Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F14465g76775536550.0
AGR162C76364614450.0
CAGL0L11726g82563813801e-180
YER162C (RAD4)75463113451e-176
Kwal_56.2341772355313241e-173
Scas_576.377957512951e-168
CAGL0H07293g6686091713e-12
YDR314C6922821623e-11
Sklu_2426.26643971293e-07
YPL096W (PNG1)3631351078e-05
Kwal_27.12204368135997e-04
ABR193W350135980.001
Scas_700.2351154920.006
CAGL0H05753g348163910.007
Sklu_2405.11351135840.055
KLLA0E24266g353138780.28
Scas_679.137070667.2
Scas_631.1126533659.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F14465g
         (755 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736 Saccha...  1412   0.0  
AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH] (1049961..1...   561   0.0  
CAGL0L11726g complement(1249886..1252363) similar to sp|P14736 S...   536   e-180
YER162C (RAD4) [1590] chr5 complement(500625..502889) Component ...   522   e-176
Kwal_56.23417                                                         514   e-173
Scas_576.3                                                            503   e-168
CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces c...    70   3e-12
YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Membe...    67   3e-11
Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement          54   3e-07
YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase...    46   8e-05
Kwal_27.12204                                                          43   7e-04
ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH] complement(7...    42   0.001
Scas_700.2                                                             40   0.006
CAGL0H05753g complement(569862..570908) similar to tr|Q02890 Sac...    40   0.007
Sklu_2405.11 YPL096W, Contig c2405 21404-22459 reverse complement      37   0.055
KLLA0E24266g complement(2158824..2159885) similar to sgd|S000602...    35   0.28 
Scas_679.1                                                             30   7.2  
Scas_631.11                                                            30   9.2  

>KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein singleton, start by similarity
          Length = 767

 Score = 1412 bits (3655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/755 (91%), Positives = 688/755 (91%)

Query: 1   MNDGRLSREYFDLIKDALQEEEKTXXXXXXXXXXXXXXXXXQKEPELESESNRVVITIXX 60
           MNDGRLSREYFDLIKDALQEEEKT                 QKEPELESESNRVVITI  
Sbjct: 1   MNDGRLSREYFDLIKDALQEEEKTGGSGSSSPRKRRKLRSLQKEPELESESNRVVITIES 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXVTDAPANNGNISITIDTSAQXXXXXXXXXXEH 120
                                       VTDAPANNGNISITIDTSAQ          EH
Sbjct: 61  DDEEQNNYDDDDDDDDDDDEYDSEEFEDVTDAPANNGNISITIDTSAQKKSTKKKKKTEH 120

Query: 121 GLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIFNNLHPQKDDE 180
           GLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIFNNLHPQKDDE
Sbjct: 121 GLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIFNNLHPQKDDE 180

Query: 181 MPLRSTRKLLDALRMLMKHWNKKFKLELTSPYEFNHLYMVHWDSVLKHKCESVXXXXXXX 240
           MPLRSTRKLLDALRMLMKHWNKKFKLELTSPYEFNHLYMVHWDSVLKHKCESV       
Sbjct: 181 MPLRSTRKLLDALRMLMKHWNKKFKLELTSPYEFNHLYMVHWDSVLKHKCESVTFKTFKK 240

Query: 241 XXXRMRGPANISVQGFVTMLRGCGLNARLIHSLQPPDFTDSKIYNKRVVWSLENECLKYP 300
              RMRGPANISVQGFVTMLRGCGLNARLIHSLQPPDFTDSKIYNKRVVWSLENECLKYP
Sbjct: 241 FFTRMRGPANISVQGFVTMLRGCGLNARLIHSLQPPDFTDSKIYNKRVVWSLENECLKYP 300

Query: 301 IFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNMMRYVIAFDRKQGCK 360
           IFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNMMRYVIAFDRKQGCK
Sbjct: 301 IFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNMMRYVIAFDRKQGCK 360

Query: 361 DVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDDYEDEYFDLRNEHEG 420
           DVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDDYEDEYFDLRNEHEG
Sbjct: 361 DVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDDYEDEYFDLRNEHEG 420

Query: 421 IPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRNKSNSLLKVFPRKDVISCYSA 480
           IPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRNKSNSLLKVFPRKDVISCYSA
Sbjct: 421 IPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRNKSNSLLKVFPRKDVISCYSA 480

Query: 481 RHWYMQGRALKSGAKHLLTHKIKNPVEEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFY 540
           RHWYMQGRALKSGAKHLLTHKIKNPVEEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFY
Sbjct: 481 RHWYMQGRALKSGAKHLLTHKIKNPVEEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFY 540

Query: 541 GNIDIYKPWMIPIGCCLVENPNSIKAASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVEN 600
           GNIDIYKPWMIPIGCCLVENPNSIKAASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVEN
Sbjct: 541 GNIDIYKPWMIPIGCCLVENPNSIKAASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVEN 600

Query: 601 EYVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKLRIKSRLVEEHGAVADEDGRD 660
           EYVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKLRIKSRLVEEHGAVADEDGRD
Sbjct: 601 EYVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKLRIKSRLVEEHGAVADEDGRD 660

