Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F14509g85183139000.0
Kwal_56.234108258599491e-115
YDR089W8698958422e-99
CAGL0C03696g8318777922e-92
Scas_636.128378947703e-89
AGR160W8368777152e-81
Sklu_2202.8136755870.038
Kwal_27.1229221768830.042
AGR223W1321103770.50
Scas_704.3991651760.64
YPR027C27756750.65
CAGL0K10252g126774750.96
Scas_597.8106567741.0
Kwal_55.210291105129741.2
KLLA0C09570g49434731.4
YPL110C122337731.8
CAGL0F02387g95267722.2
YIL047C (SYG1)90242712.3
CAGL0J07040g124537694.3
CAGL0M07678g47360684.9
CAGL0M13827g184037695.0
Kwal_33.1361889126676.8
AGL020W844219677.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F14509g
         (839 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F14509g complement(1345334..1347889) weakly similar to sp|P...  1506   0.0  
Kwal_56.23410                                                         370   e-115
YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing...   328   2e-99
CAGL0C03696g complement(367135..369630) similar to sp|P38966 Sac...   309   2e-92
Scas_636.12                                                           301   3e-89
AGR160W [4471] [Homologous to ScYDR089W - SH] complement(1045983...   280   2e-81
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           38   0.038
Kwal_27.12292                                                          37   0.042
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    34   0.50 
Scas_704.39                                                            34   0.64 
YPR027C (YPR027C) [5461] chr16 complement(620420..621253) Protei...    33   0.65 
CAGL0K10252g complement(997315..1001118) similar to sp|Q01476 Sa...    33   0.96 
Scas_597.8                                                             33   1.0  
Kwal_55.21029                                                          33   1.2  
KLLA0C09570g complement(831137..832621) similar to sp|P09032 Sac...    33   1.4  
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    33   1.8  
CAGL0F02387g complement(229207..232065) similar to sp|P25360 Sac...    32   2.2  
YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...    32   2.3  
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    31   4.3  
CAGL0M07678g complement(767857..769278) similar to sp|Q04347 Sac...    31   4.9  
CAGL0M13827g 1360609..1366131 similar to sp|Q04952 Saccharomyces...    31   5.0  
Kwal_33.13618                                                          30   6.8  
AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C (...    30   7.2  

>KLLA0F14509g complement(1345334..1347889) weakly similar to
           sp|P38966 Saccharomyces cerevisiae YDR089w singleton,
           start by similarity
          Length = 851

 Score = 1506 bits (3900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/831 (89%), Positives = 743/831 (89%)

Query: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL 60
           MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL
Sbjct: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL 60

Query: 61  FRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDENKKLRRIKLINQHLDRCNLEL 120
           FRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDENKKLRRIKLINQHLDRCNLEL
Sbjct: 61  FRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDENKKLRRIKLINQHLDRCNLEL 120

Query: 121 QKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVDLD 180
           QKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVDLD
Sbjct: 121 QKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVDLD 180

Query: 181 PYLLEISLIVDLLHEMEQDADQQPVDSGNTKTGNTSNSRANSNVGITSGTAPXXXXXXXX 240
           PYLLEISLIVDLLHEMEQDADQQPVDSGNTKTGNTSNSRANSNVGITSGTAP        
Sbjct: 181 PYLLEISLIVDLLHEMEQDADQQPVDSGNTKTGNTSNSRANSNVGITSGTAPSSRKSSVV 240

Query: 241 XXXXXXXXTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVIATSKKIL 300
                   TLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVIATSKKIL
Sbjct: 241 SSSHVIDSTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVIATSKKIL 300

Query: 301 SGDALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPGXXXXXXXXXX 360
           SGDALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPG          
Sbjct: 301 SGDALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPGSNRSQQLSNS 360

Query: 361 XXXAHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPSSNDSILLCHVGGLRNHISTD 420
              AHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPSSNDSILLCHVGGLRNHISTD
Sbjct: 361 SSSAHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPSSNDSILLCHVGGLRNHISTD 420

Query: 421 TIEYTDIKAVLNGCEPSLMPVSNRLDEFCRDWCYSHNLKTTDLVIKCXXXXXXXXXXXXE 480
           TIEYTDIKAVLNGCEPSLMPVSNRLDEFCRDWCYSHNLKTTDLVIKC            E
Sbjct: 421 TIEYTDIKAVLNGCEPSLMPVSNRLDEFCRDWCYSHNLKTTDLVIKCRRSRFIISHSSIE 480

Query: 481 TNNDYLICXXXXXXXXXXKLPFAVLEVKILEATSSSSVPNKTYSKKHIDPIMVDLTEKLV 540
           TNNDYLIC          KLPFAVLEVKILEATSSSSVPNKTYSKKHIDPIMVDLTEKLV
Sbjct: 481 TNNDYLICIDDNIEINDNKLPFAVLEVKILEATSSSSVPNKTYSKKHIDPIMVDLTEKLV 540

Query: 541 TDNLSVYPTGRNFTLWEMAGKIAGGSNPLACLDGNLNFESVEEMFGAGNALLKKTHDRYQ 600
           TDNLSVYPTGRNFTLWEMAGKIAGGSNPLACLDGNLNFESVEEMFGAGNALLKKTHDRYQ
Sbjct: 541 TDNLSVYPTGRNFTLWEMAGKIAGGSNPLACLDGNLNFESVEEMFGAGNALLKKTHDRYQ 600

