Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
KLLA0F12892g77576337870.0
Kwal_33.1520077377428430.0
AAL174C75677727600.0
YLL001W (DNM1)75776426650.0
CAGL0D05808g77678226580.0
Scas_690.2075577425210.0
YKR001C (VPS1)70455913541e-177
ABL001W68556113311e-174
Scas_668.2872256213301e-174
Sklu_2326.469055213181e-172
CAGL0L02299g70055713181e-172
Kwal_26.792469155413101e-171
KLLA0B13277g68456112671e-165
ACR164C8682684263e-43
KLLA0D06721g8832684211e-42
CAGL0L02783g8912684211e-42
YOR211C (MGM1)9022744202e-42
Sklu_1555.28842674184e-42
Kwal_26.86138612644184e-42
Scas_605.178912654086e-41
Scas_707.829458790.16
YOR165W (SEY1)77629760.57
Scas_543.361372750.70
Sklu_2179.478234740.91
AGR264C79129740.92
YCL047C25860692.6
Scas_377.114870672.9
CAGL0M12859g94165703.3
CAGL0K12474g29447684.0
CAGL0K11198g58282694.2
Sklu_2434.1157721684.5
YNL262W (POL2)222295678.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F12892g
         (763 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F12892g complement(1187526..1189853) similar to sp|P54861 S...  1463   0.0  
Kwal_33.15200                                                        1099   0.0  
AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988...  1067   0.0  
YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related pro...  1031   0.0  
CAGL0D05808g 552040..554370 highly similar to sp|P54861 Saccharo...  1028   0.0  
Scas_690.20                                                           975   0.0  
YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar ...   526   e-177
ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH] complement(3...   517   e-174
Scas_668.28                                                           516   e-174
Sklu_2326.4 YKR001C, Contig c2326 6273-8345                           512   e-172
CAGL0L02299g 264035..266137 highly similar to sp|P21576 Saccharo...   512   e-172
Kwal_26.7924                                                          509   e-171
KLLA0B13277g 1165743..1167797 highly similar to sp|P21576 Saccha...   492   e-165
ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH] (640832..64...   168   3e-43
KLLA0D06721g complement(578072..580723) similar to sp|P32266 Sac...   166   1e-42
CAGL0L02783g 322955..325630 highly similar to sp|P32266 Saccharo...   166   1e-42
YOR211C (MGM1) [5004] chr15 complement(738924..741632) Periphera...   166   2e-42
Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement         165   4e-42
Kwal_26.8613                                                          165   4e-42
Scas_605.17                                                           161   6e-41
Scas_707.8                                                             35   0.16 
YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in...    34   0.57 
Scas_543.3                                                             33   0.70 
Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement         33   0.91 
AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)...    33   0.92 
YCL047C (YCL047C) [499] chr3 complement(43661..44437) Protein of...    31   2.6  
Scas_377.1                                                             30   2.9  
CAGL0M12859g 1268191..1271016 highly similar to sp|P32565 Saccha...    32   3.3  
CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces...    31   4.0  
CAGL0K11198g complement(1086552..1088300) similar to sp|P23394 S...    31   4.2  
Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement      31   4.5  
YNL262W (POL2) [4345] chr14 (148211..154879) DNA polymerase epsi...    30   8.2  

>KLLA0F12892g complement(1187526..1189853) similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 775

 Score = 1463 bits (3787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/763 (94%), Positives = 721/763 (94%)

Query: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP 120
           VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP
Sbjct: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP 120

Query: 121 EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL 180
           EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL
Sbjct: 121 EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL 180

Query: 181 VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID 240
           VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID
Sbjct: 181 VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID 240

Query: 241 PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS 300
           PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS
Sbjct: 241 PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS 300

Query: 301 EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY 360
           EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY
Sbjct: 301 EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY 360

Query: 361 GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL 420
           GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL
Sbjct: 361 GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL 420

Query: 421 NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE 480
           NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE
Sbjct: 421 NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE 480

Query: 481 LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540
           LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF
Sbjct: 481 LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540

Query: 541 PSATEAMAEIVEARKNKKQTERXXXXXXXXXXXXXXXXXXXXXMKKSDSVDETEQDLKLD 600
           PSATEAMAEIVEARKNKKQTER                     MKKSDSVDETEQDLKLD
Sbjct: 541 PSATEAMAEIVEARKNKKQTERLQKQREYEKQLLLEQQQAEREMKKSDSVDETEQDLKLD 600

Query: 601 SDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQKSSNTKLSSRIDYNGSDNSYDIENLQI 660
           SDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQKSSNTKLSSRIDYNGSDNSYDIENLQI
Sbjct: 601 SDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQKSSNTKLSSRIDYNGSDNSYDIENLQI 660

Query: 661 QDFKDKSADAHTKSXXXXXXXXXXXXXXXXXXXXXVSYFSIVREMIEDQVPKAVMCLLVN 720
           QDFKDKSADAHTKS                     VSYFSIVREMIEDQVPKAVMCLLVN
Sbjct: 661 QDFKDKSADAHTKSEAATEFTEREELECELIRRLIVSYFSIVREMIEDQVPKAVMCLLVN 720

Query: 721 YSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLET 763
           YSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLET
Sbjct: 721 YSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLET 763

>Kwal_33.15200
          Length = 773

 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/774 (71%), Positives = 625/774 (80%), Gaps = 24/774 (3%)

Query: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMYDAGID+LDLPVLAVIGSQSSGKSSILETLVG+DFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSILETLVGKDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP 120
           VTRRPLVLQLNNI P+SPL+ +YD  + T  +           +E+TLEDHLRKN   +P
Sbjct: 61  VTRRPLVLQLNNIAPDSPLINDYDQETDTPQDH------ESVPEELTLEDHLRKNQGLEP 114

Query: 121 EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL 180
           + K+EWGEFLH+PGRRFY+F +IR+EIENETARIAGK KGISRIPINLK++SP VLNLTL
Sbjct: 115 QGKDEWGEFLHLPGRRFYNFKDIRKEIENETARIAGKNKGISRIPINLKVFSPRVLNLTL 174

Query: 181 VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID 240
           VDLPGITKVPIGEQP DIE+QI+NLILEYVAKPNCIILA+SPANVDLVNSESLKLAR++D
Sbjct: 175 VDLPGITKVPIGEQPADIEKQIKNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVD 234

Query: 241 PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS 300
           PHGKRTIGVITK+DLMD GTNALDILSGKLYPL+LGFVG+VNRSQQDIQ N++VEEALN+
Sbjct: 235 PHGKRTIGVITKMDLMDSGTNALDILSGKLYPLRLGFVGIVNRSQQDIQANRTVEEALNN 294

Query: 301 EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY 360
           EE FF++HPVYRTISTRCGTRYLAKLLNQ+LMNHIRDKLPDIKARLNTL+GQTEQEL TY
Sbjct: 295 EEAFFSRHPVYRTISTRCGTRYLAKLLNQILMNHIRDKLPDIKARLNTLMGQTEQELTTY 354

Query: 361 GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL 420
           G   +ITKENRAGLVLQLMNKFA +FISSI+GTSS+ISTKELCGGARIYYIYN +FG SL
Sbjct: 355 GGLGIITKENRAGLVLQLMNKFAARFISSIEGTSSDISTKELCGGARIYYIYNDIFGHSL 414

