Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F12914g43042321500.0
Kwal_33.151954284018811e-115
YLL002W (RTT109)4364318411e-109
AAL173C4204298241e-106
Scas_629.204404347891e-101
CAGL0D05786g4234257483e-95
Kwal_23.555696059655.5
Sklu_1989.21104102647.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F12914g
         (423 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F12914g complement(1190220..1191512) similar to sgd|S000392...   832   0.0  
Kwal_33.15195                                                         343   e-115
YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved ...   328   e-109
AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..3952...   322   e-106
Scas_629.20                                                           308   e-101
CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces c...   292   3e-95
Kwal_23.5556                                                           30   5.5  
Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement         29   7.7  

>KLLA0F12914g complement(1190220..1191512) similar to sgd|S0003925
           Saccharomyces cerevisiae YLL002w REM50 drug resistance,
           start by similarity
          Length = 430

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/423 (96%), Positives = 408/423 (96%)

Query: 1   MSLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCF 60
           MSLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCF
Sbjct: 1   MSLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCF 60

Query: 61  EEKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAIS 120
           EEKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAIS
Sbjct: 61  EEKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAIS 120

Query: 121 PGHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNRPLDSKGITSRVKIPDQDLYVSF 180
           PGHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNRPLDSKGITSRVKIPDQDLYVSF
Sbjct: 121 PGHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNRPLDSKGITSRVKIPDQDLYVSF 180

Query: 181 PVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFDNKTK 240
           PVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFDNKTK
Sbjct: 181 PVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFDNKTK 240

Query: 241 ATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLDHLIS 300
           ATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLDHLIS
Sbjct: 241 ATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLDHLIS 300

Query: 301 DGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKKNFKN 360
           DGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKKNFKN
Sbjct: 301 DGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKKNFKN 360

Query: 361 LKNYIXXXXXXXXXXXXXXXMNIRDIFDMHYSTKMIKVIGNHHKIATTKRPEINTINVIN 420
           LKNYI               MNIRDIFDMHYSTKMIKVIGNHHKIATTKRPEINTINVIN
Sbjct: 361 LKNYITGEEYDTEEGAEEAYMNIRDIFDMHYSTKMIKVIGNHHKIATTKRPEINTINVIN 420

Query: 421 TLS 423
           TLS
Sbjct: 421 TLS 423

>Kwal_33.15195
          Length = 428

 Score =  343 bits (881), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 179/401 (44%), Positives = 245/401 (61%), Gaps = 13/401 (3%)

Query: 2   SLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCFE 61
           SLE  ++D LP   E E+ +LQS PRET P+  P  +A   NGK  + +K QHF  LC +
Sbjct: 5   SLEVLLRDVLPQDVEVEVAHLQSPPRETYPVVLPHSQA---NGKQ-QVVKIQHFFGLCTD 60

Query: 62  EKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAISP 121
            K+ + LE+ VY  +  +    V+++LF+SKADTNGYC  RL I  ITK++I Y+ ++ P
Sbjct: 61  NKLFYGLEVFVYVVVQHSK--VVDKILFISKADTNGYCARRLSIKNITKALIEYVTSLDP 118

Query: 122 GHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNRPLDSKGITSRVKIPD-QDLYVSF 180
            +YL  V P+ R   + A  I +ST+ +RAL+I+ NR   + G TS    PD  +LY  F
Sbjct: 119 LYYLVKVIPMNRTRQNYANAITKSTTTKRALQIIRNR--HTAGKTS---TPDISNLYTQF 173

Query: 181 P-VPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFDNKT 239
                    K+ LFTR+EP YLFS SSKNP KH+LSG++LL WWL +VD ++ ++F + T
Sbjct: 174 EKCDPGWTCKICLFTRSEPHYLFSESSKNPEKHILSGEQLLHWWLSVVDAVLFKNFTSDT 233

Query: 240 KATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLDHLI 299
           KA LQIPGEEK     YL    +  W VGDIF+  P D+A+++IP+FPDDPKGRFL+ L+
Sbjct: 234 KARLQIPGEEKLCTEKYLNGKKFPQWRVGDIFNSEPNDLAIFKIPVFPDDPKGRFLEQLV 293

Query: 300 SDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKKNFK 359
            + R  KV V  FWTELQ +QEFR+G+TV+VIG+ G+    C  P   +II+P S K F 
Sbjct: 294 DENRAKKVQVTGFWTELQIQQEFRMGATVAVIGIDGRVANPCIMPRECEIILPKSIKAFN 353