Query: 601 SLLNPPTIEFSQSSSQNTAVNISPTVTEREKPRIRYWNEFDDGEEAMDQDFYSCLDEDDD 660
           SLLNPPTIEFSQSSSQNTAVNISPTVTEREKPRIRYWNEFDDGEEAMDQDFYSCLDEDDD
Sbjct: 601 SLLNPPTIEFSQSSSQNTAVNISPTVTEREKPRIRYWNEFDDGEEAMDQDFYSCLDEDDD 660

Query: 661 EYTHDTGLIRFNPSFIIAIYHLLSKFQIAFGIIDDVQARKSLLRDAGKSYNXXXXXXXXX 720
           EYTHDTGLIRFNPSFIIAIYHLLSKFQIAFGIIDDVQARKSLLRDAGKSYN         
Sbjct: 661 EYTHDTGLIRFNPSFIIAIYHLLSKFQIAFGIIDDVQARKSLLRDAGKSYNSIDTDTSIL 720

Query: 721 XXXXXERNDVNKFWELEEQNSESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFK 780
                ERNDVNKFWELEEQNSESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFK
Sbjct: 721 TSSSSERNDVNKFWELEEQNSESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFK 780

Query: 781 SLNDDTQLENETXXXXXXXXXXXXXXXXXXXXXXXMFSRFTFAPTWHYITG 831
           SLNDDTQLENET                       MFSRFTFAPTWHYITG
Sbjct: 781 SLNDDTQLENETSILTMIFISLSISLILGAWSLLLMFSRFTFAPTWHYITG 831

>Kwal_56.23410
          Length = 825

 Score =  370 bits (949), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 281/859 (32%), Positives = 430/859 (50%), Gaps = 86/859 (10%)

Query: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRP-NSIEDDPELRSLKK 59
           MKFG+QI +KSVPEW+L+NIDY+ LK  ++  TT +    PE +P +S+ +D EL  L +
Sbjct: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFK----PEKQPASSVNEDAELMWLYR 56

Query: 60  LFRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDE--NKKLRRIKLINQHLDRCN 117
            F++QF  +N F+ MK+KE STR+VS+E+ + +L     E    K R++ LI+ HLD CN
Sbjct: 57  AFQTQFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCN 116

Query: 118 LELQKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHE-GVSMLT 176
           +EL ++ R+LILQKIA+RKL KKFLK+YPY   +A++F+  + NCPE +   E G+S   
Sbjct: 117 MELLRICRFLILQKIALRKLLKKFLKYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTK 176

Query: 177 VDLDPYLLEISLIVDLLHEMEQDADQQPVDSGNTKTGNTSNSRANSNV-GITSG--TAPX 233
           +DLDPYLLE+SL+VD+L E+EQ A      SG  + G+ ++    S + G   G  +AP 
Sbjct: 177 LDLDPYLLEVSLVVDVLQELEQAA------SG--RKGSLTHETMKSEMPGEIEGAHSAPM 228

Query: 234 XXXXXXXXXXXXXXXTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVI 293
                           L FD  FL K + L +FL++ ES  ++KFLL+ LGF + DD +I
Sbjct: 229 ASHADSD---------LAFDSIFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMI 279

Query: 294 ATSKKIL--SGDALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPGX 351
             S++ L  S    L+    S K+ R  +       A  S + +  + P +    S    
Sbjct: 280 LVSQQSLKDSSSTSLTANGTSGKTPRTVKSFHDLRLA--SDQNENVALPMISDIRSSQQT 337

Query: 352 XXXXXXXXXXXXAHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPSSNDSILLCHVG 411
                                +KP   V +       N  P ++V+   +   +++CHVG
Sbjct: 338 EIAMLD---------------SKP---VPSFLEDDAINRHPTIVVNGSRTCKCLVMCHVG 379

Query: 412 GLRNHISTDTIEYTDIKAVLNG------CEPSLMPVSNRLDEFCRDWCYSHNLKTTDLVI 465
           GLRNHI ++ +    + +VL+          S   V+  + + C +W  SH+L       
Sbjct: 380 GLRNHIVSENVSKKKLASVLSNKSLDTLETESETEVTTPIGKLCLEWIKSHSLHQCG--P 437

Query: 466 KCXXXXXXXXXXXXETN-NDYLICX-XXXXXXXXXKLPFAVLEVKILEATSSSSVPNKTY 523
           K             E N  +YL+C           K+P AV+E++   +  S  + ++  
Sbjct: 438 KISTQRTRFTKAVGEPNLTEYLVCVDESIVLAGSKKVPHAVVEIR---SQQSGGMLHRKE 494

Query: 524 SKKHIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEM------AGKIAGGSNPLACLD-GNL 576
             K  D ++  L EK+  +++S YP   + TLW++      A  +  G    AC    + 
Sbjct: 495 GYK--DELITTLIEKMYENHISCYPLKEDQTLWKLLYQAANAEDLKSGLFSAACPSLTSF 552

Query: 577 NFESVEEMFGA--GNALLKKTHDRYQSLLNPPTIEFSQSSSQNTAVNISPTVTEREKPRI 634
           N ES+ E+  +     +  K   R  S            S +     ISP      KP I
Sbjct: 553 NSESIFEIGESELSRMIAAKGEQRRASFAGK-----KPKSRKTKEQLISPQAN--SKPPI 605

Query: 635 RYWNEFDDGEEAMDQDFYSCLDEDDDEYTHDTGLIRFNPSFIIAIYHLLSKFQIAFGIID 694
           RYWNEFD+GEEA ++ FY   +    E   D G I FN +FI A Y+     +    +  
Sbjct: 606 RYWNEFDNGEEAGNESFYRDTEAMPFEGEMDNGFIVFNRNFINATYNFSESLRRFLTLSS 665