Query: 421 NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE 480
             INPT+NLS  DIRTAIRNSTGPRPSLFVPELAFDLLVKPQI LLL+PSQRCVELVYEE
Sbjct: 415 ESINPTANLSTADIRTAIRNSTGPRPSLFVPELAFDLLVKPQIYLLLEPSQRCVELVYEE 474

Query: 481 LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540
           LMKICHNCGSPELARYPKLQ+KL+EVVSELLRERLGPTRSYVESLIDIH+AYINTNHPNF
Sbjct: 475 LMKICHNCGSPELARYPKLQAKLIEVVSELLRERLGPTRSYVESLIDIHRAYINTNHPNF 534

Query: 541 PSATEAMAEIVEARKNKKQTERXXXXXXXXXXXXXXXXXXXXXMKKSDSVDETEQDLKLD 600
            SATEAM++I EA    K+  +                      KK +         K D
Sbjct: 535 LSATEAMSDIAEA----KRANQELSVKKNLDLEEVKLSLTNDFAKKPNENHILNTSKKAD 590

Query: 601 SDSTATSEHDSEEENDM---KQSKDSFLNYFFGKEQK--------SSNTKLSSRIDYNGS 649
           S +TA +   S E+++    KQSKDSFLNYFFGK+Q+        S N++ S+   Y  +
Sbjct: 591 SGNTAFNNDSSSEDDEKAPGKQSKDSFLNYFFGKDQQIAGNYKGFSDNSQFSNFNRYEQT 650

Query: 650 DNSYDIENLQIQDFKDKSADAHTKSXXXXXXXXXXXXXXXXXXXXXVSYFSIVREMIEDQ 709
           ++   + N +     D   +    +                     VSYF IVREMI+DQ
Sbjct: 651 EHQKHLANFENLKISDPVVEERNDTPQLTEREQLECELIRRLI---VSYFGIVREMIQDQ 707

Query: 710 VPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLET 763
           +PKAVMCLLVN+SKE +QNRLVTKLYKESLF++LLMEDQ LAQDR+KCV LL+T
Sbjct: 708 IPKAVMCLLVNFSKEIIQNRLVTKLYKESLFEDLLMEDQNLAQDRQKCVKLLDT 761

>AAL174C [13] [Homologous to ScYLL001W (DNM1) - SH] (35718..37988)
           [2271 bp, 756 aa]
          Length = 756

 Score = 1067 bits (2760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/777 (69%), Positives = 613/777 (78%), Gaps = 49/777 (6%)

Query: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP 120
           VTRRPLVLQLNNI  +SPL+  Y                   E E TLE+ LR  S    
Sbjct: 61  VTRRPLVLQLNNIKADSPLITAY----------------TAEEAEPTLENRLRGQSG--- 101

Query: 121 EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL 180
             ++ WGEFLH+PGRRFYDF+EIR EIENETARIAGK KGISRIPINLKIYSPHVLNLTL
Sbjct: 102 -ARDTWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTL 160

Query: 181 VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID 240
           +DLPGITKVPIGEQPPDIERQI NLILEYVAKPNCIILA+SPANVDLVNSESLKLAR++D
Sbjct: 161 IDLPGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVD 220

Query: 241 PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS 300
           PHGKRTIGV+TKLDLMD GTNA DIL+GKLYPL+LGFVGVVNRSQQDIQ+NKSVE+AL  
Sbjct: 221 PHGKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALAR 280

Query: 301 EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY 360
           EE+FF+KHP YRTIS++CGTR+LAK LNQ+L+NHIR+KLPDIKARLNTLIGQTEQELA+Y
Sbjct: 281 EEEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASY 340

Query: 361 GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL 420
           G   +I+ E+RAGLVLQ+MNKFAT F+SSI+GTSS+ISTKELCGGARIYYIYN +FG SL
Sbjct: 341 GGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNSL 400

Query: 421 NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE 480
             INPT+NLS+TDIRTAIRNSTGPRPSLFVPELAFDLLVKPQI+LLLDPSQRCVELVYEE
Sbjct: 401 KSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVYEE 460

Query: 481 LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540
           LMKICHNCGSP LARYP+LQ+KL+EVVS+LLRERLGPTRSYVESLIDIH+A+INTNHPNF
Sbjct: 461 LMKICHNCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNHPNF 520

Query: 541 PSATEAMAEIVEARKNKKQTERXXXXXXXXXXXXXXXXXXXXXMKKSDSVDETEQD---- 596
            SATEAMA+I EAR+ K+Q  +                     ++K+ +V E        
Sbjct: 521 LSATEAMADIAEARRQKQQNAKRSADLKKKRQQE---------LEKAAAVGEPTNGNPSP 571

Query: 597 LKLDSDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQK---------SSNTKLSSRID-- 645
                 +  +S+ + E+E D KQ+KDSFLNYFFGK+Q+         S + K    +D  
Sbjct: 572 KVDSDSTITSSDSEGEDERDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSF 631

Query: 646 YNGSDNSYDIENLQIQDFKDKSADAHTKSXXXXXXXXXXXXXXXXXXXXXVSYFSIVREM 705
           +    +   +E L+IQD      +A                         +SYF IVREM
Sbjct: 632 FQQEADFMAMETLKIQDTVAAPVEAEHPELTEREELECELIRRLI-----ISYFGIVREM 686

Query: 706 IEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLE 762
           +EDQ+PKAVMC LVN+ KE VQNRLV+KLYKESLF+ELLMED+TLAQDR KC+ LLE
Sbjct: 687 VEDQIPKAVMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLLE 743

>YLL001W (DNM1) [3418] chr12 (147889..150162) Dynamin-related
           protein that controls morphology and cortical
           localization of mitochondria [2274 bp, 757 aa]
          Length = 757

 Score = 1031 bits (2665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/764 (68%), Positives = 596/764 (78%), Gaps = 24/764 (3%)

Query: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMYD+GID+LDLP+LAV+GSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKP 120
           VTRRPLVLQLNNI PNSPL+   DNS +   E           K +      R +++   
Sbjct: 61  VTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHAD--- 117

Query: 121 EIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTL 180
               EWGEFLHIPG+RFYDF +I+REIENETARIAGK+KGIS+IPINLK++SPHVLNLTL
Sbjct: 118 ----EWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTL 173

Query: 181 VDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREID 240
           VDLPGITKVPIGEQPPDIE+QI+NLIL+Y+A PNC+ILA+SPANVDLVNSESLKLARE+D
Sbjct: 174 VDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVD 233

Query: 241 PHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNS 300
           P GKRTIGVITKLDLMD GTNALDILSGK+YPLKLGFVGVVNRSQQDIQ NK+VEE+L+ 
Sbjct: 234 PQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDK 293

Query: 301 EEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATY 360
           EE +F KHPVYRTIST+CGTRYLAKLLNQ L++HIRDKLPDIK +LNTLI QTEQELA Y
Sbjct: 294 EEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARY 353

Query: 361 GDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSL 420
           G     T E+RA LVLQLMNKF+T FISSIDGTSS+I+TKELCGGARIYYIYN +FG SL
Sbjct: 354 GGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSL 413

Query: 421 NFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEE 480
             I+PTSNLS+ D+RTAIRNSTGPRP+LFVPELAFDLLVKPQI+LLL+PSQRCVELVYEE
Sbjct: 414 KSIDPTSNLSVLDVRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEE 473

