Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F14487g30228610061e-138
Kwal_56.234133151412044e-18
CAGL0L11704g3361391632e-12
Scas_576.23491411612e-12
YER161C (SPT2)3331451594e-12
AGR161C3371391418e-10
Scas_699.2053850720.48
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F14487g
         (298 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843 Saccha...   392   e-138
Kwal_56.23413                                                          83   4e-18
CAGL0L11704g complement(1248417..1249427) similar to sp|P06843 S...    67   2e-12
Scas_576.2                                                             67   2e-12
YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like c...    66   4e-12
AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH] (1048663..1...    59   8e-10
Scas_699.20                                                            32   0.48 

>KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein singleton, start by
           similarity
          Length = 302

 Score =  392 bits (1006), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 207/286 (72%)

Query: 1   MSFLAKLQQLKQTTKINEPNHSANQNKAKSLQSEEKLLPKDYVREVDPAIQRLKEARRLK 60
           MSFLAKLQQLKQTTKINEPNHSANQNKAKSLQSEEKLLPKDYVREVDPAIQRLKEARRLK
Sbjct: 1   MSFLAKLQQLKQTTKINEPNHSANQNKAKSLQSEEKLLPKDYVREVDPAIQRLKEARRLK 60

Query: 61  QGISSTSTKPAAKARHKASSPKDEAPIYKKKPGVNTTSGKYPVVVPKREPIKKLSFDELM 120
           QGISSTSTKPAAKARHKASSPKDEAPIYKKKPGVNTTSGKYPVVVPKREPIKKLSFDELM
Sbjct: 61  QGISSTSTKPAAKARHKASSPKDEAPIYKKKPGVNTTSGKYPVVVPKREPIKKLSFDELM 120

Query: 121 KRAEQKSRXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXVKEPKSKVMVKSFNRFAQPNX 180
           KRAEQKSR               F               VKEPKSKVMVKSFNRFAQPN 
Sbjct: 121 KRAEQKSREGPKEDKKPLPKKLGFDKAAKPKAATKDAKPVKEPKSKVMVKSFNRFAQPNE 180

Query: 181 XXXXXXXXXXXXQIMARHGDQHYDSENXXXXXXXXXXXXXXXXXQGSKSQPYDRDEIWSI 240
                       QIMARHGDQHYDSEN                 QGSKSQPYDRDEIWSI
Sbjct: 181 KLAKKLKLKEKKQIMARHGDQHYDSENDEDLSDFIEDDDLDECEQGSKSQPYDRDEIWSI 240

Query: 241 FNKGSKRKYFXXXXXXXMXXXXXXXXXXXXRATKMAKLEDKREQAW 286
           FNKGSKRKYF       M            RATKMAKLEDKREQAW
Sbjct: 241 FNKGSKRKYFDSDDDDDMEANEMEIFEEEERATKMAKLEDKREQAW 286

>Kwal_56.23413
          Length = 315

 Score = 83.2 bits (204), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/141 (44%), Positives = 83/141 (58%), Gaps = 18/141 (12%)

Query: 1   MSFLAKLQQL-KQTTKINEPNHSA-------NQNKAKSLQSEEKLLPKDYVREVDPAIQR 52
           MSFLAK  QL K+    N+   S        N+++   L+ E  LLP+ YVRE DPAI+R
Sbjct: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIRR 60

Query: 53  LKEARRLKQGISSTSTKPAAKARHKASSPKDEAPI-----YKKKPGVNTTSGKYPVVVPK 107
           LKE RR +Q  ++   KPAA +R +    KDE        +++K G +  S K PV   K
Sbjct: 61  LKELRRKEQLKNAPKNKPAAPSRKR----KDENSANTETKFRRKVGESLQSRK-PVAPVK 115

