Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F14531g34131914410.0
CAGL0H04917g3182853791e-42
Kwal_56.234073413203642e-40
Scas_636.113533363452e-37
YDR088C (SLU7)3823303322e-35
AGR159C2663021347e-09
Scas_676.1657566740.31
KLLA0B10868g57462710.74
KLLA0F04059g56950663.4
KLLA0A10769g15395609.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F14531g
         (336 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775 Saccha...   559   0.0  
CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces c...   150   1e-42
Kwal_56.23407                                                         144   2e-40
Scas_636.11                                                           137   2e-37
YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA sp...   132   2e-35
AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH] (1044766..1...    56   7e-09
Scas_676.16                                                            33   0.31 
KLLA0B10868g complement(951111..952835) highly similar to sp|P49...    32   0.74 
KLLA0F04059g 385832..387541 weakly similar to sp|P08019 Saccharo...    30   3.4  
KLLA0A10769g 933157..933618 similar to sp|P43594 Saccharomyces c...    28   9.5  

>KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775
           Saccharomyces cerevisiae YDR088c SLU7 pre-mRNA splicing
           factor affecting 3 splice site choice singleton,
           hypothetical start
          Length = 341

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/319 (86%), Positives = 277/319 (86%)

Query: 18  KPGQNEHIPNFIKNKPWYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXELEEKDYLSHHRL 77
           KPGQNEHIPNFIKNKPWYL                            ELEEKDYLSHHRL
Sbjct: 18  KPGQNEHIPNFIKNKPWYLAEESEVSASTSAINSNSTISGTGTGTGTELEEKDYLSHHRL 77

Query: 78  KKSSVPDSGTAEIDDAFTYVRPSGRNRKKKDSYDLDLDAPVRRRDEKVIESNYDAKRDRW 137
           KKSSVPDSGTAEIDDAFTYVRPSGRNRKKKDSYDLDLDAPVRRRDEKVIESNYDAKRDRW
Sbjct: 78  KKSSVPDSGTAEIDDAFTYVRPSGRNRKKKDSYDLDLDAPVRRRDEKVIESNYDAKRDRW 137

Query: 138 YGYTPDIKEIERNHKGPDTSHREMDEVQIQEMERLGLKPEDVGFDATQPLSGPKEKYNPV 197
           YGYTPDIKEIERNHKGPDTSHREMDEVQIQEMERLGLKPEDVGFDATQPLSGPKEKYNPV
Sbjct: 138 YGYTPDIKEIERNHKGPDTSHREMDEVQIQEMERLGLKPEDVGFDATQPLSGPKEKYNPV 197

Query: 198 RLREDKAAYLQDMSSEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERV 257
           RLREDKAAYLQDMSSEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERV
Sbjct: 198 RLREDKAAYLQDMSSEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERV 257

Query: 258 RQEAVRSGIKDFEVNKEKLNHVFAANPTKYELMMRTEPERKQETSVEQDAAPKRRKFDKN 317
           RQEAVRSGIKDFEVNKEKLNHVFAANPTKYELMMRTEPERKQETSVEQDAAPKRRKFDKN
Sbjct: 258 RQEAVRSGIKDFEVNKEKLNHVFAANPTKYELMMRTEPERKQETSVEQDAAPKRRKFDKN 317

Query: 318 XXXXXXXXXXXXXXTMKDL 336
                         TMKDL
Sbjct: 318 SFKESSSSSNPGSSTMKDL 336

>CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces
           cerevisiae YDR088c SLU7, hypothetical start
          Length = 318

 Score =  150 bits (379), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 149/285 (52%), Gaps = 57/285 (20%)

Query: 22  NEHIPNFIKNKPWYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXELEEKDYLSHHRLKKSS 81
           NEHIPN+IKN PWY                               +E+DYL HHR ++  
Sbjct: 20  NEHIPNYIKNLPWYYQDIDKNSKNNS-------------------KEQDYLRHHRQRR-- 58

Query: 82  VPDSGTAEIDDAFTYVRPSGRNRKKKDSYDL-------DLDAPVRRRDEKVIESNYDAKR 134
             D  T +ID+       +G     KD +++        +D  ++RR +   E ++DA++
Sbjct: 59  --DDKTIDIDNNDQAKIGTGI----KDEFEVIVENKKTTIDGIIKRRKD---EKDWDARK 109