Query: 481 LMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540
           LMKICH CGS ELARYPKL+S L+EV+SELLRERL PTRSYVESLIDIH+AYINTNHPNF
Sbjct: 474 LMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNF 533

Query: 541 PSATEAMAEIVEARKNKKQTERXXXXXXXXXXXXXXXXXXXXXMKKSDSVDETEQDLKLD 600
            SATEAM +I++ R+ + Q                        +  + S+        +D
Sbjct: 534 LSATEAMDDIMKTRRKRNQ-------ELLKSKLSQQENGQTNGINGTSSISSN-----ID 581

Query: 601 SDSTATSEHDSEE-ENDMKQSKDSFLNYFFGKEQKSSNTKLSS--RIDYNGSDNSYDIEN 657
            DS   S++D +  + + KQ+KD FLNYFFGK++K      +S  +    G  N  D  N
Sbjct: 582 QDSAKNSDYDDDGIDAESKQTKDKFLNYFFGKDKKGQPVFDASDKKRSIAGDGNIEDFRN 641

Query: 658 LQIQDFKDKSADAHTKSXXXXXXXXXXXXXXXXXXXXXVSYFSIVREMIEDQVPKAVMCL 717
           LQI DF     D                          VSYF I+REMIEDQVPKAVMCL
Sbjct: 642 LQISDF--SLGDIDDLENAEPPLTEREELECELIKRLIVSYFDIIREMIEDQVPKAVMCL 699

Query: 718 LVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLL 761
           LVNY K+SVQNRLVTKLYKE+LF+ELL+EDQTLAQDRE CV  L
Sbjct: 700 LVNYCKDSVQNRLVTKLYKETLFEELLVEDQTLAQDRELCVKSL 743

>CAGL0D05808g 552040..554370 highly similar to sp|P54861
           Saccharomyces cerevisiae YLL001w DNM1 dynamin-related
           protein, start by similarity
          Length = 776

 Score = 1028 bits (2658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/782 (68%), Positives = 615/782 (78%), Gaps = 39/782 (4%)

Query: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMYD+GID+LDLP+LAV+GSQSSGKSSILETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIDPNSPLVY-NYD-----NSSSTSLEQVNDEPDARTEKEMTLEDH--- 111
           VTRRPLVLQLNNI  +SPL+  N D     N++S S   +N   +   E   +L D+   
Sbjct: 61  VTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNGFQN-NNESTTSLNDNNGA 119

Query: 112 --LRKNSNYKPEIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLK 169
                 SN     ++EWGEFLHIPGRRFYDFSEIRREIE+ETARIAGK KGIS+IPINLK
Sbjct: 120 SSAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESETARIAGKNKGISKIPINLK 179

Query: 170 IYSPHVLNLTLVDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVN 229
           IYSPHVLNLTLVDLPGITKVPIGEQPPDIE+QI+NLIL+YVA PNCIILA+SPANVDLVN
Sbjct: 180 IYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCIILAVSPANVDLVN 239

Query: 230 SESLKLAREIDPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ 289
           SESLKLARE+DPHG RTIGVITKLDLMD GTNALDILSGKLYPLKLGFVGVVNRSQQDIQ
Sbjct: 240 SESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDILSGKLYPLKLGFVGVVNRSQQDIQ 299

Query: 290 QNKSVEEALNSEEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTL 349
            NK+VEEALN EE++F +HPVYRT+S RCGTRYLAKLLNQ L++HI++KLPDIK RLNTL
Sbjct: 300 MNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLAKLLNQTLISHIKEKLPDIKTRLNTL 359

Query: 350 IGQTEQELATYGDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIY 409
           I QTEQEL+ YGD   ITKENRAGLVLQLMNKFAT FISSIDGTSSEISTKEL GGARIY
Sbjct: 360 ISQTEQELSQYGDTGDITKENRAGLVLQLMNKFATAFISSIDGTSSEISTKELSGGARIY 419

Query: 410 YIYNTLFGKSLNFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDP 469
           YIYN +FG +L  I+PT+NL++ DIRTAIRNSTGPRP+LFVPELAFDLLVKPQI+LLL+P
Sbjct: 420 YIYNNIFGNTLKSIDPTTNLTILDIRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEP 479

Query: 470 SQRCVELVYEELMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIH 529
           SQ+CVELVYEEL+KICH CG+PEL+RYPKL+SKL+EVVS+LLRERL PTRSYVESLIDIH
Sbjct: 480 SQQCVELVYEELVKICHKCGTPELSRYPKLKSKLIEVVSDLLRERLFPTRSYVESLIDIH 539

Query: 530 KAYINTNHPNFPSATEAMAEIVEARKNKKQTERXXXXXXXXXXXXXXXXXXXXXMKKSD- 588
           +AYINTNHPNF +AT+AM++I+++RK  ++ +R                       KSD 
Sbjct: 540 RAYINTNHPNFLTATDAMSDIIQSRKRNQENQRAQKMLEKEKQNEIQENGTASQNSKSDI 599

Query: 589 --SVDETEQDLKLDSDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQKSSNTKLSSR--- 643
             S+D TE    LDS   AT            +SKD+FLNYFFGK++KS    LS+R   
Sbjct: 600 EPSIDGTE----LDSSKDAT------------KSKDTFLNYFFGKDKKSQ-LSLSNRDGR 642

Query: 644 -IDYNGSDNSYDIENLQIQDFKD--KSADAHTKSXXXXXXXXXXXXXXXXXXXXXVSYFS 700
             + NG  + +  +  Q+ +F     S D   ++                     VSYF 
Sbjct: 643 FSELNGYKDDFSSQFQQL-NFNSNLNSDDDAFENANHPKLTEREDLECELIRRLIVSYFD 701

Query: 701 IVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNL 760
           IVREMIEDQ+PKA+MCLLVN+ K+SVQNRLVT+LY+ES+F+ELL+EDQTL QDRE  +  
Sbjct: 702 IVREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRESMFEELLVEDQTLMQDRENALKS 761

Query: 761 LE 762
           LE
Sbjct: 762 LE 763

>Scas_690.20
          Length = 755

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/774 (63%), Positives = 587/774 (75%), Gaps = 42/774 (5%)

Query: 1   MSSLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGI 60
           M+SLEDLIPTVNKLQDVMY +GID+LDLP+LAV+GSQSSGKSSI+ETLVGRDFLPRGTGI
Sbjct: 1   MASLEDLIPTVNKLQDVMYASGIDTLDLPILAVVGSQSSGKSSIIETLVGRDFLPRGTGI 60

Query: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTL---EDHLRKNSN 117
           VTRRPLVLQLNN+ P      N +  S  + +  +       + E +L   ED +   +N
Sbjct: 61  VTRRPLVLQLNNL-PKDSSQANENIGSDANPDPFSSGSTKNNQLEDSLSFVEDGINGQTN 119

Query: 118 YKPEIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLN 177
              + ++EWGEFLHIPGRRFYDF+EIRREIENETAR+AGK KGIS++PINLKI+SPHVLN
Sbjct: 120 NNQKHRSEWGEFLHIPGRRFYDFNEIRREIENETARLAGKNKGISKLPINLKIFSPHVLN 179

Query: 178 LTLVDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAR 237
           LTLVDLPGITKVPIGEQPPDIE+QI+NLIL+YVA PNC+ILA+SPANVDLVNSESLKLAR
Sbjct: 180 LTLVDLPGITKVPIGEQPPDIEKQIKNLILDYVATPNCLILAVSPANVDLVNSESLKLAR 239

