV-GEGPRDVALGSSEITIKNQALGG 344
           ++ + F  H    +  G     M   F++ L  + V  E   DV +G + + + N  + G
Sbjct: 295 IYFSIFSWHIGSRTVDGNDSILMKPEFRSELYNNTVIKESFADVVVGGT-VRLNNIGMDG 353

Query: 345 GLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARYRL 404
           G + +    Y  GS+Q+Q+    ++     W  +    S    K+    E + +  + RL
Sbjct: 354 GFVEAAPAYYEAGSKQRQIDLRKNESVTTDWVVEYYNRSGSTPKS---FENLKNHEKIRL 410

Query: 405 VHLNTGRNLHTHPHRAPVQANA-W--EVSGYG-DAKVGDPKDDWIIEIVDQKGPEDETK- 459
                   LH+H H+AP+  +  W  EVS YG +  +GDP DDWI+EI        E + 
Sbjct: 411 YSPKYKCRLHSHDHKAPISQHVDWQKEVSCYGYEGFMGDPNDDWIVEIDQDLSEPGEARE 470

Query: 460 -LHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQN-EVACVKNPFKRDKRTWWNIETNV- 516
            +  + + FRLK+A  GCYL      +    F  + E+AC  +   + + T WNIE +  
Sbjct: 471 FVKAIDTKFRLKHAMSGCYLFTHDVRMRTPEFVMDYEIACAHS--GKYELTLWNIEQDQP 528

Query: 517 NEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGI 576
           +   P  P+   Y   S     + L+  M+         +     L +    WP L  GI
Sbjct: 529 HPNSPKNPKRVSYKPMSLKDKILDLHAKMIEKAKVRTDKSS----LITFPTTWPLLEKGI 584

Query: 577 RLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLFLM 636
               W     + + +G+PA  W  +  ++ F+V     LI WQ  +   +NP+ IN  + 
Sbjct: 585 PF--WNGFARQIYFLGNPAMWWSVSAFIVLFVVAFVGELIFWQMGFEISSNPQFINFHIQ 642

Query: 637 GGIYPLLAWGLHFVPFIIMS 656
              Y  + + L++VP+I+ +
Sbjct: 643 VLQYG-IGFALNYVPYILTT 661

>Scas_329.1
          Length = 273

 Score =  148 bits (373), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 134/239 (56%), Gaps = 9/239 (3%)

Query: 29  PEAEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSY 88
           P AE L+K + V   PL +  +I +  +FT     IR+  +   D VV+DE HFGKF SY
Sbjct: 42  PPAE-LAKARTVF--PLKEKLAIAILALFTAS---IRLPNLQKPDSVVFDEVHFGKFASY 95

Query: 89  YLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS-GEQYPEYIDFVKMRLFNALFSAL 147
           Y++ EF+ DVHPPL KML      LAG+ G++ F + G+ +P  + +V MR F+A+  AL
Sbjct: 96  YIKGEFFMDVHPPLAKMLYAGVAALAGFRGNFMFENIGDVFPADVPYVLMRFFSAMLGAL 155

Query: 148 CVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFH 207
            V + Y T +S G      ++       ENSY T+ R+ILLD+ L+FF   +++ F K+ 
Sbjct: 156 TVMLLYLTLRSSGVRPWVAFVSGACFAIENSYVTISRYILLDAPLIFFIAAAVYSFKKYE 215

Query: 208 NVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKK 266
           N +S  F+    K LF  G +LG   S K VGL  I  VG+  +  LW M+ D   S K
Sbjct: 216 NYKS--FSIGSIKSLFVAGVALGMAASAKWVGLFTIAWVGLLCIWRLWFMIGDLSKSTK 272

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  154 bits (390), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 158/617 (25%), Positives = 259/617 (41%), Gaps = 61/617 (9%)

Query: 50  SILMPIIFTGLAFFIRMYKI----GANDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKM 105
           SI+  +I   +A F  ++++    G     V ++   G    +YL HEFY D  PPL   
Sbjct: 29  SIIDSLIAVLIALFFVLFQLTKVNGELGTSVQEKEILGSI-DHYLSHEFYLDSRPPLSVQ 87

Query: 106 LVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCVPVAYFTAKSIGFSLPT 165
           L               F  GE   E +              L + +   +   +  S+  
Sbjct: 88  LFSL----------LTFVYGELSVELLRAATTSCGGIALVLLYLGLRKSSVNRV-ISVIA 136