Query: 661 YSGERDSDLEDHESYTGEDTEMGGFEQGGFLLDSNMDGGFVPEPELQHAESETEQVEHPP 720
           YSGERDSDLEDHESYTGEDTEMGGFEQGGFLLDSNMDGGFVPEPELQHAESETEQVEHPP
Sbjct: 661 YSGERDSDLEDHESYTGEDTEMGGFEQGGFLLDSNMDGGFVPEPELQHAESETEQVEHPP 720

Query: 721 VTYGEATLDRAEPSNTEPNEIADEFEQFLQEVGSQ 755
           VTYGEATLDRAEPSNTEPNEIADEFEQFLQEVGSQ
Sbjct: 721 VTYGEATLDRAEPSNTEPNEIADEFEQFLQEVGSQ 755

>AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH]
           (1049961..1052252) [2292 bp, 763 aa]
          Length = 763

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/646 (44%), Positives = 402/646 (62%), Gaps = 48/646 (7%)

Query: 122 LDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIFNNLHPQKDDEM 181
           +D   + FR++ HM  +  L+ H + RN W ND +LQ +LA LV D+++ ++HP++D+++
Sbjct: 145 VDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRLQSRLAALVPDEVYASMHPERDEQL 204

Query: 182 PLRSTRKLLDALRMLMKHWNKKFKLELTSPYEFNHLYMVHWDSVLKHKCESVXXXXXXXX 241
           PLRSTRKLLDALR  MK W K  K  +        LYM  W  + +              
Sbjct: 205 PLRSTRKLLDALRKCMKLWEKHCKRIIG---RDGGLYMRPWAQLGQRYSSGAALLTRKAF 261

Query: 242 XXRMRG----PANISVQGFVTMLRGCGLNARLIHSLQPPDFTDSK----IYNKRVVWSLE 293
              ++     P +++ +GFV +LRGCGLNARL+ SLQPPD TD K              E
Sbjct: 262 NRALQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPPDLTDMKPAGDARGSDPPGDSE 321

Query: 294 NECLKY--PIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNMMRYVI 351
           ++  KY  P+ WCEVWD+++K WIT+D + ++++EQVR KSKLEP G+  + FN MRYV+
Sbjct: 322 DDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTGKF-ARFNQMRYVV 380

Query: 352 AFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDDYEDEY 411
            FDRK GC+D++RRY A    KVR++RITR+     W++++++ L++R R + DDYEDEY
Sbjct: 381 GFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEY 440

Query: 412 FDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRN---KSNSLLKV 468
           F  R+E EGIP+++ D++NHP YVLEKDLR +++L+P  +QCG++R +     + S LKV
Sbjct: 441 FARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATEQCGYVRFKTTKRSAGSTLKV 500

Query: 469 FPRKDVISCYSARHWYMQGRALKSGAKHLLTHKIKNPVEEDEDEERLYPIGQTEYVIPKQ 528
           F R D++ CYS RHW++QG+ L+   +   T  +K+    + +EERLYP  +TE  +P  
Sbjct: 501 FRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTVIVKDHRTGESEEERLYPESETEPYVPPP 560

Query: 529 VDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPNSIKAASFLRVPFAKAVTGFKFESGRR 588
           V  DG IPTN +GNIDIYKP MIP GC L+ENPN+++AA+F+ VPFAKAVTGF FE GR 
Sbjct: 561 VAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVRAAAFIGVPFAKAVTGFSFERGRT 620

Query: 589 VKPKVTGVVVENEYVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKLRIKSRLVE 648
           VKPK +GVVV++ Y DA+ A+I+ IE   D+A   E EL AL  W+LLL +LR+K RL++
Sbjct: 621 VKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQERELGALQSWALLLAQLRVKQRLID 680

Query: 649 EHGAVADEDGRDYSGERDSDLEDHESYTGEDTEMGGFEQGGFLLDSNMDGGFVPEPELQH 708
            HGAV++          DSD E   S    DTE GGF    F  DS       P P    
Sbjct: 681 RHGAVSEHTS-------DSDSEPEAS----DTEAGGF----FPDDSAS-----PVPRSPP 720

Query: 709 AESETEQVEHPPVTYGEATLDRAEPSNTEPNEIADEFEQFLQEVGS 754
             + +E V  P           A P  T   E+ DEF +F+ E+GS
Sbjct: 721 IRAPSEPVAEPA----------ASPLQTA-VELEDEFAEFIDELGS 755

>CAGL0L11726g complement(1249886..1252363) similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein, start by similarity
          Length = 825

 Score =  536 bits (1380), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 280/638 (43%), Positives = 395/638 (61%), Gaps = 26/638 (4%)

Query: 93  PANNGNISITIDTSAQXXXXXXXXXXEHGLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWC 152
           P++N +++I ++              ++      ++FR   H   LL L+CH +  N W 
Sbjct: 117 PSDNLSVTINVNKKDSQSKKESSKIQKNMCSNEDRKFRTHMHCLYLLCLMCHGHIINHWL 176