Query: 695 DVQARKSLLRDAG--KSYNXXXXXXXXXXXXXXERNDVNKF--WELEEQNSESIYEFEHD 750
           D   ++ LL D+   +S N              ER D N++  + +E+++S+S+YEF+HD
Sbjct: 666 DEPEKRPLLTDSQHRQSINSFTTSSSLNTTSSAER-DYNRYINYTIEQEDSQSVYEFKHD 724

Query: 751 QVISFFYVSSLLISCLTTGVTIGIMTSLFKSLNDDTQLENETXXXXXXXXXXXXXXXXXX 810
           QV++FFY+SSLL+SC+T+G+++GI+ SLF+ LNDD                         
Sbjct: 725 QVVTFFYLSSLLVSCITSGISLGIVASLFRELNDDIVFGAGPGLLTVIIATLLTSLILSC 784

Query: 811 XXXXXMFSRFTFAPTWHYI 829
                +FSRF FAP WHY+
Sbjct: 785 ASLLLLFSRFKFAPWWHYV 803

>YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing a
           SYG1, Pho81 and XPR1 (SPX) N-terminal domain, which may
           be involved in G protein associated signal transduction,
           has weak similarity to uncharacterized C. albicans
           Orf6.8826p [2610 bp, 869 aa]
          Length = 869

 Score =  328 bits (842), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 272/895 (30%), Positives = 430/895 (48%), Gaps = 114/895 (12%)

Query: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL 60
           MKF  +IL+KS+PEWK +NI+Y++LKV I++ T           PN    +  L      
Sbjct: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDN-----PNDSGMEKLLNQCSVA 55

Query: 61  FRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDENK------KLRRIKLINQHLD 114
           F  +F+ +N+F+S+K+KE STRI+S+E+ +  +   K  NK       LR++K+IN H+D
Sbjct: 56  FDQEFQNVNLFVSLKIKEISTRILSVESSI--IDFSKGLNKTSRNRFNLRKLKIINAHVD 113

Query: 115 RCNLELQKLSRYLILQKIAVRKLFKKFLKHYPYGTQ---LAQEFINSLKNCPEFKEGHEG 171
            CN ELQ LSR+LI+Q+IA+RKLFKK L  +P  ++    A E++ S++N    + GHEG
Sbjct: 114 DCNFELQLLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEG 173

Query: 172 VSMLTVDLDPYLLEISLIVDLLHEME---QDADQQPVD----SGNTKTGNTSNS--RANS 222
           +S + +DLDPYLLE+SLIVD+LH++E   +DA +  V+    + + ++ +TS+S    NS
Sbjct: 174 ISFMKLDLDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNS 233

Query: 223 NVGITSGTAPXXXXXXXXXXXXXXXXTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLIN 282
           ++  +  + P                +L+FD   + K   LG FL+S E  + +KF+L+N
Sbjct: 234 SLPASPRSIP---LLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLN 290

Query: 283 LGFCLFDDSVIATSKKIL-SGDALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPP 341
           +GF + DDS+I+TSK+IL + D + S    SI+S + F D Q     S S++++   S  
Sbjct: 291 IGFRIIDDSIISTSKEILDTTDNINSAGNKSIRSAKSFNDLQH--TLSLSKQKNILPS-A 347

Query: 342 VGSPESDPGXXXXXXXXXXXXXAHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPSS 401
           V S E                     + + +   G+ +  L      N  PN++VS  + 
Sbjct: 348 VQSNEKYVSIS---------------ILDTVGNEGSPL--LLTDDNINQHPNMIVSSTAE 390

Query: 402 NDSILLCHVGGLRNHISTDTIEYTDIKAVLNGCEP-----SLMPVSNRLD-----EFCRD 451
           +  I++CHVGGLRNH+ T+ +   D+K +L+         ++  + N LD     +   +
Sbjct: 391 DTCIVMCHVGGLRNHVVTNDLLLRDVKNILSAMRSGNDTKNISALINSLDPSPISKIALE 450

Query: 452 WCYSHNLKTTDLVIKCXXXXXXXXXXXXETNNDYLICXXXXXXX-XXXKLPFAVLEVKIL 510
           W  SH LKT    I+             +  + YLI             LPF +LE+K L
Sbjct: 451 WIQSHRLKT----IEPKLDFKRTRFISADNGDIYLIALDESITIGNVSTLPFPILEIKKL 506

Query: 511 EATSSSSVPNKTYSKKHIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEMAGKIAGGS---N 567
             +S  S      +  + D     L + +VT+         + T W++  ++   +   N
Sbjct: 507 SRSSGLS-----QTAINEDNKFKQLMKSVVTNEFQCSLIPPDLTTWKICLELVHSNELQN 561

Query: 568 PLACL----DGNLNFE---SVEEMFGAGNALLKKTHDRYQSLLNPPTIEFSQSSSQNTAV 620
            L  L       LN +   S +E F  G   L++  D     L  P      S      V
Sbjct: 562 DLFQLLLRDQYKLNSDDSLSPDEFFQLGKDRLEEEFD-----LTGPINNSQGSVDSGRRV 616

Query: 621 NI----SPTVTEREKPRIRYWNEFDDGEE-AMDQDFYSCLDEDDDEYTHDT--------- 666
            I      +  E +K  IRYWNEFD+ EE  +D  FY  +D +    T D          
Sbjct: 617 RIHKKSKQSDNETKKKPIRYWNEFDEQEEDNLDNAFY--IDTNGSRSTTDNEESLLLRNS 674