Query: 238 EIDPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEA 297
           E+DP GKRTIGVITKLDLMD GTNALDILSGKLYPLK GFVG+VNRSQQDIQ NKSV+EA
Sbjct: 240 EVDPLGKRTIGVITKLDLMDSGTNALDILSGKLYPLKFGFVGIVNRSQQDIQLNKSVQEA 299

Query: 298 LNSEEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQEL 357
           LN+EE++F +HP+YRTIS +CGTRYLAKLLN++LMNHI+DKLPDIK +LNTL+ QTEQEL
Sbjct: 300 LNNEEEYFKRHPIYRTISNKCGTRYLAKLLNKILMNHIKDKLPDIKTKLNTLVTQTEQEL 359

Query: 358 ATYGDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFG 417
            +YG   + TKENRA L+LQLMNKFAT FISSI+G SS+I+TKELCGGARIYYIYN +FG
Sbjct: 360 YSYGGSALSTKENRANLILQLMNKFATSFISSIEGNSSDINTKELCGGARIYYIYNNVFG 419

Query: 418 KSLNFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELV 477
           KSL  I+PT+NL+  DIRTAIRNSTGPRP+LFVPE AFDLLV+PQ+ LLL+PSQRCVELV
Sbjct: 420 KSLKSIDPTTNLTTMDIRTAIRNSTGPRPTLFVPEFAFDLLVRPQVSLLLEPSQRCVELV 479

Query: 478 YEELMKICHNCGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNH 537
           YEELMKICH CGSPEL RYP+L+S L+EVV +LL+ERL PTR YVESLIDIHKAYINTNH
Sbjct: 480 YEELMKICHGCGSPELVRYPRLKSMLIEVVVDLLKERLAPTRQYVESLIDIHKAYINTNH 539

Query: 538 PNFPSATEAMAEIVEARKNKKQTERXXXXXXXXXXXXXXXXXXXXXMKKSDSVDETEQDL 597
           P+F  ATEA ++I+++ + +K  E                         SD    +E+  
Sbjct: 540 PSFLKATEAYSDIMKSNQERKDKENKNTEVITEKE------------NGSDRSSSSEETG 587

Query: 598 KLDSDSTATSEHDSEEENDMKQSKDSFLNYFFGKEQKSSNTKLSSRI--------DYNGS 649
            +D  +  + E D        +SK  F + FF  E++ S+  L++          D NGS
Sbjct: 588 YIDGKNNISKEAD--------ESKALFFDNFFATEKQDSSGNLANTSHDTLVINEDLNGS 639

Query: 650 DNSYDIENLQIQDFKDKSADAHTKSXXXXXXXXXXXXXXXXXXXXXVSYFSIVREMIEDQ 709
                + NL I +      ++ T                       +SYF I+REMIEDQ
Sbjct: 640 ----LLGNLHITE------NSQTTYDLEPHLSEREQLECELIRRLIISYFGIIREMIEDQ 689

Query: 710 VPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREKCVNLLET 763
           +PKA+M  LVNY KESVQNRLVTKLYKES+ +ELL+EDQT+AQDR  C  LLET
Sbjct: 690 IPKAIMFFLVNYCKESVQNRLVTKLYKESMLEELLVEDQTIAQDRANCERLLET 743

>YKR001C (VPS1) [3257] chr11 complement(440251..442365) Vacuolar
           sorting protein, member of the dynamin family of GTPases
           [2115 bp, 704 aa]
          Length = 704

 Score =  526 bits (1354), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 262/559 (46%), Positives = 380/559 (67%), Gaps = 13/559 (2%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPE 121
           TRRPLVLQL N  P     +   N ++  L  +N   D + + E        +N     +
Sbjct: 63  TRRPLVLQLINRRPKKS-EHAKVNQTANELIDLNINDDDKKKDE----SGKHQNEGQSED 117

Query: 122 IKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLV 181
            K EWGEFLH+PG++FY+F EIR+EI  ET ++ G   GIS +PINL+IYSPHVL LTLV
Sbjct: 118 NKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLV 177

Query: 182 DLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDP 241
           DLPG+TKVP+G+QPPDIERQI++++L+Y++KPN IIL+++ AN DL NS+ LKLARE+DP
Sbjct: 178 DLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDP 237

Query: 242 HGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNSE 301
            G RTIGV+TK+DLMDQGT+ +DIL+G++ PL+ G++ V+NR Q+DI+  K++ EAL +E
Sbjct: 238 EGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENE 297

Query: 302 EQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATYG 361
            +FF  HP Y + +  CGT YLAK LN +L++HIR  LP+IKA++   + + + EL   G
Sbjct: 298 RKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKKYQNELINLG 357

Query: 362 DDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSLN 421
            +   T ++ + +VL ++  F+ ++   +DG + E+S++EL GGARI Y+++  F   ++
Sbjct: 358 PE---TMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVD 414

Query: 422 FINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEEL 481
            ++P   +  +DIRT + NS+G  PSLFV   AF++LVK QIR   +PS R V LV++EL
Sbjct: 415 SLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDEL 474

Query: 482 MKICHNCGS-PELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540
           +++     S P+ +RYP L+  +     + L++   PT  +V  +I   + YINT HP+ 
Sbjct: 475 VRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDL 534

Query: 541 PSATEAMAEIVEARKNKKQ 559
              ++AM  +VE + + +Q
Sbjct: 535 LKGSQAMV-MVEEKLHPRQ 552

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%)

Query: 697 SYFSIVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREK 756
           SYFSIV+  I D +PKA+M  L+  SK  +Q  L+ KLY +   +EL  E+    Q R++
Sbjct: 627 SYFSIVKRTIADIIPKALMLKLIVKSKTDIQKVLLEKLYGKQDIEELTKENDITIQRRKE 686

Query: 757 CVNLLE 762
           C  ++E
Sbjct: 687 CKKMVE 692

>ABL001W [591] [Homologous to ScYKR001C (VPS1) - SH]
           complement(395835..397892) [2058 bp, 685 aa]
          Length = 685

 Score =  517 bits (1331), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 265/561 (47%), Positives = 378/561 (67%), Gaps = 26/561 (4%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRG+GIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGSGIV 62

Query: 62  TRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPE 121
           TRRPLVLQL N             ++   L +++   D +T +    ED+          
Sbjct: 63  TRRPLVLQLINRRGKK----GDKRNAHGDLLELDVAADQKTGQS---EDN---------- 105

Query: 122 IKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLV 181
              EWGEFLH PG++FY+F +IR+EI NET ++ GK  GIS IPINL+IYSPHVL LTLV
Sbjct: 106 -AEEWGEFLHAPGKKFYNFDQIRQEIVNETEKLTGKNAGISPIPINLRIYSPHVLTLTLV 164

Query: 182 DLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDP 241
           DLPG+TKVP+G+QP DIE QI+N+I++Y++KPN IILA++ AN DL NS+ LKLARE+DP
Sbjct: 165 DLPGLTKVPVGDQPVDIESQIKNMIMQYISKPNAIILAVNAANADLANSDGLKLAREVDP 224

Query: 242 HGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNSE 301
            G RTIGV+TK+DLMD+GT+ +DILSG++ PL+ G+V V+NR Q+DI+  K++ EALN E
Sbjct: 225 EGTRTIGVLTKIDLMDEGTDVVDILSGRIIPLRYGYVPVINRGQKDIESRKTIREALNDE 284