Query: 153 NDEKLQKKLAKLVSDDIFNNLHPQKDDEMPLRSTRKLLDALRMLMKHWNKKFKLELTSPY 212
           N+ K+ +KL+ ++ + +F+ LHP+KD+E+PLRSTRKLLD L+  M+ W K +++     Y
Sbjct: 177 NNSKMNRKLSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHWRI--MQRY 234

Query: 213 EFNHLYMVHWD--SVLKHKCESVXXXXXXXXXXRMRGPANISVQGFVTMLRGCGLNARLI 270
           +  + YM +WD   +     +++          +  G  +++ QGFV +LR C +NARL+
Sbjct: 235 KGVNCYMRYWDELQICDKSRKTLTKNDFIKGILKGVGDRDVATQGFVALLRSCNVNARLV 294

Query: 271 HSLQPPDFTD-SKIYNKRVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVR 329
            S QPPDFT+  K Y      S E+   KYP+FWCEVWDKF+K+WITID   ++ IEQVR
Sbjct: 295 MSCQPPDFTNLKKSYGTEKKVSYED-MTKYPVFWCEVWDKFSKKWITIDPFCKKTIEQVR 353

Query: 330 YKSKLEPIGRINSAFNMMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWF 389
             SK EP G      N MRYVI FDRK+GC+D++RRY     +K RKKRIT+EA    W+
Sbjct: 354 LSSKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWY 413

Query: 390 NSIIKFLNKRNRNRIDDYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPG 449
             ++  L+KR R +IDDYED YFD RN+ EG+PD++QD K HP+YVLEKD+R NQVLK G
Sbjct: 414 ERVLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSG 473

Query: 450 AQQCGFLRLRNKSNSLLKVFPRKDVISCYSARHWYMQGRALKSGAKHLLT-----HKIKN 504
            ++CG+L+L NK+N +LKV+ +KD+I   SA+ WYM+GR LK+GA+ L T      +  +
Sbjct: 474 CKECGYLKLHNKTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFTD 533

Query: 505 PVEEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPNSI 564
           P  E+++EERLY    TE  +       G+I TN +GNI+++ P MIP  CCLVE+P +I
Sbjct: 534 P--EEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAI 591

Query: 565 KAASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAARHE 624
           KAASF+R+ FAKAVT FKFE GR VKP +TGVVV   + DALVA I+ I + N +    E
Sbjct: 592 KAASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIE 651

Query: 625 LELEALNGWSLLLTKLRIKSRLVEEHGAVADEDGRDYSGER--DSDLEDHESYTGEDTEM 682
            ELEAL+ W  L+TKLRIK++L  E+G V +E+      +    +  ++  S T    E 
Sbjct: 652 HELEALSYWHNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDE- 710

Query: 683 GGFEQGGFL-LDSNMDGGFVPEPELQHAESETEQVEHP 719
             F QGGFL  D N DG         H E+   ++E P
Sbjct: 711 --FPQGGFLPTDINHDG-------TSHNETSDNEIEEP 739

>YER162C (RAD4) [1590] chr5 complement(500625..502889) Component of
           the nucleotide excision repairosome, homolog of human
           XPC xeroderma pigmentosum gene product [2265 bp, 754 aa]
          Length = 754

 Score =  522 bits (1345), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 276/631 (43%), Positives = 392/631 (62%), Gaps = 31/631 (4%)

Query: 130 RKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIFNNLHPQKDDEMPLRSTRKL 189
           RK  HM  L+ L+ H + RNEW N ++L +KL+ LV + +F  LHPQKD+E+PLRSTRKL
Sbjct: 140 RKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKL 199

Query: 190 LDALRMLMKHWNKKFKLELTSPYEFNHLYMVHWDSVL-----KHKCESVXXXXXXXXXXR 244
           LD L+  M+ W K +K+  T  Y+   LYM  W  +      K K +++          +
Sbjct: 200 LDGLKKCMELWQKHWKI--TKKYDNEGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSK 257

Query: 245 MRGPANISVQGFVTMLRGCGLNARLIHSLQPPDFTDSKIYNKRVVWSLENECLKYPIFWC 304
             G  +ISVQGFV MLR C +NARLI S QPPDFT+ KI       +   + +KYPIFWC
Sbjct: 258 GHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSLNGNNAYKDMVKYPIFWC 317

Query: 305 EVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNMMRYVIAFDRKQGCKDVSR 364
           EVWDKF+K+WIT+D V  + IEQVR  SKL P G      NM+RYVIA+DRK GC+DV+R
Sbjct: 318 EVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTR 377

Query: 365 RYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDDYEDEYFDLRNEHEGIPDS 424
           RY   + +KVRK+RIT++    +WF  +I  L+ R R +IDDYED+YF  R+E EGIPDS
Sbjct: 378 RYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGIPDS 437

Query: 425 LQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRNKSNSLLKVFPRKDVISCYSARHWY 484
           +QD+KNHP+YVLE+D++  Q++KPG ++CG+L++  K   +LKV+ ++D+    SAR WY
Sbjct: 438 VQDLKNHPYYVLEQDIKQTQIVKPGCKECGYLKVHGKVGKVLKVYAKRDIADLKSARQWY 497