Query: 166 VWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYT 225
           V  F+ L +F      +      D   + F  +S++ +  F    +KPF+K W K+L + 
Sbjct: 137 VVSFSYLKVFREETLRVST----DIFQVCFLAMSLYSWKSFK--AAKPFSKTWHKYLLFL 190

Query: 226 GFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFA 285
             SLG +IS K VG +  + +   ++V LWN++AD +++ K    H   RF+ L+LVP  
Sbjct: 191 SISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADVRLTGKQVFTHCVLRFMALVLVPAI 250

Query: 286 VFLACFKIHFDLLSHSGTGDAN-MPSLFQANLIGSDVGE--GPRDVALGSSEITIKNQAL 342
           VFL  +  H   L+   T  +  M   ++  L  + + +   P  V  GS+ ITI+++  
Sbjct: 251 VFLLSYYAHISTLTQDLTDFSTFMSPYYKHTLENNPLNKIVPPGRVYYGST-ITIRHKDS 309

Query: 343 GGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNETETEFVTDGARY 402
            GG LHSH   Y  GS +QQVT Y   D+NN W  + ++ +            V +G   
Sbjct: 310 LGGYLHSHELNYQSGSHEQQVTLYDFPDNNNEWIVEHKKENKDVSSKAVA---VKNGENI 366

Query: 403 RLVHLNTGRNLHTHPHRAPVQANAW--EVSGYGDAK-VGDPKDDWIIEIVDQKGPEDETK 459
           RL H  TG+ L     + PV    +  EVS  GDA   G   + W I      G   E  
Sbjct: 367 RLRHRLTGKLLRASGAKPPVSEQDYDREVSCTGDANYTGQSDELWKIRF---SGRLLE-G 422

Query: 460 LHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTWWNIETNVNEK 519
           L PL ++F+L N   GC L      LP+W   Q EV C+  P K  +RT + +E++    
Sbjct: 423 LVPLDTTFQLTNQGQGCTLLSHDLRLPEWALFQQEVLCLDPPTK--ERTLFYVESS---N 477

Query: 520 LPPRPENFKYPKTSFIKDFIHL---NLAMMATNNALVPNAEKLDKLASSAWQWPTLNVGI 576
                 ++ + + + +  F+ L    L      +  + N +    +    W W      +
Sbjct: 478 RYSEDHHYIFVEDNSVVKFLKLLKEYLYKQFKYDYYIKNYKAEGDVGVGKWPWYISGDYL 537

Query: 577 RLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQR-QYSDLTNPEDINLFL 635
               W                + +  ++LA+++L  + LI W     +D+  P    L++
Sbjct: 538 DTAIW----------------FSAVFSILAYLLLQTIRLITWNPWNVADVELPLSYLLYI 581

Query: 636 MGGIYPLLAWGLHFVPF 652
             G+   + W LH+  F
Sbjct: 582 DNGLEFSVGWFLHYYIF 598

>Scas_30.1
          Length = 128

 Score =  138 bits (347), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 61/106 (57%), Positives = 72/106 (67%)

Query: 624 DLTNPEDINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISM 683
           D  NPED+N FLMG  YPLL WGLH++PF+IMSRVTYVHH               F+  M
Sbjct: 12  DFANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFFM 71

Query: 684 KKWNKSKCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDYE 729
           KKW KSKCG + +  IY  Y A++IYGFYYF+PISFGM GPS +Y 
Sbjct: 72  KKWTKSKCGSITKLAIYFCYYAVIIYGFYYFSPISFGMDGPSQNYS 117

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  126 bits (317), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 93/314 (29%), Positives = 146/314 (46%), Gaps = 11/314 (3%)

Query: 199 SMFCFVKFHNVRS----KPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDL 254
           +MF  +  +N +S    +PF + WW  L       G     K VGL     V +     +
Sbjct: 176 AMFLAIILYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHI 235

Query: 255 WNMLADTKMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQA 314
           + ++ D ++S +    H   R   L LVP ++ L  +  H    S+S    + MP+LF+A
Sbjct: 236 FQLIGDLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKA 295

Query: 315 NLIGSDVGEGPRDVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNV 374
            L G  V + P  V  GS  + I++ +  GG LHSH  TYP GS++QQ+T Y  +D+NN 
Sbjct: 296 QLDGYQVLQ-PASVYYGSG-VVIRHSSSIGGYLHSHELTYPGGSEEQQITLYDFEDANNK 353

Query: 375 WTFDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAW--EVSGY 432
           WT +   ++   D     T+ V +G   +L H+ TG+ L     + PV    +  EVS  
Sbjct: 354 WTVE-PVYNEAMDDIINSTQPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQEVSCT 412