Query: 135 DRWYGYTPDIKEIERNHKGPDTSHREMDEVQIQ---------EMERLGLKPEDVGFDATQ 185
           DRWYGY+   KE E   K  + S  +++    +         EM +LGL P+D+     Q
Sbjct: 110 DRWYGYSG--KEYEEVLKKWEKSREDLNNTTEESAYDTDEEIEMMKLGLTPKDL----EQ 163

Query: 186 PLSGPKEKYNPVRLREDKAAYLQDMSSEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTG 245
            + G       VRLREDKAAYL+D+ S    YDPKSR+YKS + G+ID  S MF RHLTG
Sbjct: 164 NIKGS-----SVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDDLGSIDEHSNMFLRHLTG 218

Query: 246 DALQVGVINERVRQEAVRSGIKDFEVNKEKLNHVFAANPTKYELM 290
           +  ++  +N+  R+ A  SGI+D  V+ +K+NHV  ANPTK E++
Sbjct: 219 EGKELNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLEVL 263

>Kwal_56.23407
          Length = 341

 Score =  144 bits (364), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 158/320 (49%), Gaps = 73/320 (22%)

Query: 18  KPGQNEHIPNFIKNKPWYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXELEEKDYLSHHR- 76
           K  +N HIP +IK++PW+                               +  DYLSHHR 
Sbjct: 10  KKQENVHIPKYIKDQPWFYKDLKSGDD----------------------QSNDYLSHHRR 47

Query: 77  ---------LKKSSVPDSGTAEIDDAFTY-------VRPSGRNRKKKDSYDLD-LDAP-- 117
                    +  ++ P  G    D+   Y       VRP   N    D    D L+AP  
Sbjct: 48  LNRPDSDLDIDNNAEPKIGRGIKDEYEGYSEVVTSRVRPKCNNCGGMDHIRRDCLEAPRK 107

Query: 118 -------------VRRRDEKVIESNYDAKRDRWYGYTPDIKEIE-----------RNHKG 153
                        +RR+D   +  N+DA+RDRW+GY  + KE E           +  +G
Sbjct: 108 RPATTKSVLKSSILRRKD---MSGNWDAQRDRWFGY--EGKEYEDTLRTWETAKDKESQG 162

Query: 154 PDTSHREMDEVQIQEMERLGL-KPEDVGFDATQPLSGPKEKYNPVRLREDKAAYLQDMSS 212
            D     +D  +  E+  LGL K E  G  A    +G + + + VRLRED+AAYL D++S
Sbjct: 163 NDEIEDLIDTDEEIELAALGLYKDEVTGAVAPDDENGSRLRAS-VRLREDRAAYLNDINS 221

Query: 213 EEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERVRQEAVRSGIKDFEVN 272
           E + YDPKSR+YKS++ G ID +SKMFHRHLTG++L++  ++   R++ + +GI+D   +
Sbjct: 222 ETLNYDPKSRLYKSEDLGEIDTESKMFHRHLTGESLELAKLSRFAREKTLAAGIRDEVED 281

Query: 273 KEKLNHVFAANPTKYELMMR 292
             K NHV  ANPTKYEL+M+
Sbjct: 282 DAKTNHVLVANPTKYELLMK 301

>Scas_636.11
          Length = 353

 Score =  137 bits (345), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 111/336 (33%), Positives = 161/336 (47%), Gaps = 82/336 (24%)

Query: 21  QNEHIPNFIKNKPWYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXELEEKDYLSHHRLKKS 80
           +N+HIP +IK +PWY                               +++DYL HHR K  
Sbjct: 15  ENQHIPRYIKTQPWYYKDGNAKPEGK--------------------DDEDYLKHHRNKDH 54

Query: 81  SV-----PDSGTAEIDDAF---------------------------------TYVRPSGR 102
           ++     P  G A I D F                                  + RP  +
Sbjct: 55  TLDHNDEPSIG-AGISDKFITTETKTLKTTMSDNGDVRKCTNCGTMGHLAKDCFERP--K 111