Query: 485 MQGRALKSGA--KHLLTHKIKNPV-EEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFYG 541
           M GR LK+G+  K ++   +  P  E +E++ERLY    TE  IP    A G+I  N +G
Sbjct: 498 MNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELYIPPLASASGEITKNTFG 557

Query: 542 NIDIYKPWMIPIGCCLVENPNSIKAASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVENE 601
           NI+++ P MIP  CCLVENP +IKAA FL V FA AVT FKFE G  VKP ++G+VV   
Sbjct: 558 NIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKW 617

Query: 602 YVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKLRIKSRLVEEHGAVADEDGRDY 661
             +A+   I+ IE   +D  R E  L AL  W+ LL KLRI+S+L   +G +A+E+    
Sbjct: 618 LREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRSKLNSTYGKIAEEEP--- 674

Query: 662 SGERDSDLEDHESYTGEDTEMGGFEQGGFLLDSNMDGGFVPEPELQHAESETEQVEHPPV 721
           +  ++ ++ D+   T                ++ M GGF+P      A   +E  E P  
Sbjct: 675 NVTKEQNIADNHDNT----------------ETFMGGGFLPGIANHEARPYSEPSE-PED 717

Query: 722 TYGEATLDRAEPSNTEPNEIADEFEQFLQEV 752
           +    ++D+AE S T+ +++ +++  F++E+
Sbjct: 718 SLDYVSVDKAEESATD-DDVGEDYSDFMKEL 747

>Kwal_56.23417
          Length = 723

 Score =  514 bits (1324), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 252/553 (45%), Positives = 359/553 (64%), Gaps = 30/553 (5%)

Query: 127 KEFRKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIFNNLHPQKDDEMPLRST 186
           +++R+  H+  L+TL+ H Y RN+W ND KL +KL+KLV D++F  LHP++DDE+PLRST
Sbjct: 144 RKYRRYFHLLQLVTLMVHGYVRNQWLNDAKLHQKLSKLVPDNVFELLHPKRDDELPLRST 203

Query: 187 RKLLDALRMLMKHWNKKFKLELTSPYEFNHLYMVHWDSV---LKHKCESVXXXXXXXXXX 243
           RKLLD L+  M+ W K F  +  + +E   LYM+ WD +    +     +          
Sbjct: 204 RKLLDGLKRCMEIWWKHF--DQITRWETPGLYMLDWDELDGPWEQPTRYMSQKLFNKKVA 261

Query: 244 RMRGPANISVQGFVTMLRGCGLNARLIHSLQPPDFTDSKIYNKRVVWS------------ 291
             +G + I+ QGFV MLR CG+NARLI + QPPDFT++K+  +  + +            
Sbjct: 262 HGKGSSEIAAQGFVAMLRACGVNARLIMNAQPPDFTNNKVSARGSLKTPGEYLDKTDMRP 321

Query: 292 ----------LENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRIN 341
                      + +  ++ +FWCEVWDK +K+WIT+D +GQ  IEQ+RYK+ L+P G   
Sbjct: 322 KRRKKAKGGQRDPDAKRHVLFWCEVWDKVSKKWITVDPMGQRTIEQIRYKTALDPQGSAK 381

Query: 342 SAFNMMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNR 401
              N+ RY+IA+DRK GC+DV+RRY  H  +K RK+RITR+A+  +W   ++  L++R R
Sbjct: 382 RN-NLFRYIIAYDRKLGCRDVTRRYTTHFNSKTRKRRITRDAEGEKWMKRVLARLHQRKR 440

Query: 402 NRIDDYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRNK 461
            R DD+ED YF  R+E EGIPD++QD+KNHP+YVL+ D + N+VLK G ++CGFLR +N 
Sbjct: 441 TRTDDFEDAYFRQRDETEGIPDNMQDLKNHPYYVLQNDFKWNEVLKSGCKECGFLRTKN- 499

Query: 462 SNSLLKVFPRKDVISCYSARHWYMQGRALKSGAKHLLTHKIKNPVEEDEDEERLYPIGQT 521
            N+ LKV+ R+DV+   +AR WY +GR LK GA  L T K ++    +  EERLY   +T
Sbjct: 500 -NTSLKVYRREDVLVLKTARTWYTEGRVLKPGASALKTTKSRDFKTGEATEERLYAFDET 558

Query: 522 EYVIPKQVDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPNSIKAASFLRVPFAKAVTGF 581
           E  IP+ +  + ++PTN YGNIDIY   MIP G CL+E+P ++KAA+ L + FAKAVTGF
Sbjct: 559 ELFIPEDLGPNNEVPTNVYGNIDIYTSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTGF 618

Query: 582 KFESGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKLR 641
           KFE  R  KP++TG+VV  EY +A+ ++I+ +E   ++  R E ELEAL  W+L L KLR
Sbjct: 619 KFEKKRVAKPQITGIVVSQEYREAVESMIDGVEYSLEEDERQERELEALQHWNLFLAKLR 678