Query: 433 GDAKV-GDPKDDWIIEIVDQKGPEDETKLHPLTSSFRL-KNAEMGCYLSQTGNTLPQWGF 490
           GD+   GD  + W ++I D +  ED      +  S R+ K   +   LS  G        
Sbjct: 413 GDSGYSGDSDETWRVDIQDAEYHEDPKAWFCIHFSPRVNKGPVLPPLLSHDGQAAEVGPC 472

Query: 491 RQNEVACVKNPFKR 504
            + EV C+ +P  +
Sbjct: 473 TRQEVICLASPVHK 486

>Kwal_33.14357
          Length = 657

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 112/425 (26%), Positives = 175/425 (41%), Gaps = 40/425 (9%)

Query: 87  SYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSA 146
           S Y++ EF+    PP    ++     + G                +    +R  N   +A
Sbjct: 69  SEYMKKEFFLMSSPPFMVQILALVSRIMGS---------------LSIEVLRKINLTTTA 113

Query: 147 LCVPVAYFTAKSIGF----SLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFC 202
             V   Y      G     S  T    + L LF  +   L    L++  +LF +     C
Sbjct: 114 FVVSSFYLALSRSGVVFVVSAVTAGSLSYLSLFAENSQHLS---LINFQVLFLSC----C 166

Query: 203 FVKFHNVR-SKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADT 261
            + +++ + S  FT++W+  L      L  ++S   +G +  +   I  +  +W+++ D 
Sbjct: 167 LLSWNSFKHSTSFTRRWYVALTSLSLFLSLSLSTTFLGAITWSWFLILMIKQMWSIVGDV 226

Query: 262 KMSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDV 321
            +S      H   R + +I VPF + L+ + +   LL+  G G  N  SL         +
Sbjct: 227 DVSMWKILKHTFWRVLMIICVPFGLMLSSYFVF--LLNSRGAG-MNHSSLVSPYFKTWFL 283

Query: 322 GEG-PR-DVALGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYG-HKDSNNVWTFD 378
            +G P+ D     S + I++    GG LHSH  TY  GS +QQVT      D++N W  +
Sbjct: 284 PQGLPQPDAVYYGSNLLIRHAESLGGYLHSHNYTYESGSLEQQVTLVDFSNDADNEWIIE 343

Query: 379 RQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAW--EVSGYGDAK 436
            Q  +   DK     + V +G   +L H  +G+ L     +APV    +  EVS  GD  
Sbjct: 344 AQNENLKLDKT---LQPVRNGDFVKLRHRTSGKLLRASSAKAPVSEQDYDHEVSCTGDHD 400

Query: 437 -VGDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEV 495
             GD  + W I       P +E  L P T  F L+N    C L      LP WGF Q EV
Sbjct: 401 YTGDSDETWRIRFERGNTP-NEGILCPFTMYFSLENKGHDCKLLSHDLRLPDWGFGQQEV 459

Query: 496 ACVKN 500
            CV +
Sbjct: 460 LCVDS 464

>Scas_588.7
          Length = 726

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 108/447 (24%), Positives = 180/447 (40%), Gaps = 61/447 (13%)

Query: 88  YYLRHEFYHDVHPPLGKMLVGF---SGYLAGYNGSWDFPSGEQYPEYIDFVKMRL--FNA 142
           YY + +F  +  PPLG  L        Y A    S    S      Y+ F ++ +    A
Sbjct: 142 YYQKDKFILNSFPPLGIQLYSLLPVGSYSAMRLMSLSASSFSLLFLYLAFRRVNVPYLIA 201

Query: 143 LFSALCVPVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFC 202
           L S +C+            S+P         LF    T +     LD++  F+  +S++ 
Sbjct: 202 LVSTVCI-----------LSIP---------LFRKESTRIS----LDTLQWFWLSISIYS 237

Query: 203 FVKFHNVRSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTK 262
           +          F+ KW         S+GC+++ K +G        + + +  W M+ D +
Sbjct: 238 WASLKCFSH--FSIKWTIHSLIFAMSIGCSMATKYIGFATWGWAILISSIYFWQMIGDVR 295

Query: 263 MSKKVYAAHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDAN----MPSLFQANLIG 318
           +S      H   +   L+++P  +F     +    ++HS          M S ++  L  
Sbjct: 296 LSTSHIVKHTTFQIFCLLVIPMTIFATTLYLQ---INHSRIDSPEYSQYMSSYYKIFLRS 352