Query: 302 EQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATYG 361
           ++FF  HP Y + +  CGT YLAK LN +L++HIR  LP+IK ++   + + + EL   G
Sbjct: 285 KRFFENHPSYSSNANYCGTPYLAKKLNSILLHHIRQTLPEIKNKIELSLKKYQAELLALG 344

Query: 362 DDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSLN 421
            +   T ++   +VL ++  F+ ++   +DG + E+S++EL GGARI ++++ +F   + 
Sbjct: 345 PE---TLDSPNSIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIFKGGVY 401

Query: 422 FINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEEL 481
            ++P   +  +DIRT + NS+G  PSLFV   AF++LVK QI+   DPS R V L+++EL
Sbjct: 402 ALDPFDQIKDSDIRTIMYNSSGAAPSLFVGTEAFEVLVKQQIQRFEDPSLRLVALIFDEL 461

Query: 482 MKICHNCGS-PELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540
           ++I     S P+ ARYP L+  +     + L+ER+ P   +V  +I   + YINT HP+ 
Sbjct: 462 VRILREIISQPKYARYPGLREAISNYFIQYLKERIIPANDFVVDIIKSEQTYINTAHPDL 521

Query: 541 PSATEAMAEIVEARKNKKQTE 561
              ++AMA +VE R + KQ +
Sbjct: 522 LKGSQAMA-MVEERLHPKQVD 541

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%)

Query: 697 SYFSIVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREK 756
           SYFSIV+  + D +PKAVM  L+  SK  +Q  L+ KLY     +EL  E+    Q R++
Sbjct: 608 SYFSIVKRTVADLIPKAVMLKLIVKSKNDIQKILLEKLYGNQDIEELTKENDITIQRRKE 667

Query: 757 CVNLLE 762
           C N+++
Sbjct: 668 CHNMVQ 673

>Scas_668.28
          Length = 722

 Score =  516 bits (1330), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 264/562 (46%), Positives = 383/562 (68%), Gaps = 17/562 (3%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNN----IDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKN-- 115
           TRRPLVLQL N     +  +    N  N  S  L  ++ + DA  +KE    D  +K   
Sbjct: 63  TRRPLVLQLINRRSKKEKEAAPQANTKNDVSKQLLDLDLQDDA-DKKEAPASDKTKKGEK 121

Query: 116 --SNYKPEIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSP 173
             ++   +   EWGEFLH+PG++F++F EIR+EI  ET ++ G   GIS IPINL+IYSP
Sbjct: 122 GATSQSEDNAEEWGEFLHLPGKKFFNFDEIRQEIVRETEKVTGTNVGISSIPINLRIYSP 181

Query: 174 HVLNLTLVDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESL 233
           +VL LTLVDLPG+TKVP+G+QPPDIE+QI+N++L+Y++KPN IIL+++ AN DL NS+ L
Sbjct: 182 YVLTLTLVDLPGLTKVPVGDQPPDIEKQIKNMLLKYISKPNAIILSVNAANTDLANSDGL 241

Query: 234 KLAREIDPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKS 293
           KLARE+DP G RTIGV+TK+DLMDQGT+ +DIL+G++ PL+ G++ V+NR Q+DI+  K+
Sbjct: 242 KLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEGKKT 301

Query: 294 VEEALNSEEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQT 353
           +  AL  E++FF +HP Y + +  CGT YLAK LN +L++HIR  LPDIKA++   + + 
Sbjct: 302 IRSALEDEKRFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKAKIENTLKKY 361

Query: 354 EQELATYGDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYN 413
           + EL + G +   T ++   +VL ++  F+ ++   +DG + E++++EL GGARI ++++
Sbjct: 362 QNELISLGPE---TMDSSNSIVLSMITDFSNEYSGILDGEAKELTSQELSGGARISFVFH 418

Query: 414 TLFGKSLNFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRC 473
            +F   ++ ++P   +  +DIRT + NS+G  PSLFV   AF++LVK QI+   +PS R 
Sbjct: 419 EVFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIKRFEEPSLRL 478

Query: 474 VELVYEELMKICHN-CGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAY 532
           V LV++EL++I       P+ ARYP L+  +     + L+E + PT  +V  +ID  + Y
Sbjct: 479 VNLVFDELVRILKQIITQPKYARYPALREAISNEFIDFLKESMIPTNKFVTDIIDAEQTY 538

Query: 533 INTNHPNFPSATEAMAEIVEAR 554
           INT HP+    + AMA +VE R
Sbjct: 539 INTAHPDLLKGSRAMA-MVEER 559

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%)

Query: 697 SYFSIVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREK 756
           SYF IV+  + D +PKA+M  L+  S+  +Q  L+ KLY      +L  E++   Q R++
Sbjct: 645 SYFGIVKRTVADIIPKALMLKLIVKSRTDIQKVLLEKLYSSGQLKDLTKENELTIQRRKE 704

Query: 757 CVNLLE 762
           C  +++
Sbjct: 705 CNRMVD 710

>Sklu_2326.4 YKR001C, Contig c2326 6273-8345
          Length = 690

 Score =  512 bits (1318), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 259/552 (46%), Positives = 374/552 (67%), Gaps = 24/552 (4%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EALIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPE 121
           TRRPLVLQL N           D++  ++  ++ D   A  +K+   ED+          
Sbjct: 63  TRRPLVLQLINKRTKK------DSTLQSAKNELLDLNVADDQKKGQSEDN---------- 106

Query: 122 IKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLV 181
              EWGEFLHIPG++FY+F +IR+EI  ET +  GK  GIS IPINL+IYSPHVL LTLV
Sbjct: 107 -AEEWGEFLHIPGKKFYNFDQIRQEIVIETEKTTGKNAGISPIPINLRIYSPHVLTLTLV 165

Query: 182 DLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDP 241
           DLPG+TKVP+G+QP DIE+QI++++L+Y++KPN IIL+++ AN DL NS+ LKLARE+DP
Sbjct: 166 DLPGLTKVPVGDQPADIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDP 225

Query: 242 HGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNSE 301
            G RTIGV+TK+DLMD GT+ +DIL+G++ PL+ G++ V+NR Q+DI+ +K++  AL  E
Sbjct: 226 EGTRTIGVLTKVDLMDHGTDVIDILAGRVIPLRYGYIPVINRGQKDIEAHKTIRAALEDE 285

Query: 302 EQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATYG 361
           ++FF  HP Y + +  CGT YLAK LN +L++HIR  LP+IK ++   + + + EL + G
Sbjct: 286 KKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKNKIEVTLKKYQAELLSLG 345

Query: 362 DDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSLN 421
            +   T ++   +VL ++  F+ ++   +DG + E+S++EL GGARI ++++ +F   +N
Sbjct: 346 PE---TMDSPNSIVLSMITDFSKEYTGILDGEARELSSQELSGGARISFVFHEIFKNGVN 402

Query: 422 FINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEEL 481
            ++P   +  +DIRT + NS+G  PSLFV   AF++LVK QIR   +PS R V LV++EL
Sbjct: 403 ALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQIRRFEEPSLRLVSLVFDEL 462

Query: 482 MKICHNCGS-PELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540
           ++I     S P+ +RYP L+  L     + L+E + PT  +V  +I   + YINT HP+ 
Sbjct: 463 VRILKQIISHPKYSRYPGLREALSNYFVQFLKEAIIPTNEFVLDVIRSEQTYINTAHPDL 522