Query: 360 NLKNYIXXXXXXXXXXXXXXXMNIRDIFDMHYSTKMIKVIG 400
            +K YI                NIRD   +     ++KV G
Sbjct: 354 MIKTYITGEEYDTIDGAYEACANIRDFVALRLGRSLLKVQG 394

>YLL002W (RTT109) [3417] chr12 (146290..147600) Protein involved in
           resistance to mutagens such as diepoxybutane and
           mitomycin C [1311 bp, 436 aa]
          Length = 436

 Score =  328 bits (841), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/431 (42%), Positives = 261/431 (60%), Gaps = 19/431 (4%)

Query: 1   MSLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCF 60
           MSL  ++   LP   +FE ++LQSIP ET  +  P ++ + V   T   IKTQHF +L  
Sbjct: 1   MSLNDFLSSVLPVSEQFEYLSLQSIPLETHAVVTPNKDDKRVPKST---IKTQHFFSLFH 57

Query: 61  EEKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAIS 120
           + KV F+LE+ VY +L   +    ERL+FVSKADTNGYC+ R+ +  ITK I+ +IL+I 
Sbjct: 58  QGKVFFSLEVYVYVTL--WDEADAERLIFVSKADTNGYCNTRVSVRDITKIILEFILSID 115

Query: 121 PGHYLRAVKPLIR--KALSGAKIIKRSTSVQRALEILSNRPLDSKGIT--SRVKIP--DQ 174
           P +YL+ VKP IR  K +S  ++I  +++  R L IL+ R L   G T    ++ P   Q
Sbjct: 116 PNYYLQKVKPAIRSYKKIS-PELISAASTPARTLRILARR-LKQSGSTVLKEIESPRFQQ 173

Query: 175 DLYVSFPVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVED 234
           DLY+SF  P EI+TK+ LFTR   QYLF +SSKN +KH+L+G++L+KWW  I+D++++E 
Sbjct: 174 DLYLSFTCPREILTKICLFTRPASQYLFPDSSKNSKKHILNGEELMKWWGFILDRLLIEC 233

Query: 235 FDNKTKATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRF 294
           F N T+A L+IPGE+   + +YLR   Y  W VGDIF+     +A+Y IPLFPDDPK RF
Sbjct: 234 FQNDTQAKLRIPGEDPARVRSYLRGMKYPLWQVGDIFTSKENSLAVYNIPLFPDDPKARF 293

Query: 295 LDHLISDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNE-PERTDIIIPT 353
           +  L  + R+ KV++ +FW ELQ RQEF+L  T SV+G+SG  +   +  P   D+I+P 
Sbjct: 294 IHQLAEEDRLLKVSLSSFWIELQERQEFKLSVTSSVMGISGYSLATPSLFPSSADVIVPK 353

Query: 354 SKKNFKNLKNYIXXXXXXXXXXXXXXXMNIRDIFDMHYSTKMIKVIGN-HHKIATTKRPE 412
           S+K F+ +K YI                NIRD   +  +T +  + G   H+      P 
Sbjct: 354 SRKQFRAIKKYITGEEYDTEEGAIEAFTNIRDFLLLRMATNLQSLTGKREHRERNQPVPA 413

Query: 413 INTINVINTLS 423
            N    INTL+
Sbjct: 414 SN----INTLA 420

>AAL173C [14] [Homologous to ScYLL002W (REM50) - SH] (38265..39527)
           [1263 bp, 420 aa]
          Length = 420

 Score =  322 bits (824), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 172/429 (40%), Positives = 246/429 (57%), Gaps = 29/429 (6%)

Query: 1   MSLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCF 60
           M L+  + +ALP GH+F++++LQS   E  P+T       + +G +  TI  QHF  L  
Sbjct: 1   MGLKELLAEALPAGHDFDVLHLQSPATERPPLT-------EASGCSPTTIAAQHFFTLSN 53

Query: 61  EEKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAIS 120
             KV +AL++VVY  +   +    +R+LFVSKADTNGYCD+R+D+ + T++++ ++L+I 
Sbjct: 54  NSKVFYALQVVVYICIEGTSG---DRMLFVSKADTNGYCDVRVDVRRATRALLQFLLSID 110

Query: 121 PGHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNR----PLDSKGITSRVKIPDQDL 176
           P HYL+ V+ +     +   +I  +T+   AL IL+ R     LD +    R +      
Sbjct: 111 PSHYLQRVRRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRAR------ 164