Query: 667 ----GLIRFNPSFIIAIYHLLSKFQIAFGIIDDVQARKSLLRDAG----KSYNXXXXXXX 718
               G I F+ +FI   Y    K +    I  D +    L +++      S N       
Sbjct: 675 PPDYGFILFSRNFINRTYDFCEKLRNL--IRHDKKTSPDLFQNSKHPHCSSTNYGSVASF 732

Query: 719 XXXXXXXERNDVNKFWELEEQ---NSESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIM 775
                    +DV ++ + ++Q   +S+SIYE+ HD+V++F Y+S+LL SC+   V +GI+
Sbjct: 733 GSQSTSASYDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLTSCIMASVCLGIV 792

Query: 776 TSLFKSL-NDDTQLENETXXXXXXXXXXXXXXXXXXXXXXXMFSRFTFAPTWHYI 829
            SLF+   N++  LE +                        +FSRFT AP WHY+
Sbjct: 793 LSLFRGQSNNEIDLEIQNILIAIIIISLLVSLILICACLLLLFSRFTLAPIWHYV 847

>CAGL0C03696g complement(367135..369630) similar to sp|P38966
           Saccharomyces cerevisiae YDR089w, start by similarity
          Length = 831

 Score =  309 bits (792), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 251/877 (28%), Positives = 415/877 (47%), Gaps = 118/877 (13%)

Query: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL 60
           MKFG+QILDKSVP+WKL+NIDY++LK  I++ T+ +        PNS     +   L+  
Sbjct: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTA------PNS----NDFEGLEVS 50

Query: 61  FRSQFEMINVFISMKLKECSTRIVSIENYLTQL--HLIKDENKKLRRIKLINQHLDRCNL 118
           F+     IN+F+S+KLKE S+++VSIE+ +T+L  + I D  K LRRIK I  +L+ CN 
Sbjct: 51  FKQNIVQINLFVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCND 110

Query: 119 ELQKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVD 178
            LQKLSR++I+Q+IA+RKLFKK  KHY    ++AQ+FI+S++NC E ++G+EGVS   +D
Sbjct: 111 LLQKLSRFVIVQRIALRKLFKKITKHYG-DKKIAQQFISSIQNCNELRDGYEGVSFKNLD 169

Query: 179 LDPYLLEISLIVDLLHEME---------QDADQQPVDSGNTKTGNTSNSRANSNVGITSG 229
           L  YL+E+SLI+D+L +M          +D   +  +     T  T N +      + S 
Sbjct: 170 LQSYLVEVSLIMDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNKKP-----LVSF 224

Query: 230 TAPXXXXXXXXXXXXXXXXTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFD 289
           T                    +FD     K   + S L+  ++ +++KFLLI LGF +FD
Sbjct: 225 TTNQ-----------------QFDQVLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFD 267

Query: 290 DSVIATSKKILSGDALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPPVGSPESDP 349
            ++   S+ I++ +     R  S++S + F ++ R     + +R  T S+  + + E   
Sbjct: 268 QNLQGISRDIIASEPNSEVR--SLRSKKSFYESDR----PALKRLHTSSTEYLNNAEE-- 319

Query: 350 GXXXXXXXXXXXXXAHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPS----SNDSI 405
                            ++  P  K  + +   Y+S +   +P++L+ Y      +N+ I
Sbjct: 320 ---------MEQSKCKAVMLTPSGKVDSSI---YDSKKITSYPSVLLEYEKNNVIANECI 367

Query: 406 LLCHVGGLRNHISTDTIEYTDIKAVLNGCEPSLMPVSNRLDEFCRDWCYSHNLKTTDLVI 465
           ++CHVGGLR  + TD +   +I   L         +S+ L +   DW   H +K   + I
Sbjct: 368 VICHVGGLRGKVVTDKLHINEISEYLKNSNKQ--AISDPLAKIALDWICDHGMKECGIEI 425

Query: 466 KCXXXXXXXXXXXXETNNDYLICXXXXXXXXXXK------LPFAVLEVKILEATSSSSVP 519
                         + +N Y+I                  +  ++++++++  T++ S  
Sbjct: 426 ----GFKRTRYFCNKHSNLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVV--TTNFSSD 479

Query: 520 NKTYSKKHIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEMAGKIAGGSNPLACLDGNLNFE 579
           NK+ +KK       ++ EK+++  +  +P   +F   ++   I   +     +   L  E
Sbjct: 480 NKSLAKKS-----QEIYEKIISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIH-RLMLE 533

Query: 580 SV-----------EEMFGAGNALL-----KKTHDRYQSLLNPPTIEFSQSSSQNTAVNIS 623
           ++           +E FG G  LL      +  D Y   +  PT        +N  ++ +
Sbjct: 534 NIYELNENNKITEDEFFGIGFDLLLDICSSEFKDNYYQKVESPT-RTPNDWKKNNLLSKN 592

Query: 624 PTVTEREKPRIRYWNEFDDGEEAMDQDFYSCLDEDDD------EYTHDTGLIRFNPSFII 677
              TE  KP IRYWNEFDD EE      +   D  DD      +   D G I F+  FI 
Sbjct: 593 KN-TENNKPAIRYWNEFDDLEEENGGGGFYIQDRTDDLESNELQQERDYGFIHFSKDFIE 651