Query: 642 IKSRLVEEHGAVA 654
           IK RL   HG V+
Sbjct: 679 IKQRLNTTHGKVS 691

>Scas_576.3
          Length = 779

 Score =  503 bits (1295), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 270/575 (46%), Positives = 363/575 (63%), Gaps = 15/575 (2%)

Query: 95  NNGNISITI-DTSAQXXXXXXXXXXEHGLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCN 153
           N  +ISITI D + +           +      ++ R   HM  LL L+ H Y RNEW N
Sbjct: 116 NINDISITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLN 175

Query: 154 DEKLQKKLAKLVSDDIFNNLHPQKDDEMPLRSTRKLLDALRMLMKHWNKKFKLELTSPYE 213
             K   KL+KLV + +F  LHP KD+E+PLRSTRKLLD L+  M+ WNK +K+     YE
Sbjct: 176 SSKFIVKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKI--LQKYE 233

Query: 214 FNHLYMVHWDSVLKHKCESVXXXXXXXXXXRM----RGPANISVQGFVTMLRGCGLNARL 269
               YM  WD +      +           R     +G  +I+ QG+V +LR C +NARL
Sbjct: 234 GVACYMKSWDEITTSTKPNSPFFLSKKQFIRQVIKGQGDRDIAAQGYVALLRACNVNARL 293

Query: 270 IHSLQPPDFTDSKIYNKRVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVR 329
           I S QPPD TD K   K +    + + +KYPIFWCEVWDKFAK+WITID +   IIEQV+
Sbjct: 294 IMSCQPPDITDLKEKCKPIDIDYD-DMVKYPIFWCEVWDKFAKKWITIDCMNFHIIEQVK 352

Query: 330 YKSKLEPIGRINSAFNMMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWF 389
           ++SKLEP G      N +RYVI +DRK GC+DV+RRY      K RKKRIT+E K  EWF
Sbjct: 353 HRSKLEPHGVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGEEWF 412

Query: 390 NSIIKFLNKRNRNRIDDYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPG 449
           N ++  L++R R +IDDYED Y + R+  E +PD+LQD+KNHP+Y+LE DLR NQVLKPG
Sbjct: 413 NKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVLKPG 472

Query: 450 AQQCGFLRLRN----KSNSLLKVFPRKDVISCYSARHWYMQGRALKSGAKHLLTHK---I 502
           +++ G+L L+       N LLKV+ RK+++   SAR WYM+GR LK+G++ L T K   +
Sbjct: 473 SKESGYLHLQGSKSKNKNKLLKVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKRRAM 532

Query: 503 KNPVEEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPN 562
           +  ++++EDEERLY I  T   +P    +DG+I  N YGNI+++ P MIP  CCL+E+P 
Sbjct: 533 RPSLDDEEDEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIESPY 592

Query: 563 SIKAASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAAR 622
           +IKAA FLR+ + +AVTGFKFE GR  KP + GVVV N Y DA+ + I+ IE   D+  +
Sbjct: 593 AIKAAKFLRINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDNDKK 652

Query: 623 HELELEALNGWSLLLTKLRIKSRLVEEHGAVADED 657
            E ELE+L  W  LL+KLRIK +L   +G V +E+
Sbjct: 653 LEEELESLRCWHTLLSKLRIKKKLDVIYGTVGEEN 687

>CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces
           cerevisiae YDR314c, hypothetical start
          Length = 668

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 133/609 (21%), Positives = 245/609 (40%), Gaps = 106/609 (17%)

Query: 129 FRKTCHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDIFNNLH--PQKDDEMPLRST 186
            R   H+  +  LV    +R  W  DE+L+++L + V   I   +    +   ++ + S 
Sbjct: 82  LRYGLHIIAIPILVATLIKRTNWTQDERLRRRLKRSVPKQITKKVKNWSKSSQDIRISSI 141

Query: 187 RKLLDALRMLMK-HWNKKFKLELTSPYEFNHLYMVHWDSVLKHKCESVXXXXXXXXXXRM 245
           R LL  L M  + ++         + Y  ++++ +   +V+K   E+           R 
Sbjct: 142 RTLLLGLVMWFRANYQINSNGFRQNFYRLHYIFRLDDGNVMKPYREACLRDQHKYYGERP 201

Query: 246 RGPANIS----------------VQGFVTMLRGCGLNARLIHSLQ-------------PP 276
               NI                    F+T+LR   L A  I SL+             P 
Sbjct: 202 DIAGNIEDIRTFVRNKKANRDYLTLFFITILREI-LPADQIKSLRLCFSLPLHNFQISPR 260

Query: 277 DFTDSKIYNKRVVWSLENECLKYPIFWCEV--WDKFAKQWITIDIVGQE---IIEQVRYK 331
           + T     +   V +  +  L  P FW E+   D+  K ++   +V  E   I+++    
Sbjct: 261 NITKLASRDAGKVPNRFDTDLLQPYFWIELHTIDEPDKLYVIDPVVHIEEGNIVKKYNID 320