Query: 177 YVSFPVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFD 236
           Y SFP P +  T+++LFTRAEP YLFS S++NP KHVL GD+LL+WWL  VD ++V  FD
Sbjct: 165 YTSFPCPPQYTTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTLFD 224

Query: 237 NKTKATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLD 296
             T A L IPGE+  V ++YLR   +  W VG +F  S +D AL RIP FPDDPKGRFLD
Sbjct: 225 PATDAALLIPGEDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGRFLD 284

Query: 297 HLISDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKK 356
            L  +GR    ++  FWTEL ARQEFRLG  V V+G +G Y G C  P   D++ P S  
Sbjct: 285 DLAHEGR--NPSLRAFWTELVARQEFRLGVVVGVVGAAGLYTGPCARPAPEDLLCPASPA 342

Query: 357 NFKNLKNYIXXXXXXXXXXXXXXXMNIRDIFDMHYSTKMIKVIGNHHKIA-------TTK 409
           ++ ++K+Y+                N+ D   + Y   M +V G H            TK
Sbjct: 343 DYVHVKHYVTAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQDATK 402

Query: 410 RPEINTINV 418
           RP +N +  
Sbjct: 403 RPAVNDLTA 411

>Scas_629.20
          Length = 440

 Score =  308 bits (789), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/434 (41%), Positives = 255/434 (58%), Gaps = 36/434 (8%)

Query: 2   SLECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCFE 61
           +L+  +   LP GH+FE+++LQ  P +T  I  P    ++    T+ T+K QHF  L   
Sbjct: 8   TLDELLASVLPRGHDFELLHLQDEPAQTHDIVTPMPTTQE-RADTL-TVKIQHFFTLFHN 65

Query: 62  EKVVFALEIVVYFSLNSANNGPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAISP 121
           +K VFALEI VY +L+S +N    +L+FVSKADT+GYCD++L +G ITK  + Y++++ P
Sbjct: 66  KKAVFALEIYVYLTLSSLHN---TKLIFVSKADTSGYCDIKLRMGDITKVFLQYLISVDP 122

Query: 122 GHYLRAVKPLIRKALSGAKIIKRSTSVQRALEILSNR----PLDSKGITSRVKIPDQDLY 177
            HYLR VKPL R       +I++ TSV+R+L IL+ R    P   +  T +  I   D+ 
Sbjct: 123 LHYLRKVKPLRRVNDHDESLIRKGTSVERSLRILAVRVDLSPHPCQN-TDKFYITRNDVG 181

Query: 178 VSFPVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFD- 236
                 T  VTK+ LFTR    YLF  SSKN +KH L+GD+LLKWW+KI+D +V  DFD 
Sbjct: 182 GD----TNWVTKICLFTRPADDYLFIGSSKNAKKHKLNGDQLLKWWMKIIDGLVCTDFDP 237

Query: 237 NKTKATLQIPGEEK-RVISNYLRN--TAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGR 293
           N   A L++PGE+  RV   YL    T   NW VGDIF  +  D+A++ +PLFPDDPK R
Sbjct: 238 NNVSARLRVPGEDTGRVSRTYLNGDLTQSNNWQVGDIFGGTGNDLAVFHVPLFPDDPKSR 297

Query: 294 FLDHLISDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGK------YIGRCNEPERT 347
           F+ HL+ + RI K N+ T+W ELQ RQEF+L   VSVIGV G       Y+     P   
Sbjct: 298 FIRHLVQENRIMKTNLKTYWMELQERQEFKLSVIVSVIGVEGHTKKIPDYL-----PNDR 352

Query: 348 DIIIPTSKKNFKNLKNYIXXXXXXXXXXXXXXXMNIRDIFDMHYSTKMIKVIGNHHKIAT 407
           +I I +S++ F+ +++Y+               +N+RD  ++ YS K++K+ G       
Sbjct: 353 EIFICSSRRQFRYIRSYVAGEEYDNEEGTLESYVNVRDYLELRYSKKLLKLSG------- 405

Query: 408 TKRPEINTINVINT 421
           T+ PEI    V +T
Sbjct: 406 TREPEIRKPVVAST 419

>CAGL0D05786g 550165..551436 similar to tr|Q07794 Saccharomyces
           cerevisiae YLL002w REM50 drug resistance, start by
           similarity
          Length = 423

 Score =  292 bits (748), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 171/425 (40%), Positives = 239/425 (56%), Gaps = 14/425 (3%)