Query: 103 NRKKKDSYDLDLDAPVRRRDEKVIESNYDAKRDRWYGY-TPDIKEIERNHKGPDTSHREM 161
             KK DSY  D    ++ R+++  E ++DAK+DRW+GY   +  E+ +N +    +  +M
Sbjct: 112 KFKKLDSYSGD---QIKIRNDE--ELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKM 166

Query: 162 -----DEVQIQ------EMERLGLKPEDVGFDATQPLSGPKEKY-NPVRLREDKAAYLQD 209
                +EV I       E+ +LGL  + VG       +    K    VRLRED+AAYL D
Sbjct: 167 PSNGENEVNIWDSDEEIELMKLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLND 226

Query: 210 MSSEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERVRQEAVRSGIKDF 269
           ++S  + YDPKSRIYKS+E G+ID KSKMF RHLTG+ +++  +N   R  A ++GI+D 
Sbjct: 227 VNSGTINYDPKSRIYKSEELGSIDEKSKMFRRHLTGEGIELNELNSFTRAHARQTGIRDE 286

Query: 270 EVNKEKLNHVFAANPTKYELMMRTEPERKQETSVEQ 305
             +  K+ HV  ANPTKYE +MR   E+KQ    E+
Sbjct: 287 VEDSHKVEHVLVANPTKYEQLMR---EKKQNLPTER 319

>YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA
           splicing factor affecting 3' splice site choice,
           required for the second catalytic step of splicing [1149
           bp, 382 aa]
          Length = 382

 Score =  132 bits (332), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/330 (33%), Positives = 153/330 (46%), Gaps = 59/330 (17%)

Query: 21  QNEHIPNFIKNKPWYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXELEEKDYLSHHRLK-- 78
           +N HIP +I+N+PWY                               E+ DYL HHR K  
Sbjct: 29  ENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGG-------EKSDYLVHHRQKAK 81

Query: 79  -------KSSVPDSGTAEIDDAFTYVRPS------------GRN-----RKKKDSYD--- 111
                   +S P  G   I D F  +RP              RN      K+KD  +   
Sbjct: 82  GGALDIDNNSEPKIGMG-IKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCMEKPR 140

Query: 112 ----LDLDAPVRRRDEKVI----ESNYDAKRDRWYGYTPD-----IKEIERNH----KGP 154
               L  D   ++ +  V+    + ++D+++DRWYGY+       I + ER+     KG 
Sbjct: 141 KMQKLVPDLNSQKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRNKIKGK 200

Query: 155 DTSHRE---MDEVQIQEMERLGLKPEDVGFDATQPLSGPKEKYNPVRLREDKAAYLQDMS 211
           D S  +    D  +  E+ +L L  + VG          +      RLREDKAAYL D++
Sbjct: 201 DKSQTDETLWDTDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLNDIN 260

Query: 212 SEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERVRQEAVRSGIKDFEV 271
           S E  YDPKSR+YK++  G +D KSKMF RHLTG+ L++  +N+  R  A   GI+D   
Sbjct: 261 STESNYDPKSRLYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMGIRDEIE 320

Query: 272 NKEKLNHVFAANPTKYELM--MRTEPERKQ 299
           +KEK+ HV  ANPTKYE +   R + E KQ
Sbjct: 321 DKEKVQHVLVANPTKYEYLKKKREQEETKQ 350

>AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH]
           (1044766..1045566) [801 bp, 266 aa]
          Length = 266

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 108/302 (35%), Gaps = 93/302 (30%)

Query: 21  QNEHIPNFIKNKPWYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXELEEKDYLSHHRLKKS 80
           +N+HIP +I++KPWY+                              ++ DYL HHR +  
Sbjct: 3   ENKHIPKYIRDKPWYVESGD--------------------------DDADYLGHHRREPG 36

Query: 81  ------SVPDSGTAEIDDAFTYVRP-SGRNRKKKDSYDLDLDA----------------- 116
                 SV   G+   D       P +GR R +  +   + D                  
Sbjct: 37  EGAQDFSVAQQGSVISDRFVAGSAPRAGRGRGRCTNCGANHDRRDCLLRPRKQARGDGGE 96