Query: 108 REPIKKLSFDELMKRAEQKSR 128
           R P+KKLSFDELMK AE+KS+
Sbjct: 116 RTPLKKLSFDELMKEAEEKSK 136

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 230 QPYDRDEIWSIFNKGSKRKYFXXX-XXXXMXXXXXXXXXXXXRATKMAKLEDKREQAW 286
           Q ++RDEIW++FNKG KR+ F        M            RATKMAKLEDKRE+ W
Sbjct: 243 QGFNRDEIWAMFNKGKKRRDFENDYESDDMEVNEMDIMEEEERATKMAKLEDKREEEW 300

>CAGL0L11704g complement(1248417..1249427) similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein, start by similarity
          Length = 336

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 74/139 (53%), Gaps = 21/139 (15%)

Query: 1   MSFLAKLQQLKQTT--KINEPNHSANQNKAKSLQSEEKLLPKDYVREVDPAIQRLKEARR 58
           MSFL+KL +LK+T    +  P   AN+      Q E  LLPK+YVRE DPA+ RLKE RR
Sbjct: 1   MSFLSKLSELKKTKPKTVISPPQKANK------QEEISLLPKNYVREEDPAVTRLKELRR 54

Query: 59  ---LK---------QGISSTSTKPAAKARHKASSPKDEAPIYKKKPGVNTTSGKYPVVVP 106
              LK         + +  T +   A    K  +  D   + + K  V +     P+ V 
Sbjct: 55  QELLKNPELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLVSRFKRKVGSDKPAVPIQVK 114

Query: 107 KR-EPIKKLSFDELMKRAE 124
           K+ +PIKKLSF+ELMK+AE
Sbjct: 115 KKPQPIKKLSFEELMKQAE 133

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 227 SKSQPYDRDEIWSIFNKGSKRKYF------XXXXXXXMXXXXXXXXXXXXRATKMAKLED 280
           SK   YDRDEIW++FNKG KR Y              M             A +MA+LED
Sbjct: 253 SKDPGYDRDEIWAMFNKGRKRSYNEYMDYEEEDDFDAMEANEMEILEEEEEAARMARLED 312

Query: 281 KREQAW 286
           KRE+AW
Sbjct: 313 KREEAW 318

>Scas_576.2
          Length = 349

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 78/141 (55%), Gaps = 18/141 (12%)

Query: 1   MSFLAKLQQLKQTTKINEPNHSANQN---KAKSLQSE-EKLLPKDYVREVDPAIQRLKEA 56
           MSFL+KL QLK+ +  N    + ++    + KS++ +   LLP +Y+R+ DPA++RLKE 
Sbjct: 1   MSFLSKLSQLKKASTTNTSMKNTSKESIPRKKSIEEDIPSLLPTNYIRDEDPAVRRLKEL 60

Query: 57  RRLKQ------GISSTSTKPAAKARHKASSPKDEAPI-----YKKKPGVNTTSGKYPV-- 103
           RR +Q            T P+   + K+    D         +KKK G +T +   PV  
Sbjct: 61  RRKEQIKNGEFAKKHKKTNPSTTTKRKSKKDDDNLAADGYSRFKKKLG-STHTRPTPVRT 119

Query: 104 VVPKREPIKKLSFDELMKRAE 124
           +  K EPIKK+SFDELMK+AE
Sbjct: 120 LTRKMEPIKKISFDELMKQAE 140

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 232 YDRDEIWSIFNKGSKR-KYFXXXXXXXMXXXXXXXXXXXXRATKMAKLEDKREQAW 286
           YDRDEIW++FNKG KR +Y        M            RA +MA+LEDKRE AW
Sbjct: 280 YDRDEIWAMFNKGRKRSEYAYDEEEDDMEANEMEILEEEERAEEMARLEDKREAAW 335

>YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like
           chromatin protein that interacts with Snf1p through a
           conserved domain, negative regulator of HO gene
           transcription [1002 bp, 333 aa]
          Length = 333