Query: 3   LECYIKDALPFGHEFEIINLQSIPRETSPITFPKREAEDVNGKTVKTIKTQHFVALCFEE 62
           L+  +K+ LP    FEI++LQS P E++P+          N  T  TIKT+H   L ++ 
Sbjct: 2   LQAILKEVLPQDSSFEILHLQSPPSESAPLV---NNTSKQNRAT--TIKTEHLFCLAYKG 56

Query: 63  KVVFALEIVVYFSLNSANN-GPVERLLFVSKADTNGYCDLRLDIGQITKSIIAYILAISP 121
           ++ + LE+ VY + N  N     ERL+FVSKADTNGYCD+R++I  +T  +I Y+L+I+P
Sbjct: 57  RIFYGLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKLVTLQLIRYVLSINP 116

Query: 122 GHYLRAVKPLIR--KALSGAKIIKRSTSVQRALEILSNRPLDSKGITSRVKIPDQDLYVS 179
            +YL  V P  R  K      +I ++T+ ++AL+IL++R  +   I   +       Y  
Sbjct: 117 DYYLHRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHNLIEPEIF---NAFYTK 173

Query: 180 FPVPTEIVTKVSLFTRAEPQYLFSNSSKNPRKHVLSGDKLLKWWLKIVDQIVVEDFD-NK 238
           F    E+VTK++LFTR   QYLF NSSKNP KH L GD LLKWW  ++D ++V DF+ NK
Sbjct: 174 FHSGKELVTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWASLLDNLLVSDFNLNK 233

Query: 239 TKATLQIPGEEKRVISNYLRNTAYQNWTVGDIFSESPQDIALYRIPLFPDDPKGRFLDHL 298
           TKA ++IPGE+K     Y        WT GDIFS++  D  +  IP+FPDDPK RF+  L
Sbjct: 234 TKAKIRIPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIKCIPMFPDDPKSRFMKQL 293

Query: 299 ISDGRISKVNVLTFWTELQARQEFRLGSTVSVIGVSGKYIGRCNEPERTDIIIPTSKKNF 358
             + RI   ++ TFWTELQ RQEF+L   VSV+G+SG Y    N    TD+    SK+ F
Sbjct: 294 FEENRIQTTSLDTFWTELQERQEFKLSVVVSVMGISGIYEIDTNYKPSTDVYRCRSKRQF 353

Query: 359 KNLKNYIXXXXXXXXXXXXXXXMNIRDIFDMHYSTKMIKVIGN-HHKIATTKRPEINTIN 417
             +KNYI                N+ D       T ++ V GN  +      R   +T  
Sbjct: 354 HCIKNYITGEEYDTEEGALESYQNVNDYLSRE-GTSLLTVTGNADYSKFKQNRTTTSTPV 412

Query: 418 VINTL 422
           V+NTL
Sbjct: 413 VVNTL 417

>Kwal_23.5556
          Length = 960

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%)

Query: 36  KREAEDVNGKTVKTIKTQHFVALCFEEKVVFALEIVVYFSLNSANNGPVERLLFVSKAD 94
           ++EAED +G + +   + H + +  E  +  +LEIV YF  ++     V+ LL +   D
Sbjct: 173 EKEAEDSSGTSPEPSSSSHKLNISKEALIQLSLEIVPYFLKHNGEADAVDLLLEIESID 231

>Sklu_1989.2 YGR094W, Contig c1989 1283-4597 reverse complement
          Length = 1104

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 22/102 (21%)

Query: 213 VLSGDKLLKWWLKI---VDQIVVEDFDNKTKATLQIPGEEKRVISNYLRNTAYQNWTVGD 269
           +    +L+ W +K+   +  + VE+ D K +  L +PG +++V    L + AYQ      
Sbjct: 314 IYRASRLINWSVKLNTAISNLEVENKDVKARTLLSVPGYDEKVEFGVLTSFAYQV----- 368

Query: 270 IFSESPQDIALYR---------IPLFPDDPK-----GRFLDH 297
           + S+    IA  R         I + P+DP+     G+F+ H
Sbjct: 369 VDSDEKLIIATTRPETMFGDTAIAVHPEDPRYKHLHGKFVQH 410

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,192,966
Number of extensions: 558395
Number of successful extensions: 1296
Number of sequences better than 10.0: 10
Number of HSP's gapped: 1290
Number of HSP's successfully gapped: 10
Length of query: 423
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 319
Effective length of database: 12,995,837
Effective search space: 4145672003
Effective search space used: 4145672003
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)