Query: 319 SDVGEGPRDVALGSSEITIKN-QALGGGLLHSHIQTYPEGSQQQQVT-TYGHKDSNNVWT 376
                 P ++  GS  ITI++  +LGG L     ++YPEGS +Q V+ T    + +N W 
Sbjct: 353 KSPILQPMEITNGSI-ITIRHLNSLGGYLTSPANESYPEGSAEQIVSLTDMESNVDNQWI 411

Query: 377 FDRQRFSAPYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAW--EVSGYGD 434
            +   +   Y+K       + D  R +L H  TG+ L     + PV    +  EVS  GD
Sbjct: 412 LE---YVDDYNKGP-----LIDSQRIKLRHRTTGKLLRASSAKPPVSEQEYNSEVSCTGD 463

Query: 435 AKV-GDPKDDWIIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQN 493
               GD  + W I++V       E  L P  +   L N    C L      LP WG  + 
Sbjct: 464 WDYHGDSDEFWKIDLV-------EGSLIPCWNIMELDNVGQMCTLISHDTRLPDWGEFEQ 516

Query: 494 EVACVKNPFKRDKRTWWNIETNVNEKL 520
           EV C+++P    +R  + IE   N+++
Sbjct: 517 EVFCIQSP--DPQRAKFQIEFVDNDEI 541

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 87/355 (24%), Positives = 154/355 (43%), Gaps = 36/355 (10%)

Query: 170 TTLVLFEN--SYTTLGRFILLDSM--LLFFTVLSMFCFVKFHNVRSKPFTKKWWKWLFYT 225
           T L++  N  ++   G  I  DS+   LF  V+  F  +      +K  T  W+  +   
Sbjct: 135 TGLLILSNWETFRNEGTIISFDSLEWCLFSVVIYSFISISI----AKLGTTNWFANVITL 190

Query: 226 GFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAAHWASRFVFLILVPFA 285
             SLG  IS K +G++    V +  V     +++D K++            +F++++P +
Sbjct: 191 SISLGLAISSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVILCLLFVLIIPGS 250

Query: 286 VFLACFKIHFDLLSHSGTGDAN----MPSLFQANLIGSDVGEGPRDVALGSSEITIKNQA 341
           +F+  +    +LLS+  T        M + F++ L G  V   P  +  GS+ IT+++  
Sbjct: 251 IFIISYS---NLLSNFKTDTPQFSKYMSTYFKSYLRGPQVQ--PSRLYYGST-ITLRHLD 304

Query: 342 LGGGLLHSHIQTYPEGSQQQQVT-TYGHKDSNNVWTFDRQ----RFSAPYDKNE-TETEF 395
              G L SH  +YP    +Q V  ++    ++N W  +       FS  Y  ++    EF
Sbjct: 305 SMVGYLASHDISYPSDVDEQLVALSFEEFAADNEWLIEHPTLNLSFSEVYHADQLIPVEF 364

Query: 396 VTDGARYRLVHLNTGRNLHTHPHRAPV--QANAWEVSGYGDAKV-GDPKDDWIIEIV--- 449
              G   +L H +TG+ L     + P+  Q   +++S   D+   G   + W + ++   
Sbjct: 365 ---GQSIKLRHKSTGKLLRASTAKPPISEQDYDFQISCTKDSNYEGGMDERWDVLLIKDE 421

Query: 450 ---DQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNP 501
              D+K   D+  + PL S  R  N    C L      LP+WG  + EV C++ P
Sbjct: 422 INNDKKDNADDKYIKPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQEVLCMEYP 476

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 133/331 (40%), Gaps = 24/331 (7%)

Query: 211 SKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYAA 270
           SK F+  W+  +     SL   IS K +GL+    + I ++  LW ++ D  +  +   A
Sbjct: 177 SKDFSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDVKNRQLFA 236

Query: 271 HWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVAL 330
               R +F +++P       +       + S    A M S FQ +   S   + P  +  
Sbjct: 237 IMFCRLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQ-HYSMSQHNDIPSSIIY 295

Query: 331 GSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKNE 390
           GSS I +++    GG L +    YP+ +      +    D  N W  +  +      +N 
Sbjct: 296 GSS-IRLRHVNSLGGYLSALEIPYPKSNDTLVTVSDDPDDEANFWIIESNK-----GRNT 349

Query: 391 TET---EFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWE--VSGYGDAKV-GDPKDDW 444
            +T     V    + +L +  TG+ L     + P+    ++  +S  GD+   GD  + W
Sbjct: 350 EQTGSNALVKQTDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQGDQDELW 409