Query: 678 AIYHLLSKFQIAFGIIDDVQ-ARKSLLRDAGKSYNXXXXXXXXXXXXXXERN--DVNKFW 734
           + Y  L  F+   G  D+ + A    L D  + +                 +  D+ K  
Sbjct: 652 STYSSLQSFRDFLGFKDNNRTAIDPALLDLSERFGNSNYGSISSKGSILSNSVEDIRKLI 711

Query: 735 E---LEEQNSESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFKSLNDDTQLENE 791
           E    E +NSES+Y ++HDQV+S  Y+ +LL++C T+G+ +GI+ S+F   N D +++  
Sbjct: 712 EHQMKEIENSESVYVYKHDQVLSLMYLFALLMACATSGICMGIVLSVFNGDNSDIEIDVG 771

Query: 792 TXXXXXXXXXXXXXXXXXXXXXXXMFSRFTFAPTWHY 828
                                   +FSR+T+AP WHY
Sbjct: 772 KTLIITVILSLGISLGLITLCLLLLFSRYTYAPIWHY 808

>Scas_636.12
          Length = 837

 Score =  301 bits (770), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 265/894 (29%), Positives = 419/894 (46%), Gaps = 136/894 (15%)

Query: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL 60
           M F + +LDKSVP+WK  N++Y +LK  I R T                    L +L  +
Sbjct: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHT-------------------RLETLDAM 41

Query: 61  FRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDENKKLRRIKLINQHLDRCNLEL 120
           F+ QF+ IN+F+S+K+KE STRI+S+E  + Q  + K  +      K++  H++ CN EL
Sbjct: 42  FKEQFQNINLFVSLKIKEISTRIMSVEASILQQTMRKGPSN----FKIVFSHVNDCNEEL 97

Query: 121 QKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVDLD 180
           Q LSRYLI+QK+AV+KL ++ +  +  G+ + +E++  L    +++ G++GVS   +DLD
Sbjct: 98  QMLSRYLIVQKLAVKKLLRRLISSHD-GSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLD 156

Query: 181 PYLLEISLIVDLLHEMEQDADQQPVDSGNTKTGNTSNSRANSNVGITSGTAPXXXXXXXX 240
           PYL+EISLIVD+L++++        ++ N  +     S+ N  + + S   P        
Sbjct: 157 PYLIEISLIVDVLNDLKLKV---TTNNNNDVSSTLLTSKHNETLNLRSNENPPSIQNNGE 213

Query: 241 XXXXXXXXTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVIATSKKIL 300
                    + FD  F+ K  PL   ++S E+ +E KF+L++  F + DD +I+TSK I+
Sbjct: 214 DIIRS---AIDFDTIFMDKCLPLHRLIVSNENIEEFKFMLLSNEFRIVDDQLISTSKDII 270

Query: 301 SG------DALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPGXXXX 354
                   +  + K   SI+S + F+       +S+ QR ++ +S   G   S       
Sbjct: 271 VSTEQNRPNLNVKKSMASIRSFQTFQ-------SSTKQRNNSATSTSHGGLPS------- 316

Query: 355 XXXXXXXXXAHNIL------FEPLAKPGADVTNLYNSTEENLFPNLLVSYPSSNDS---I 405
                    + N+L       +P   P     + +N +     P LL+    +N S   I
Sbjct: 317 ------LRLSQNMLSISLLDLDPTGVPRFMKDDAFNQS-----PTLLIHLQDTNISPNCI 365

Query: 406 LLCHVGGLRNHISTDTIEYTDIKAVLNGCEPSLMPVSNR----LDEFCRDWCYSHNLKTT 461
           L+CH+GGLR+H+ T+ I    I  VL+      +P SN     +D    +W  +  L+ T
Sbjct: 366 LMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIPPSNSNFNPIDNMALEWIMNQKLRHT 425

Query: 462 DLVI--KCXXXXXXXXXXXXETNNDYLICXXXXXXXXXXKLPFAVLEVKILEATSSSSV- 518
            + I  K               + D  IC            P +++E+K+L   S SS+ 
Sbjct: 426 GMKIDIKRTRLIFSTEEFTYLISIDEKICITFNDEKFY--FPHSIVEIKLLSKKSPSSMH 483

Query: 519 ------PNKTYSKKHIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEMAGKIAGGSNP---- 568
                 P K+ ++K +  I  ++ EK    N+  +   RN+TLW++   I    N     
Sbjct: 484 ANNINNPTKSMNEK-LQHIFREVYEK----NIQCFSLDRNWTLWKICYSICQLPNVNDND 538

Query: 569 -----LAC---LDGNLNFESVEEMFGAGNALLKKTHDRYQSLLNPPTIE--FSQSSSQNT 618
                L C   L  N +  S EE F  G       HD    L  PP  E   ++S SQ+T
Sbjct: 539 LFKLLLQCDYTLPPNDSL-STEEFFALG-------HDGILELCYPPFQEEIRNKSQSQST 590

Query: 619 AVNISP-----TVTEREKPR-IRYWNEFDDGEEAMD---QDFYSCLDEDDDEYTH-DTGL 668
             N  P     +   ++K R  RYWNEFDD + +++   Q FY   DED+   +  D GL
Sbjct: 591 HSNFKPHPYNESKANKQKERTFRYWNEFDDDQASINRENQHFYQ--DEDESICSQEDHGL 648

Query: 669 IRFNPSFIIAIYHLLSKFQ-IAFGIIDDVQARKSLLRDAGKSY---NXXXXXXXXXXXXX 724
           + FN  FI +++    KF+ I   II   + ++   +  G S                  
Sbjct: 649 VTFNRPFIDSMF---DKFKSIKSMIIPRKRKQRKKRQQDGTSIYGSTYVLGSRSTLTLSP 705