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (53%), Gaps = 31/145 (21%)

Query: 1   MSFLAKLQQLKQTT-----KINEPNHSANQNKAKSLQSEEKLLPKDYVREVDPAIQRLKE 55
           MSFL+KL Q++++T     ++ +P    N         E  LLPK+Y+R+ DPA++RLKE
Sbjct: 1   MSFLSKLSQIRKSTTASKAQVQDPLPKKND-------EEYSLLPKNYIRDEDPAVKRLKE 53

Query: 56  ARR---LKQGISSTSTKPAAKARHKASSPKDEAPI-------------YKKKPGVNTTSG 99
            RR   LK G  + + K   K +   SS  ++  I             +K+  G +    
Sbjct: 54  LRRQELLKNG--ALAKKSGVKRKRGTSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAPL 111

Query: 100 KYPVVVPKREPIKKLSFDELMKRAE 124
           K PVV  K EPIKK+SF+ELMK+AE
Sbjct: 112 K-PVVRKKPEPIKKMSFEELMKQAE 135

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 232 YDRDEIWSIFNKGSKR--KYFXXXXXXXMXXXXXXXXXXXXRATKMAKLEDKREQAW 286
           YDRDEIW++FN+G KR    +       M             A KMA+LEDKRE+AW
Sbjct: 261 YDRDEIWAMFNRGKKRSEYDYDELEDDDMEANEMEILEEEEMARKMARLEDKREEAW 317

>AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH]
           (1048663..1049676) [1014 bp, 337 aa]
          Length = 337

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 81/139 (58%), Gaps = 14/139 (10%)

Query: 1   MSFLAKLQQLKQTTKINEPNHSANQNKAK----SLQSEEKLLPKDYVREVDPAIQRLKEA 56
           MSFLAKL QLK++T  +    S ++   K    SL  +  +LP+ YVR+ DPAI+RLKE 
Sbjct: 1   MSFLAKLSQLKKSTTSSTDTGSGSKATKKEDNPSLDFKSPILPEYYVRKEDPAIRRLKEK 60

Query: 57  RRLKQGISSTSTKPAAKARHKASSPKDEAPIYKKKPGVNTTSGKYP----VVV---PKRE 109
           RR +Q    T  K +++ R KA+  +  +   +++    +T  K P     VV       
Sbjct: 61  RRQEQLRKGTLKKASSQRRSKANGGEVASGGVRQE---GSTRWKLPRPKSTVVAAAAPAP 117

Query: 110 PIKKLSFDELMKRAEQKSR 128
           P+KKLSF+ELMK+AE+K++
Sbjct: 118 PLKKLSFEELMKQAEEKAK 136

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 229 SQPYDRDEIWSIFNKGSKRKY---FXXXXXXXMXXXXXXXXXXXXRATKMAKLEDKREQA 285
           S  YD++EIWSIFNKG +R Y           M             ++KMA+ EDK E+ 
Sbjct: 262 SYGYDKEEIWSIFNKGRRRLYQEDDDNDFDDDMEANEMEILEEEDYSSKMARREDKMEEE 321

Query: 286 W 286
           W
Sbjct: 322 W 322

>Scas_699.20
          Length = 538

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 8   QQLKQTTKINEPNHSANQNKAKSLQ--SEEKLLPKDYVREVDPAIQRLKE 55
           Q +K+T +++ P HS  +   + +Q  +   ++PKDY   V P    L+E
Sbjct: 375 QMIKETLRLHHPLHSLFRKVIRDMQVPNTSYVIPKDYFVLVSPGYTHLQE 424

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.125    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,610,582
Number of extensions: 219497
Number of successful extensions: 857
Number of sequences better than 10.0: 24
Number of HSP's gapped: 842
Number of HSP's successfully gapped: 29
Length of query: 298
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 197
Effective length of database: 13,099,691
Effective search space: 2580639127
Effective search space used: 2580639127
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)