Query: 541 PSATEAMAEIVE 552
              ++AMA + E
Sbjct: 523 LKGSQAMATVEE 534

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%)

Query: 697 SYFSIVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREK 756
           SYF IV+  + D +PKA+M  L+  SK  +Q  L+ KLY      EL  E+    Q R++
Sbjct: 613 SYFGIVKRTVADIIPKAIMLKLIVKSKNDIQKILLEKLYGNQDIAELTKENDITIQRRKE 672

Query: 757 CVNLLE 762
           C  ++E
Sbjct: 673 CHKMVE 678

>CAGL0L02299g 264035..266137 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1, start by
           similarity
          Length = 700

 Score =  512 bits (1318), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 256/557 (45%), Positives = 376/557 (67%), Gaps = 26/557 (4%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EHLIATINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRK-----NS 116
           TRRPLVLQL N              S  S ++V    D   +  + ++DH +K       
Sbjct: 63  TRRPLVLQLIN------------RRSKKSDKEVQKASDQLLD--LNMDDHSKKEDPAGKK 108

Query: 117 NYKPEIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVL 176
               +   EWGEFLH+P ++FY+F EIR EI  ET ++ G   GIS IPINL+IYSPHVL
Sbjct: 109 GQSEDNAEEWGEFLHLPDKKFYNFDEIRNEIVRETDKLTGTNLGISPIPINLRIYSPHVL 168

Query: 177 NLTLVDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLA 236
            LTLVDLPG+TKVP+G+QPPDIE+QI++++L+Y++KPN IIL+++ AN DL NS+ LKLA
Sbjct: 169 TLTLVDLPGLTKVPVGDQPPDIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLA 228

Query: 237 REIDPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEE 296
           RE+DP G RTIGV+TK+DLMD+GT+ +DIL+G++ PL+ G++ V+NR Q+DI+  K++  
Sbjct: 229 REVDPEGTRTIGVLTKVDLMDKGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIRA 288

Query: 297 ALNSEEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQE 356
           AL  E++FF +HP Y + +  CGT YLAK LN +L++HIR  LPDIK ++ + + +   E
Sbjct: 289 ALQDEKKFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIESTLKKYVNE 348

Query: 357 LATYGDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLF 416
           L + G +   T ++ + +VL ++  F+ ++   +DG + E++++EL GGARI ++++ +F
Sbjct: 349 LESLGPE---TMDSASSIVLSMITDFSNEYTGILDGEAKELTSQELSGGARISFVFHEIF 405

Query: 417 GKSLNFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVEL 476
              ++ ++P   +  +DIRT + NS+G  PSLFV   AF++LVK QIR   +PS R V L
Sbjct: 406 KNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTL 465

Query: 477 VYEELMKICHNCGS-PELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINT 535
           V++EL+++     S P+ ARYP L+  +     + L+E + PT  +V+ +I   + YINT
Sbjct: 466 VFDELVRMLKQIISQPKYARYPALREAISTQFIDYLKEAIVPTNEFVQDIIKSEQTYINT 525

Query: 536 NHPNFPSATEAMAEIVE 552
            HP+    ++AM+ + E
Sbjct: 526 AHPDLLKGSQAMSMVEE 542

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%)

Query: 697 SYFSIVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREK 756
           SYF+IV+  I D VPKA+M  L+  SK  +Q  L+ KLY     DEL  E+    Q R++
Sbjct: 623 SYFNIVKRTIADLVPKALMLKLIVKSKNDMQKVLLQKLYGNQDIDELTKENDITIQRRKE 682

Query: 757 CVNLLE 762
           C  ++E
Sbjct: 683 CQRMIE 688

>Kwal_26.7924
          Length = 691

 Score =  509 bits (1310), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 257/554 (46%), Positives = 370/554 (66%), Gaps = 29/554 (5%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+G+QSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   EALISTINKLQDALAPLGGGSQSPIDLPQITVVGTQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVND--EPDARTEKEMTLEDHLRKNSNYK 119
           TRRPLVLQL N            +  +TS    ND  E   + +K    ED++       
Sbjct: 63  TRRPLVLQLVN---------KRSSKGNTSQSSKNDLLELGNQEQKGGQSEDNV------- 106

Query: 120 PEIKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLT 179
               +EWGEFLH+PG++F++F EIR+EI NET +  GK  GIS +PINLKI SPHVL LT
Sbjct: 107 ----DEWGEFLHLPGKKFFNFDEIRQEIVNETEKTTGKNAGISPVPINLKICSPHVLTLT 162

Query: 180 LVDLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREI 239
           LVDLPG+TKVP+G+QP DIE+QI++++L Y++KPN IIL+++ AN DL NS+ LKLARE+
Sbjct: 163 LVDLPGLTKVPVGDQPADIEKQIKDMLLRYISKPNAIILSVNAANTDLANSDGLKLAREV 222

Query: 240 DPHGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALN 299
           DP G RTIGV+TK+DLMDQGT+ +DIL+G++ PL+ G++ V+NR Q+DI+  K++  AL 
Sbjct: 223 DPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEVKKTIRAALE 282

Query: 300 SEEQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELAT 359
            E ++F  HP Y + +  CGT YLAK LN +L++HIR  LPDIK ++   + + + EL +
Sbjct: 283 DERRYFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIELTLKKYQAELMS 342

Query: 360 YGDDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKS 419
            G +   T ++   ++L ++  F+ ++   +DG + E+S++EL GGARI ++++ ++   
Sbjct: 343 LGPE---TMDSPNSIILSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIYKNG 399

Query: 420 LNFINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYE 479
           +  ++P   +  +DIRT + NS+G  PSLFV   AF++LVK QI    +PS R V LV++
Sbjct: 400 VRALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTQAFEVLVKQQINRFEEPSLRLVSLVFD 459

Query: 480 ELMKICHNCGS-PELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHP 538
           EL++I     S P+  RYP L+  +     + L+E + PT S+V  +I   + YINT HP
Sbjct: 460 ELVRILKQIISQPKYGRYPGLREAMSNYFIQFLKEAIIPTNSFVTDIIQAEQTYINTAHP 519

Query: 539 NFPSATEAMAEIVE 552
           +    ++AMA I E
Sbjct: 520 DLLKGSQAMAMIEE 533

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%)

Query: 697 SYFSIVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREK 756
           SYF+IV+  + D +PKAVM  L+  SK  +Q  L+ KLY      EL  E+    Q R++
Sbjct: 614 SYFNIVKRTVADVIPKAVMLKLIVKSKNDIQKILLEKLYGNQDIAELTKENDITIQRRKE 673

Query: 757 CVNLLE 762
           C  + E
Sbjct: 674 CHKMTE 679

>KLLA0B13277g 1165743..1167797 highly similar to sp|P21576
           Saccharomyces cerevisiae YKR001c VPS1 member of the
           dynamin family of GTPases, start by similarity
          Length = 684

 Score =  492 bits (1267), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 254/561 (45%), Positives = 367/561 (65%), Gaps = 28/561 (4%)

Query: 5   EDLIPTVNKLQDVMYDAGIDS---LDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIV 61
           E LI T+NKLQD +   G  S   +DLP + V+GSQSSGKSS+LE +VGRDFLPRGTGIV
Sbjct: 3   ERLIATINKLQDALAPLGGGSQTPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIV 62