Query: 725 XERNDVNKFWELEEQN---SESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFK- 780
              +D+    E +  N   SESIYEF+HDQV++ FY++SLLISC+T+G+ +GI+ +LF+ 
Sbjct: 706 GSESDLEALLEYDPSNVQESESIYEFKHDQVLTVFYLASLLISCMTSGLCLGIVLALFRE 765

Query: 781 SLNDDT-QLENETXXXXXXXXXXXXXXXXXXXXXXXMFSRFTFAPTWHYITGVV 833
           S NDD    +                          +FSRFT AP WHYI+  V
Sbjct: 766 SENDDVIVFDGINFLLAVIIGSLLVSLILIIVSLLLLFSRFTLAPLWHYISCFV 819

>AGR160W [4471] [Homologous to ScYDR089W - SH]
           complement(1045983..1048493) [2511 bp, 836 aa]
          Length = 836

 Score =  280 bits (715), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 241/877 (27%), Positives = 391/877 (44%), Gaps = 138/877 (15%)

Query: 14  EWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKLFRSQFEMINVFIS 73
           EW L+ +DY+ L+  +RR TT   G++         D   L  L   FR++   +N+F+S
Sbjct: 23  EWTLNGMDYEYLREEVRRATTYAGGREET-------DGRVLGRLLGAFRAELSNVNLFVS 75

Query: 74  MKLKECSTRIVSIENYLTQLHL--IKDENKKLRRIKLINQHLDRCNLELQKLSRYLILQK 131
           +K++E + R+ ++E  + +     + +   +  R++  N  L +C+ +LQ+L+RYL+LQK
Sbjct: 76  LKMREITARLETVEAGIVEWRRRKVGEPGARALRLRRANGQLAQCSADLQRLARYLLLQK 135

Query: 132 IAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVDLDPYLLEISLIVD 191
            A+RKL ++ +++YPY     + F+ +L  C E ++GHEGV    VDL+PYLLE+SLI+ 
Sbjct: 136 AALRKLTRRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTAVDLEPYLLEVSLIMG 195

Query: 192 LLHEMEQDADQQPVDSGNTKTGNTSNSRANSNVG--ITSGTAPXXXXXXXXXXXXXXXXT 249
           +L+++E             ++   +    N+ +G  ITS                     
Sbjct: 196 VLYDLEM----------KDRSVERAREPPNNVLGRPITS--------------------C 225

Query: 250 LKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVIATSKKILSGDALLSKR 309
           L FD  FL K++ L   LIS+++  E+KFLL+ L + + DD V++TS+++ +G AL    
Sbjct: 226 LTFDTLFLGKYHLLQRLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANG-ALPGGD 284

Query: 310 --KGSIK--SLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPGXXXXXXXXXXXXXAH 365
             KGS K  SLR F     +  A+   R    SS P                       H
Sbjct: 285 PIKGSCKAQSLRFF-----DFGAARPARMRRNSSLP------------DKLRTLSQLRTH 327

Query: 366 NILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPSSNDSILLCHVGGLRNHISTDTIEYT 425
                PL K              N  PN+ V     +  +L+CHVGG+RNHI T  +   
Sbjct: 328 ---MYPLDK------QFMTDEAYNQHPNIFVRGQQDDACLLMCHVGGMRNHIITQNLPLP 378

Query: 426 DIKAVLNGCEPSL--MPVSNRLDEFCRDWCYSHNLKTTDLVIKCXX----XXXXXXXXXX 479
            +   L   + S   +P+S  LD+ C DW  ++NL  +D VI                  
Sbjct: 379 LVLECLTKRQWSHKNIPLSA-LDKLCLDWVRTNNLGLSDFVISVKRTRFFTKRDEVINGT 437

Query: 480 ETNNDYLICXXXXX-XXXXXKLPFAVLEVKILEATSSSSVPNKTYSKKHIDPIMVDLTEK 538
              + YLI            KLP A +EV+ L  T++   PNK+ +K  ID  +  L + 
Sbjct: 438 AFTSVYLITLDEEVFINNTLKLPHAFVEVRKL--TNTVVTPNKSTNK--IDTELSHLIDV 493

Query: 539 LVTDNLSVYPTGRNFTLWEMAGKIAGGSNPLACLDGNLNFESVEEMFG-----AGNALLK 593
           ++  +LS YP   + TLW+MA  +     P   ++ ++        F      +G+ L  
Sbjct: 494 ILDMSLSCYPLAPSNTLWKMAYSLK--DTPAEEIERSMYAALAAADFQDSSNISGDILFS 551

Query: 594 KTHDRYQSLLNP------PTIEFSQSSSQNTAVNISPTVTEREKPRIRYWNEFDDGEEAM 647
               R   +  P      P++  S   SQ+     SP+ +     R RYWNE D+  +A 
Sbjct: 552 IGRRRLDQMSTPTVPQRTPSLAKSSHKSQDAQ---SPSSSGETPQRKRYWNELDEQNDAD 608

Query: 648 DQDFYSCLDEDDDE-----YTHDTGLIRFNPSFIIAIYHLLSKFQIAFGIIDDVQARKSL 702
            QD   C   D +E     Y  + G I+F+ +FI+  Y  L K    F          ++
Sbjct: 609 AQD---CFYRDPEELHTGDYEAEHGFIKFDKNFILNFYQYLHKLNHIFCYQKKPPKEYTV 665