Query: 117 -PVRRRDEKVIESNYDAKRDRWYGYTPDIKEIERNHKGPDTSHREMDEVQIQEMERLGLK 175
              + RDE  +  +++AKRDRWYG+   +            +  E     ++   +LGL 
Sbjct: 97  RAFQVRDENAL--SFEAKRDRWYGFEGPVAPAVAAAAAEPPAAAEDAAAAVERY-KLGLD 153

Query: 176 PEDVGFDATQPLSGPKEKYNPVRLREDKAAYLQDMSSEEMLYDPKSRIYKSKEEGTIDPK 235
                     P          +R R D+A YL D+  EE  YDPKSR+Y+        P 
Sbjct: 154 ARAARAGVGAPA---------IRPRHDRARYLDDVRGEETRYDPKSRVYRGDGAAGEAPA 204

Query: 236 SKMFHRHLTGDALQVGVINERVRQEAVRSGIKDFEVNKEKLNHVFAANPTKYELMMRTEP 295
           +                        A R G          ++HV +ANPT+ EL  +T P
Sbjct: 205 AP---------------------DRAGRDG--------STVDHVISANPTRLELGRQT-P 234

Query: 296 ER 297
           ER
Sbjct: 235 ER 236

>Scas_676.16
          Length = 575

 Score = 33.1 bits (74), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 14/66 (21%)

Query: 151 HKGPDTSHREMDEVQIQEMERLGLKPEDVGFDA-TQPLSGP---------KEKYNPVRLR 200
           H+GPD S   +    I   ERL +    VG D+  QP++ P          E YN +++R
Sbjct: 29  HRGPDWSGNVVKNTTILAHERLSI----VGLDSGAQPITSPCGNYTLCVNGEIYNHIQIR 84

Query: 201 EDKAAY 206
           E+ A Y
Sbjct: 85  EECADY 90

>KLLA0B10868g complement(951111..952835) highly similar to sp|P49089
           Saccharomyces cerevisiae YPR145w ASN1 asparagine
           synthetase, start by similarity
          Length = 574

 Score = 32.0 bits (71), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 151 HKGPDTSHREMDEVQIQEMERLGLKPEDVGF------DATQPLSGPKEKYNPVRLREDKA 204
           H+GPD S   +    I   ERL +   D G       D +  L+   E YN + LRE+ A
Sbjct: 29  HRGPDWSGNIVKNSTILVHERLAIVGLDSGAQPITSEDGSYTLAVNGEIYNHIMLREECA 88

Query: 205 AY 206
           +Y
Sbjct: 89  SY 90

>KLLA0F04059g 385832..387541 weakly similar to sp|P08019
           Saccharomyces cerevisiae YIL099w SGA1 sporulation
           specific glucan 1, 4-alpha-glucosidase singleton,
           hypothetical start
          Length = 569

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 28/50 (56%)

Query: 190 PKEKYNPVRLREDKAAYLQDMSSEEMLYDPKSRIYKSKEEGTIDPKSKMF 239
           P++ Y+ + + E    ++  ++S E++Y   +++Y  ++   IDP S  F
Sbjct: 425 PEDIYDGIDISEGNPWFISTLTSAELIYKLVNKMYHDEKPLLIDPISNKF 474

>KLLA0A10769g 933157..933618 similar to sp|P43594 Saccharomyces
           cerevisiae YFR011c ochre suppressor tyr-tRNA singleton,
           start by similarity
          Length = 153

 Score = 27.7 bits (60), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 12/95 (12%)

Query: 199 LREDKAAYLQDMSSEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDALQVGVINERVR 258
           L+E  +A L D+ SE +      + +++K + +I P          GDAL   ++NE+V 
Sbjct: 48  LQEKVSAKLSDLESEAL------KEFETKLQSSILPD----DSKSAGDALSTKLVNEKVD 97

Query: 259 QEAVRSGIKDFEVNKEK-LNHVFAANPTKYELMMR 292
           Q  VR   K  E +K K  + V A   T  E +++
Sbjct: 98  QLKVRLS-KLQEAHKAKSTDKVTATKKTLTECLLK 131

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,165,619
Number of extensions: 443469
Number of successful extensions: 1102
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1093
Number of HSP's successfully gapped: 37
Length of query: 336
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 234
Effective length of database: 13,065,073
Effective search space: 3057227082
Effective search space used: 3057227082
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)