Query: 332 SKL---EPIGRINSAFNM-MRYVIAFDRK-QGCKDVSRRYIAHLQNKVRKK------RIT 380
             +   EPI  +N   N   +YVI+ D K    +DVS RYI  +  +   +        T
Sbjct: 321 EPVDIFEPIKDLNLNVNQWFQYVISCDAKDMTIRDVSARYIPDIYYRYYDRTRGSVLETT 380

Query: 381 REAKLNEWFNSIIKFLNK-RNRNRIDDYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKD 439
           R++K + +F  ++K  ++ RN N +         +  ++  +P S+ ++K  P +   + 
Sbjct: 381 RQSKSHHFFMRVLKSTSRYRNDNTV-----LMKTIAAKNYKLPKSISELKRSPNFKGLRI 435

Query: 440 LRANQVLKPGAQQCGFLRLRNKSNSLLKVFPRKDVISCYSARHWYMQGRALKSGAKHLLT 499
           L+ ++ +   A+  G ++   K + + ++    D++   + +HWY+ GR +K  AK + T
Sbjct: 436 LKQSETVSSKAKPVGKVQYGGKKDKIYRI---SDILPLKTRQHWYLLGRTVKEDAKPIRT 492

Query: 500 HKI----KNPVEEDED---EERLYPIGQTEYVIPK------------QVDADGKIPTNFY 540
             I    +N +   ++      L+   QT+ + PK             V  D     N Y
Sbjct: 493 KTIPLRKRNAISSAQELNFARELFSYEQTD-LTPKYPSSYKDVYGIYHVVCDVDFYKNKY 551

Query: 541 GNIDIYKPWMIPIGC---------------CLVENPNSIKAASFLR-VPFAKAVTGFKFE 584
            N++IY   +IP G                 L++N N  K     + + +   V+GF F 
Sbjct: 552 KNVEIYSKSVIPTGFRLMRTFDKDYKFDLRRLIKNANVEKGKKGQKLIKYLDVVSGFDFR 611

Query: 585 SGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAARHELELEALNGWSLLLTKLRIKS 644
            G +  P  T ++V   Y+D        I     D     +EL  L  WS  +T+L+IK 
Sbjct: 612 KG-QATPIKTHILV--NYMDY-----RKILSLQKDY----IELLRLESWSNFITRLKIKC 659

Query: 645 RLVEEHGAV 653
            L +++G +
Sbjct: 660 ELEDKYGKL 668

>YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Member
           of the DNA repair protein Rad4 family, has low
           similarity to uncharacterized C. albicans Orf6.3103p
           [2079 bp, 692 aa]
          Length = 692

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 122/282 (43%), Gaps = 53/282 (18%)

Query: 421 IPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCGFLRLRNKSNSLLKVFPRKDVISCYSA 480
           +P S+ +IK    +V+   L++N+VLK  A+Q          NS   +F R+DVI   S 
Sbjct: 434 LPKSVTEIKRTDNFVIPSLLKSNEVLKACAKQAA--TFTKGDNSQEPIFWRRDVIQLKSK 491

Query: 481 RHWYMQGRALKSGAKHLLTHKI------------KNPVEEDEDEERL-----YPIGQTEY 523
           +HW + GR++   A+ L   K             K  ++E    E+      YP    ++
Sbjct: 492 QHWAILGRSILPNAQPLKRKKYLPMRERMVRNLDKYVIKELFSYEQTMKSPKYPSTYCDH 551

Query: 524 VIPKQVDADGKIPTNFYGNIDIY----KP---WMIPIG-----CCLVENPNSIKAASFLR 571
           +  + V  D     N +GNI+IY    KP    +IP+       CL++  N  K     +
Sbjct: 552 LGQEHVITDLSHYKNKFGNIEIYSKETKPDGFELIPLSKEVDIKCLIKEYNKGK-RKMQK 610

Query: 572 VPFAKAVTGFKFESGR-RVKPKVTGVVVENEYVDALVAVIENIEECNDDAARHELELEAL 630
           + +   V+GF F+  +    PK+  ++V+     A+  + +  +            L  L
Sbjct: 611 IKYLDVVSGFDFKQKKGHAIPKIESILVKETDYKAVQLLKQQTK-----------VLLGL 659

Query: 631 NGWSLLLTKLRIKSRLVEEHGAVADEDGRDYSGERDSDLEDH 672
           + W +LL KLR+  RL  E+G V         G  +  L+DH
Sbjct: 660 SFWDILLRKLRVNDRLNAEYGNV---------GNNEETLDDH 692

>Sklu_2426.2 YDR314C, Contig c2426 795-2789 reverse complement
          Length = 664

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 88/397 (22%), Positives = 160/397 (40%), Gaps = 52/397 (13%)

Query: 300 PIFW--CEVWDKFAKQWITIDIVGQEIIEQVR---YKSKLEPIGRINSAFNM-MRYVIAF 353
           P FW  C+V D        +++  + I+ + R   Y   ++P+  +   +     Y+++ 
Sbjct: 272 PYFWIECKVRDDLYIIDPIVNVDQKRIVMKARADEYVPHIKPLDDLKINYTQRFHYIVSI 331