Query: 703 LRDAGKSYNXXXXXXXXXXXXXXERNDVNKFWELEEQNS--------------------- 741
           +  +G S                + ++   +  LE Q++                     
Sbjct: 666 VPCSGDS----EITRSELTPLIRQNSEARSYSALEVQSTLPGGGSQLQVPNWDDEAALVC 721

Query: 742 ----ESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFKSL-NDDTQLENETXXXX 796
               + +Y ++HD+V+S FY+++LL+SC+TTG T+GIM SLF +L ND T+ E       
Sbjct: 722 YDELDVLYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFSLFSALGNDQTEFEGSNYITA 781

Query: 797 XXXXXXXXXXXXXXXXXXXMFSRFTFAPTWHYITGVV 833
                              +FSR+  AP WHY + ++
Sbjct: 782 LILVSLVVSLMLSSFSLLLLFSRYHMAPWWHYSSCII 818

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 1  MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELR 55
          MKFG    +  VPEW    ++Y+ LK  I++ T  +E    E   +S E DP  R
Sbjct: 1  MKFGKTFPNHQVPEWSHQYVNYKGLKKLIKQITQTQEKLHREQHDHSGETDPPAR 55

>Kwal_27.12292
          Length = 217

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 1  MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREG--QDPEFRPNSIEDDPELRSLK 58
          MKFG    +  VPEW    ++Y+ LK  I+  TTV+E   +  + R N  E   + R+  
Sbjct: 1  MKFGKTFPNHQVPEWSHEYVNYKNLKKLIKEITTVQESYHKARQTRTNGDEAPLKARNSA 60

Query: 59 KLFRSQFE 66
          KL  + FE
Sbjct: 61 KLEENFFE 68

>AGR223W [4534] [Homologous to ScYPL110C - SH]
           complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 20/103 (19%)

Query: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELR----- 55
           MKFG    +  VPEW    ++Y+ LK  I+  T V++    + +  + +D P  R     
Sbjct: 1   MKFGKTFPNHQVPEWAHKYVNYKGLKKQIKEITLVQDALFRQEQGAASQDGPARRRGRES 60

Query: 56  --------SLKKLFRSQF-------EMINVFISMKLKECSTRI 83
                    +KKL  + F       E ++ F +M+  E   R+
Sbjct: 61  KEQYLGHPEVKKLLAAFFFALDRDIEKVDGFYNMQFMEYDRRL 103

>Scas_704.39
          Length = 916

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 4/51 (7%)

Query: 1  MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQ----DPEFRPNS 47
          MKFG  + +  +PEWK   IDY+  K  I+      E Q    DP F+  S
Sbjct: 1  MKFGDHLRESIIPEWKDKYIDYKSSKKRIKHFRAKWENQSIYNDPVFQKKS 51

>YPR027C (YPR027C) [5461] chr16 complement(620420..621253) Protein
           with similarity to Ynl019p and Ynl033p [834 bp, 277 aa]
          Length = 277

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 149 TQLAQEFINSLKNCPEFKEGHEGVSMLTVDLDPYLLEISLIVDLLHEMEQDADQQP 204
           T+L  + I ++ +C  F  G    +M++  L   +L  SLI++L++++E D   +P
Sbjct: 63  TKLTLQVIQTMVSC--FSVGENPANMISCGLGVVILMFSLIIELINKLENDGINEP 116

>CAGL0K10252g complement(997315..1001118) similar to sp|Q01476
           Saccharomyces cerevisiae YOR124c UBP2 ubiquitin-specific
           proteinase, hypothetical start
          Length = 1267

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 11/74 (14%)

Query: 370 EPLAKPGADVTNLYNSTEENLFPNLLVSYP-SSNDSIL---LCHVGGL-----RNHISTD 420
           EP+  P ADVTN+ +   + L+PN+    P  ++D +L   LC VG L     ++ ++++
Sbjct: 27  EPI--PSADVTNIEDDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSGDNKSILNSN 84

Query: 421 TIEYTDIKAVLNGC 434
           T+EY+  +  + G 
Sbjct: 85  TLEYSKQRPHIKGS 98

>Scas_597.8
          Length = 1065

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 13/67 (19%)

Query: 83  IVSIENYLTQLHLIKDENKKLRRIKLINQHLDRCNLELQKLSRYLILQKIAVRKLFKKFL 142
           I  IE+Y   L +I+ E +K+R+IKL  + L R      KLS+Y          LF+  L
Sbjct: 875 IEKIEDYEKYLKIIETEEEKIRKIKLQQEALRR------KLSQY-------TNPLFELEL 921

Query: 143 KHYPYGT 149
           KH P G+
Sbjct: 922 KHPPAGS 928

>Kwal_55.21029
          Length = 1105

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 53/129 (41%), Gaps = 12/129 (9%)

Query: 519 PNKTYSKKHIDPIMVDLTEKLVTDNLSV--YPTGRNFTLWEMAGKIAGGSNPLACLDGNL 576
           P++   +K   P   ++ + + +   S+  YP  + FT  E  G +   SNP   LD  L
Sbjct: 271 PSREIKRKLTSPERWEIRQLIASGAASIDDYPEMQEFTEQE-DGTVRLHSNPADELDVEL 329

Query: 577 NFESVEEMFGAGNALLKKTHDRYQSLLNPPTIEFSQSSSQNTAVNISPTVTEREKPRIRY 636
           N +        G   LK   DR Q    P   +  Q S   TA+N S  + E    +IR 
Sbjct: 330 NTDD-------GPLFLKGEIDRSQKQEMPKIAKVPQGSLNRTALNGSEIMNEHRLEKIRQ 382