Query: 62  TRRPLVLQLNNIDPNSPLVYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPE 121
           TRRPL+LQL N                    +V  E    TE+ + L D+   N     +
Sbjct: 63  TRRPLILQLIN-------------------RRVKKETKHATEELLDL-DNSAANGGQNED 102

Query: 122 IKNEWGEFLHIPGRRFYDFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLV 181
              EWGEF H+PG++ ++F+EIR+EI  ET +  GK  GIS +PI L++YSPHVL LTLV
Sbjct: 103 NAEEWGEFGHLPGKKLFNFNEIRKEIVLETDKSTGKNAGISAVPITLRVYSPHVLTLTLV 162

Query: 182 DLPGITKVPIGEQPPDIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDP 241
           DLPG+TKVP+G+QP DIERQI+++IL Y+ KPN IILA++PAN DL NS+ LKLARE+DP
Sbjct: 163 DLPGLTKVPVGDQPADIERQIKDMILTYIKKPNAIILAVNPANADLANSDGLKLAREVDP 222

Query: 242 HGKRTIGVITKLDLMDQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQNKSVEEALNSE 301
            G RTIGV+TK+DLMD+GT+ +DIL+G++ PLK G++ V+NR Q+DI++NK++  AL  E
Sbjct: 223 DGSRTIGVLTKVDLMDEGTDVIDILAGRVIPLKFGYIPVINRGQKDIEKNKTIRSALEDE 282

Query: 302 EQFFAKHPVYRTISTRCGTRYLAKLLNQVLMNHIRDKLPDIKARLNTLIGQTEQELATYG 361
           ++FF  HP Y   +  CGT YL K LN +L++HIR  LPDIK ++   + + + EL +  
Sbjct: 283 KRFFENHPSYSARALYCGTPYLTKKLNSILLHHIRQTLPDIKHKIEVTLKKYQTELLSL- 341

Query: 362 DDKVITKENRAGLVLQLMNKFATKFISSIDGTSSEISTKELCGGARIYYIYNTLFGKSLN 421
                +  + + +VL ++  F+ ++   +DG + E+++KEL GGAR+ ++++ +F   + 
Sbjct: 342 --GPESLSSSSSIVLSMITDFSKEYTGILDGEARELTSKELSGGARVSFVFHEIFKNGVY 399

Query: 422 FINPTSNLSMTDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIRLLLDPSQRCVELVYEEL 481
            ++P   +  +DIRT + N +G  PSLFV   AF++LVK QI     PS R V LV++EL
Sbjct: 400 ALDPFDQIKDSDIRTIMYNCSGSAPSLFVGTEAFEVLVKKQISRFEQPSLRLVNLVFDEL 459

Query: 482 MKICHN-CGSPELARYPKLQSKLVEVVSELLRERLGPTRSYVESLIDIHKAYINTNHPNF 540
           ++I       P+ +RYP L+  +     + L+E + PT  +V  +I   + YINT HP+ 
Sbjct: 460 VRILKQIINQPKYSRYPSLRDAISNNFVQFLKEAVIPTNDFVVDIIKSEQTYINTAHPDL 519

Query: 541 PSATEAMAEIVEARKNKKQTE 561
              ++AMA +VE R + +Q +
Sbjct: 520 LKGSQAMA-MVEERLHPRQVD 539

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 697 SYFSIVREMIEDQVPKAVMCLLVNYSKESVQNRLVTKLYKESLFDELLMEDQTLAQDREK 756
           SYFSIV+  + D +PKAVM  L+  SK  +Q  L+ KLY     DEL  E     Q R++
Sbjct: 607 SYFSIVKRSVADFIPKAVMLKLIVKSKNDIQKILLEKLYSSENLDELTKESDLTTQRRKE 666

Query: 757 C---VNLL 761
           C   VN+L
Sbjct: 667 CQKMVNIL 674

>ACR164C [1211] [Homologous to ScYOR211C (MGM1) - SH]
           (640832..643438) [2607 bp, 868 aa]
          Length = 868

 Score =  168 bits (426), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 145/268 (54%), Gaps = 55/268 (20%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPL 79
           D     + LP + V+GSQSSGKSS+LE++VGRDFLP+G+ +VTRRP+ L L N    S  
Sbjct: 200 DTNTPGVTLPSIVVVGSQSSGKSSVLESIVGRDFLPKGSNMVTRRPIELTLVNTPSGSET 259

Query: 80  VYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPEIKNEWGEFLHIPGRRFY- 138
             ++                                                 P  R Y 
Sbjct: 260 TADF-------------------------------------------------PTHRIYN 270

Query: 139 --DFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPP 196
             DF E++R I  E        + IS  PI L I SP V +L+LVDLPG  +V   +QP 
Sbjct: 271 LKDFREVKR-ILMELNLTVPTHEAISEDPIQLTIKSPRVPDLSLVDLPGYIQVEAADQPM 329

Query: 197 DIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLM 256
           +++ +I N+  +Y+A+PN IILAIS A+VDL NS +L+ ++  DP G RTIGVITKLDL+
Sbjct: 330 ELKSKIRNVCQKYLAEPN-IILAISAADVDLANSAALRASKLADPQGLRTIGVITKLDLV 388

Query: 257 DQGTNALDILSGKLYPLKLGFVGVVNRS 284
           +  + A D+L  K YPLK+G+VGV+ + 
Sbjct: 389 EP-SAARDLLMNKKYPLKMGYVGVITKG 415

>KLLA0D06721g complement(578072..580723) similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 883

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/268 (39%), Positives = 150/268 (55%), Gaps = 55/268 (20%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPL 79
           D+   +L LP + VIGSQSSGKSS+LE++VG+DFLP+GT +VTRRP+ L L     N+P 
Sbjct: 213 DSTSANLALPSIVVIGSQSSGKSSVLESIVGKDFLPKGTNMVTRRPIELTL----VNTP- 267

Query: 80  VYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPEIKNEWGEFLHIPGRRFY- 138
                                 T +E+T +                       P  R Y 
Sbjct: 268 ----------------------TSQEVTAD----------------------FPTMRIYN 283

Query: 139 --DFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPP 196
             DF E++R +      +   E  +S  PI L I S  V +L+LVDLPG  +V   +QP 
Sbjct: 284 LKDFKEVKRILTEMNMAVPSTE-AVSDDPIQLTIKSSRVPDLSLVDLPGYIQVEAVDQPI 342

Query: 197 DIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLM 256
           +++ +I  L  +Y+ +PN IILAIS A+VDL NS +L+ ++  DP G RTIGV+TKLDL+
Sbjct: 343 ELKSKIRQLCDKYLEEPN-IILAISAADVDLANSAALRASKVADPQGLRTIGVVTKLDLV 401

Query: 257 DQGTNALDILSGKLYPLKLGFVGVVNRS 284
           D  T A  IL+ + YPLK+G+VGV+ +S
Sbjct: 402 DAKT-ARAILNNRKYPLKMGYVGVITKS 428

>CAGL0L02783g 322955..325630 highly similar to sp|P32266
           Saccharomyces cerevisiae YOR211c MGM1 dynamin-like
           protein, hypothetical start
          Length = 891

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 104/268 (38%), Positives = 146/268 (54%), Gaps = 55/268 (20%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPL 79
           D+   +L LP + VIGSQSSGKSS+LE++VGR+FLP+G+ +VTRRP+ L L N       
Sbjct: 213 DSASANLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNT------ 266