Query: 354 DRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSII--KFLNKRNRNRIDDYEDEY 411
                  DVS RY+ ++  +      T  +      +SI+  KFL K          +  
Sbjct: 332 ANDMHMMDVSPRYLDNICYRYFNTPSTVFSSSKPLKSSILFRKFLRKYGTIEKSKEYNSL 391

Query: 412 FDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPGAQQCG-FLRLRNKSNSLLKVFP 470
            DL  ++  IP +L  +K    + +   L+AN+V+    +  G F R +        V+ 
Sbjct: 392 VDLALQNYKIPKTLIGMKRSDNFTMPSLLKANEVISASTRPVGTFCRGQQTEEY---VYW 448

Query: 471 RKDVISCYSARHWYMQGRALKSGAKHLLTHKIKNPVEEDEDEERLYPIGQT-----EYVI 525
           +KD++   S +HW + GR +K  A  + + K+       E    +Y I +          
Sbjct: 449 KKDILRLKSRQHWALLGRTVKMDAVPMKSKKVHTMKMRREKRLYMYEIRELYAFEQTIAT 508

Query: 526 PK-------QVDADGKIP-----TNFYGNIDIYKPWMIPIGCCLVENPNSIKAASFLRVP 573
           PK        V   G I       N +G+++IY   + P G    E   + K    L   
Sbjct: 509 PKMNNTYLTSVGGRGLITDVYHFKNAHGHVEIYNANLKPDG---FEMFAATKETKLLIRQ 565

Query: 574 FAKAV-TGFKFESGRRVKPKVTGVVVENEYVDAL------------VAVIENIEECNDDA 620
           + + +  G  F   + V PK+   +   +++D +            V V+  I   ++D 
Sbjct: 566 YNRDIRKGIGFLKDKYVVPKLQ-CLEPLKFLDVVSGFDFKQTPGYAVPVLNQILVNHNDF 624

Query: 621 ARHEL------ELEALNGWSLLLTKLRIKSRLVEEHG 651
            R EL      EL+ LN W  LL  L++K R+ +++G
Sbjct: 625 CRLELLIGQNRELQNLNYWQNLLQALQVKRRIDKQYG 661

>YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase
           enzyme, may be involved in degradation of misfolded
           glycoproteins [1092 bp, 363 aa]
          Length = 363

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 58/135 (42%), Gaps = 23/135 (17%)

Query: 287 RVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNM 346
           R VW+ E+        WCE +  F  +W+ +D   Q   +   Y                
Sbjct: 210 RYVWNREDH------VWCEYFSNFLNRWVHVDSCEQSFDQPYIYSINWNK---------K 254

Query: 347 MRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDD 406
           M Y IAF  K G  DVS+RYI  LQN++ + +I  E         + +F+ KR R  ++D
Sbjct: 255 MSYCIAFG-KDGVVDVSKRYI--LQNELPRDQIKEED-----LKFLCQFITKRLRYSLND 306

Query: 407 YEDEYFDLRNEHEGI 421
            E      R+E E I
Sbjct: 307 DEIYQLACRDEQEQI 321

>Kwal_27.12204
          Length = 368

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 58/135 (42%), Gaps = 23/135 (17%)

Query: 287 RVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNM 346
           R VW+ E+        WCE +  F K+W+ +D   Q   E   Y                
Sbjct: 216 RYVWNREDH------VWCEFYSTFLKRWVHVDACEQSFDEPHIYSVNWN---------KK 260

Query: 347 MRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDD 406
           M YVIAF+    C DVS+RYI  +QN++ + +I  +         ++  + +R R  + D
Sbjct: 261 MSYVIAFE-PYSCVDVSKRYI--IQNQLPRDQIKEDD-----LQFLLDMITRRQRMLLTD 312

Query: 407 YEDEYFDLRNEHEGI 421
            E      R+E E +
Sbjct: 313 DEVYVQACRDEQERL 327

>ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH]
           complement(768355..769407) [1053 bp, 350 aa]
          Length = 350

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 57/135 (42%), Gaps = 23/135 (17%)

Query: 287 RVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNM 346
           R  W+ E+        WCEV+    K+W+ +D   +   E   Y          N A   
Sbjct: 202 RYTWNREDH------VWCEVYSNALKRWVHVDSCEKSFDEPHIYSVNW------NKA--- 246

Query: 347 MRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDD 406
           M YVIAF  +   KDVSRRYI        + R+ R+    +    + K+L K  R ++ D
Sbjct: 247 MSYVIAFSNR-SVKDVSRRYIV-------RNRLPRDQIDEDDLQFLTKYLTKLLRLQLPD 298

Query: 407 YEDEYFDLRNEHEGI 421
            E      R+E E I
Sbjct: 299 EERYLLHCRDELEAI 313

>Scas_700.2
          Length = 351

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 68/154 (44%), Gaps = 26/154 (16%)