Query: 637 WNEFDDGEE 645
             E   G+E
Sbjct: 383 KKEV--GQE 389

>KLLA0C09570g complement(831137..832621) similar to sp|P09032
           Saccharomyces cerevisiae YOR260w GCD1 translation
           initiation factor eIF2bgamma subunit singleton, start by
           similarity
          Length = 494

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 433 GCEPSLMPVSNR-LDEFCRDWCYSHNLKTTDLVI 465
           G   +L+PV+NR + EF  DWC     K  +LVI
Sbjct: 26  GVPKALLPVANRSMIEFVLDWCEQAQFKEVNLVI 59

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member
          of the glycerophosphoryl diester phosphodiesterase
          family, contains six ankyrin (Ank) repeats and a SYG1,
          Pho81 and XPR1 (SPX) N-terminal domain, has weak
          similarity to S. cerevisiae Pho81p, which is a
          cyclin-dependent kinase (CDK) inhibitor [3672 bp, 1223
          aa]
          Length = 1223

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 1  MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVRE 37
          MKFG    +  +PEW    + Y+ LK  I+  T ++E
Sbjct: 1  MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEITRLQE 37

>CAGL0F02387g complement(229207..232065) similar to sp|P25360
          Saccharomyces cerevisiae YCR037c PHO87 or sp|P39535
          Saccharomyces cerevisiae YJL198w, start by similarity
          Length = 952

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 1  MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTT--VREG----QDPEFRPNSIEDDPEL 54
          M+F   +   +VPEW+ H +DY +LK  I    T  ++ G    Q PE  P   E+D  +
Sbjct: 1  MRFSHFLKYNAVPEWQNHYMDYSELKNLIYTLQTDELKNGPIGNQPPERGPVVEEEDEVI 60

Query: 55 RSLKKLF 61
           S  K F
Sbjct: 61 ASSSKHF 67

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
          which truncation and overexpression can suppress
          lethality of Gpa1p deficiency, member of the divalent
          anion:Na+ (DASS) family of membrane transporters [2709
          bp, 902 aa]
          Length = 902

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 1  MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPE 42
          MKF   + + ++PEW+   IDY   KVG ++    +E  D E
Sbjct: 1  MKFADHLTESAIPEWRDKYIDY---KVGKKKLRRYKEKLDAE 39

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
          cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 1  MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVRE 37
          MKFG  +L   +PEW    ++Y+ LK  ++  T V++
Sbjct: 1  MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEITKVQD 37

>CAGL0M07678g complement(767857..769278) similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w, hypothetical start
          Length = 473

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 578 FESVEEMFGAGNALLKKTHDRYQSLLNPPTIEFSQSSSQNTAVNISPTVTEREKPRIRYW 637
            E+VE  +GAG+A L   HD  + +     I+F  S  Q ++ NI+    E    RI  W
Sbjct: 107 LEAVEAKYGAGDAGL---HDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKW 163

>CAGL0M13827g 1360609..1366131 similar to sp|Q04952 Saccharomyces
            cerevisiae YMR306w FKS3, hypothetical start
          Length = 1840

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 373  AKPGADVTNLYNSTEENLFPNLLVSYPSSNDSILLCH 409
            A PG  + NL+ S   +LF  LL++  S N   +LCH
Sbjct: 1261 AHPGFHLNNLFISLSLHLFFMLLINLGSLNHETILCH 1297

>Kwal_33.13618
          Length = 891

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 1  MKFGTQILDKSVPEWKLHNIDYQQLK 26
          MKF   +   +VPEW+ H ++Y QLK
Sbjct: 1  MKFSHSLKYNAVPEWQEHYLNYSQLK 26

>AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C
           (VTC3) - SH] complement(682963..685497) [2535 bp, 844
           aa]
          Length = 844

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 83/219 (37%), Gaps = 32/219 (14%)

Query: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDP-EFRPNSIEDDPELRSLK- 58
           M FG ++ +   P WK   IDY  LK  ++       G  P E +     D  E  + + 
Sbjct: 1   MLFGVKLANDIYPPWKDWYIDYDGLKKLLKESVIKDLGLSPKESKRKGKGDTDEHWTARN 60

Query: 59  -----KLFRSQFEMINVFISMKLKECSTRIVSIENYLTQLHLIKDENKKLRRIKL--INQ 111
                +    + E +  F S K  E   ++  +E  L       D    L+ + L  I +
Sbjct: 61  ESNFVEALDRELEKVYSFQSGKYTEIMGKLERLEEEL-------DGADALQSLDLGHIRE 113

Query: 112 HLDRCNLELQKLSRYLILQKIAVRKLFKKFLK---HYPYGTQLAQEFINSLKNCPEFKEG 168
            L++   E Q+L R+  L      K+ KK  K    YP    L Q     LK  P   E 
Sbjct: 114 ELEQALTEAQELDRFSRLNFTGFIKIVKKHDKLHEGYPSVKSLLQ---VRLKALPFHSE- 169

Query: 169 HEGVSMLTVDLDPYLLEISLIVDLLHEMEQDADQQPVDS 207
                    +  P L +IS + D+L +    A +  ++S
Sbjct: 170 ---------EYSPLLYKISFLYDVLRKSTDTASKSLIES 199

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,785,118
Number of extensions: 1104367
Number of successful extensions: 4296
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4370
Number of HSP's successfully gapped: 48
Length of query: 839
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 729
Effective length of database: 12,788,129
Effective search space: 9322546041
Effective search space used: 9322546041
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)