Query: 445 IIEIVDQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKR 504
            IEI  Q        L P      LKN    C L      +P WG R+ EV CV +P + 
Sbjct: 410 KIEI--QGKASFREVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCV-DPARV 466

Query: 505 DKRTWW-----NIETNVNEKLPPRPENFKYP 530
           ++  ++     + E  V EK    PE   YP
Sbjct: 467 NRALFYIDFVSSPEAGVVEKYKWAPE---YP 494

>Scas_710.0d
          Length = 271

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 64/146 (43%), Gaps = 3/146 (2%)

Query: 575 GIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPEDINLF 634
           GI   G  +Q++  +L+G+    W  T  +  F+VL    LI WQ     L + + IN F
Sbjct: 2   GISYWGEHDQHLGIYLLGNAVVWWSVTAFIGIFVVLCLSELIAWQVGKPVLQDKDVIN-F 60

Query: 635 LMGGIYPLLAWGLHFVPFIIMSRVTYVHHXXXXXXXXXXXXXXXFEISMKKWNKSKCGKV 694
            +  I+ LL + +H  P  +M R  ++HH                +I+     + K  K 
Sbjct: 61  HIQVIHYLLGFAVHIGPSFLMGRQMFLHHYLPAYYFGILAFGHALDITATYVLRRK--KN 118

Query: 695 MRYTIYGSYMAIVIYGFYYFAPISFG 720
             YT+   + A+  Y F   +PI +G
Sbjct: 119 FAYTLLAVFFALSYYFFKDHSPIIYG 144

>CAGL0J11044g complement(1073988..1076198) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w PMT7,
           hypothetical start
          Length = 736

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 91/218 (41%), Gaps = 35/218 (16%)

Query: 327 DVALGSSEITIKN-QALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSN-NVWTFDRQRFSA 384
           ++    S + I++ ++LGG L       Y  GS +Q       +DS  N W  +      
Sbjct: 319 EIIFKKSTVRIRHVESLGGYLSTLPNVNYMSGSFEQIAFLSQFEDSELNNWIIE------ 372

Query: 385 PYDKNETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAW--EVSGYGDAKV-GDPK 441
           P  + +   E V  G+R RL ++ TG+ L     R P+    +  EVS  G A   GD  
Sbjct: 373 PSTEAQNNKE-VRSGSRIRLRNVVTGKLLRASSSRPPMSDQEYNSEVSLTGSANFSGDAD 431

Query: 442 DDWIIE---IVDQKGPEDETKLHP---------LTSSFRLKNAEMGCYLSQTGNTLP-QW 488
           + W+I+   ++ +  P ++  L P           S F L+N   GC L      LP  W
Sbjct: 432 ETWLIDQKYVIGKAIPFNKMGLPPSENINALINTNSVFTLRNDGHGCMLLSHDTDLPDDW 491

Query: 489 G--------FRQNEVACVKNPFKRDKRTWWNIETNVNE 518
                    F + E+ C   P K  K T++  E+ V++
Sbjct: 492 DSMSSFKPEFHRQELTCNTTPTK--KLTYFMFESVVDQ 527

>Kwal_55.21788
          Length = 749

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 11/61 (18%)

Query: 72  NDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEY 131
           NDH V   A  G F S  LR+ FY D+           SG +A   G +D PS +++   
Sbjct: 597 NDHAVTPVAVKGDFVSLKLRNAFYEDIQ----------SGDIAAIVG-YDIPSAQEFTAQ 645

Query: 132 I 132
           I
Sbjct: 646 I 646

>Scas_650.11
          Length = 656

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 42/99 (42%), Gaps = 12/99 (12%)

Query: 351 IQTYPEGSQQQQVTT-------YGHKDSNNVWTFDRQ-RFSAPYD--KNETETEFVTDGA 400
           I+ YPE + + QVT          H DS N+  F+   +F +      N+     +    
Sbjct: 378 IERYPENASKFQVTIDQIIEYLKKHSDSENILVFESAYKFESMTSLMNNDNVMTVLYSSL 437

Query: 401 RYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGD 439
           ++ ++ L  GR+     +    + N W+  GYG   VGD
Sbjct: 438 KHMIITLQHGRSRSIMVNMLKYRKNLWDSLGYG--SVGD 474

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.138    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,360,934
Number of extensions: 1082645
Number of successful extensions: 2402
Number of sequences better than 10.0: 47
Number of HSP's gapped: 2276
Number of HSP's successfully gapped: 47
Length of query: 729
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 620
Effective length of database: 12,822,747
Effective search space: 7950103140
Effective search space used: 7950103140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)