Query: 287 RVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNM 346
           R VW+ E+        WCE +  +  +W+ +D   Q   +   Y         IN     
Sbjct: 200 RYVWNREDH------VWCEYYSPYLNRWVHVDSCEQSFDQPYIYS--------INWN-KS 244

Query: 347 MRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKR-NRNRID 405
           M Y IAF  K    DVS+RYI  L+N++ + +I   ++L+  F  I  +L KR  R R D
Sbjct: 245 MSYCIAFS-KDDVTDVSKRYI--LKNELPRDQI---SELDLQF--ICTYLTKRLRRQRTD 296

Query: 406 DYEDEYF--DLRNEHEGIPDSLQDIKNHPFYVLE 437
           D   E F  D R   E +P   +  +  P   LE
Sbjct: 297 DELFELFKRDERERFEWMPKVKKTEQKSPTKTLE 330

>CAGL0H05753g complement(569862..570908) similar to tr|Q02890
           Saccharomyces cerevisiae YPL096w PNG1, hypothetical
           start
          Length = 348

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 69/163 (42%), Gaps = 30/163 (18%)

Query: 287 RVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNM 346
           R +W+ E+        WCE +  + K+WI +D   Q   E   Y                
Sbjct: 196 RYIWNREDH------VWCEYYSPYLKRWIHVDSCEQSFDEPFIYSKNWN---------KS 240

Query: 347 MRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDD 406
           M Y I F R  G  DVS+RYI  LQN++  + I +E  L      +   L KR R  + D
Sbjct: 241 MSYCIGFWR-YGVVDVSKRYI--LQNQL-PRDIIKEDDL----QFLCHALTKRLRTGLSD 292

Query: 407 YEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVLKPG 449
             DE + +        D L+ ++ +P     K+++  ++ K G
Sbjct: 293 --DESYKMY-----CRDDLEQLELNPSATPTKEMQKLKISKTG 328

>Sklu_2405.11 YPL096W, Contig c2405 21404-22459 reverse complement
          Length = 351

 Score = 37.0 bits (84), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 62/135 (45%), Gaps = 23/135 (17%)

Query: 287 RVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAFNM 346
           R +W+ E+        WCE +    K+W+ +D       +   Y         IN     
Sbjct: 203 RYIWNREDH------VWCEFYSPNLKRWVHLDSCEMSFDQPYIYS--------INWG-KK 247

Query: 347 MRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRIDD 406
           M YV+AF  K G  D+S+RYI  L+N++   +I+ E+ L      +++F+ K+ R  + D
Sbjct: 248 MSYVVAFG-KDGVADISQRYI--LRNELPTDQIS-ESDL----QFLLEFITKQLRATLSD 299

Query: 407 YEDEYFDLRNEHEGI 421
            E      R+E E +
Sbjct: 300 DEIYKLACRDEQEKL 314

>KLLA0E24266g complement(2158824..2159885) similar to sgd|S0006021
           Saccharomyces cerevisiae YPL096w PNG1 protein with
           de-N-glycosylation function, start by similarity
          Length = 353

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 55/138 (39%), Gaps = 23/138 (16%)

Query: 285 NKRVVWSLENECLKYPIFWCEVWDKFAKQWITIDIVGQEIIEQVRYKSKLEPIGRINSAF 344
           N R +W+ E+        WCE +    K+W+ +D   Q   E   Y              
Sbjct: 202 NARYIWNKEDH------VWCEYYSPNLKRWVHLDCCEQSFDEPHIYSKNWNK-------- 247

Query: 345 NMMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLNEWFNSIIKFLNKRNRNRI 404
             M YV+AF       DVS RYI  LQN + +  I+     NE  N +  +L K  R   
Sbjct: 248 -KMSYVLAFS-NDIVADVSGRYI--LQNNLPRNAISE----NE-LNFMCTYLTKTLRKDF 298

Query: 405 DDYEDEYFDLRNEHEGIP 422
           +D +      R+E E + 
Sbjct: 299 NDDQIYALACRDEQERLS 316

>Scas_679.1
          Length = 370

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 133 CHMFMLLTLVCHSYQRNEWCNDEKLQKKLAKLVSDDI---FNNLHPQKDDEMPLRSTRKL 189
            H+ ++  L+    QR EW  DE+L ++L + V   I   F+    +K  E   +S R L
Sbjct: 120 VHLIVMPFLLATLKQRFEWTKDERLNRRLRRSVPKMIHKKFDKWSKEKKPEKRSKSIRTL 179

Query: 190 LDALRMLMKH 199
           L  L +  ++
Sbjct: 180 LIGLVLWFRN 189

>Scas_631.11
          Length = 265

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 5/33 (15%)

Query: 406 DYEDEYF-----DLRNEHEGIPDSLQDIKNHPF 433
           D E EY      DL++  E +PD   +++NHPF
Sbjct: 85  DAEGEYLLCMDADLQHPPESVPDMFDNLRNHPF 117

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,156,605
Number of extensions: 1093637
Number of successful extensions: 3613
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3693
Number of HSP's successfully gapped: 36
Length of query: 755
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 646
Effective length of database: 12,822,747
Effective search space: 8283494562
Effective search space used: 8283494562
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)