Query: 80  VYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPEIKNEWGEFLHIPGRRFY- 138
                                                   P ++    +F   P  R Y 
Sbjct: 267 ----------------------------------------PNVQETTADF---PSLRVYN 283

Query: 139 --DFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPP 196
             DF E++R +      +   E  +S  PI L I S HV +L+LVDLPG  +V   +QP 
Sbjct: 284 MKDFREVKRMLTELNLAVPASE-AVSEEPIQLTIKSAHVPDLSLVDLPGYIQVEAADQPM 342

Query: 197 DIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLM 256
           +++ +I  L  +Y+A+PN IILAIS A+VDL NS +L+ ++  DP G RTIGVITKLDL+
Sbjct: 343 ELKSKIRMLCDKYLAEPN-IILAISAADVDLANSSALRASKVADPQGLRTIGVITKLDLV 401

Query: 257 DQGTNALDILSGKLYPLKLGFVGVVNRS 284
                A  IL+ + YPL +G+VGV+ +S
Sbjct: 402 S-AEEARKILTNRKYPLTMGYVGVITKS 428

>YOR211C (MGM1) [5004] chr15 complement(738924..741632) Peripheral
           membrane protein that mediates mitochondrial
           inheritance, member of dynamin family of GTPases [2709
           bp, 902 aa]
          Length = 902

 Score =  166 bits (420), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 147/274 (53%), Gaps = 55/274 (20%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPL 79
           D+    L LP + VIGSQSSGKSS+LE++VGR+FLP+G+ +VTRRP+ L L N  PNS  
Sbjct: 223 DSSSAHLTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNT-PNS-- 279

Query: 80  VYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPEIKNEWGEFLHIPGRRFY- 138
                                                       N   +F   P  R Y 
Sbjct: 280 -------------------------------------------NNVTADF---PSMRLYN 293

Query: 139 --DFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPP 196
             DF E++R +      +   E  +S  PI L I S  V +L+LVDLPG  +V   +QP 
Sbjct: 294 IKDFKEVKRMLMELNMAVPTSE-AVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPI 352

Query: 197 DIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLM 256
           +++ +I +L  +Y+  PN IILAIS A+VDL NS +LK ++  DP G RTIGVITKLDL+
Sbjct: 353 ELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLV 411

Query: 257 DQGTNALDILSGKLYPLKLGFVGVVNRSQQDIQQ 290
           D    A  IL+ K YPL +G+VGV+ ++   I +
Sbjct: 412 DP-EKARSILNNKKYPLSMGYVGVITKTPSSINR 444

>Sklu_1555.2 YOR211C, Contig c1555 412-3066 reverse complement
          Length = 884

 Score =  165 bits (418), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 151/267 (56%), Gaps = 55/267 (20%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPL 79
           D+   +L LP + VIGSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N  PNS  
Sbjct: 215 DSSSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNT-PNS-- 271

Query: 80  VYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPEIKNEWGEFLHIPGRRFY- 138
                                    E+T +                       P  R Y 
Sbjct: 272 ------------------------NEITAD----------------------FPALRVYN 285

Query: 139 --DFSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPP 196
             DF E++R I  E        + +S  PI L I +  V +L+LVDLPG  +V   +QP 
Sbjct: 286 LQDFKEVKR-ILMELNMAVPTSEAVSEEPIQLTIKASRVPDLSLVDLPGYIQVEAADQPL 344

Query: 197 DIERQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLM 256
           +++ +I  L  +Y+A+PN IILAIS A+VDL NS +L+ ++ +DP G+RTIGVITKLDL+
Sbjct: 345 ELKSKIRLLCEKYLAEPN-IILAISAADVDLANSAALRASKVVDPLGERTIGVITKLDLV 403

Query: 257 DQGTNALDILSGKLYPLKLGFVGVVNR 283
           +    A +IL+ K YPLK+G+VGV+ +
Sbjct: 404 EPA-KAREILNNKKYPLKMGYVGVITK 429

>Kwal_26.8613
          Length = 861

 Score =  165 bits (418), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 106/264 (40%), Positives = 148/264 (56%), Gaps = 49/264 (18%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPL 79
           D+   SL LP + VIGSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L N       
Sbjct: 201 DSSSASLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVN------- 253

Query: 80  VYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPEIKNEWGEFLHIPGRRFYD 139
                  +S S E   D P  R               N K                   D
Sbjct: 254 -------TSGSNETTADFPSLRA-------------YNIK-------------------D 274

Query: 140 FSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPPDIE 199
           F+E++R +      +   E  +S  PI L I S  V +L+LVDLPG  +V   +QP +++
Sbjct: 275 FNEVKRILMELNMAVPSSE-AVSADPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPYELK 333

Query: 200 RQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLMDQG 259
            +I  +   Y+A+PN IILAIS A+VDL NS +L+ ++  DP G RTIGVITKLDL++  
Sbjct: 334 SKIRQVCETYLAEPN-IILAISAADVDLANSSALRASKVADPKGLRTIGVITKLDLVEPA 392

Query: 260 TNALDILSGKLYPLKLGFVGVVNR 283
             A +IL+ K YPLK+G+VGV+ +
Sbjct: 393 -RAKEILNSKKYPLKMGYVGVITK 415

>Scas_605.17
          Length = 891

 Score =  161 bits (408), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 148/265 (55%), Gaps = 49/265 (18%)

Query: 20  DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPL 79
           D+   +L LP + VIGSQSSGKSS+LE++VG++FLP+G+ +VTRRP+ L L     N+P 
Sbjct: 214 DSTSANLTLPSIVVIGSQSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTL----VNTPG 269

Query: 80  VYNYDNSSSTSLEQVNDEPDARTEKEMTLEDHLRKNSNYKPEIKNEWGEFLHIPGRRFYD 139
           V           E   D P  RT              N K                   D
Sbjct: 270 VN----------ETTADFPSLRT-------------YNLK-------------------D 287

Query: 140 FSEIRREIENETARIAGKEKGISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPPDIE 199
           F E++R +      +   E  +S  PI L I S  + +L+LVDLPG  +V   +QP +++
Sbjct: 288 FKEVKRILMELNMAVPTTE-AVSEEPIQLTIKSSSIPDLSLVDLPGYIQVEAADQPTELK 346

Query: 200 RQIENLILEYVAKPNCIILAISPANVDLVNSESLKLAREIDPHGKRTIGVITKLDLMDQG 259
            +I  L  +Y+ +PN IILAIS A+VDL NS +L+ A+  DP G RTIGVITKLDL+   
Sbjct: 347 TKIRQLCDKYLNEPN-IILAISAADVDLANSSALRAAKMADPQGLRTIGVITKLDLISPE 405

Query: 260 TNALDILSGKLYPLKLGFVGVVNRS 284
             A +IL+ + YPLK+G+VGV+ +S
Sbjct: 406 A-ARNILNNRKYPLKMGYVGVITKS 429

>Scas_707.8
          Length = 294

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 9/58 (15%)

Query: 33 VIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPLVYNYDNSSSTS 90
          V+G+  +GKS++L+ L G+     G  +V         N +DP SPL    DN  +T+
Sbjct: 38 VVGANGAGKSTLLKLLAGKHLCLNGKILV---------NGLDPFSPLSMYQDNDKTTA 86

>YOR165W (SEY1) [4964] chr15 (644566..646896) Protein involved in
          vesicle formation and protein secretion [2331 bp, 776
          aa]
          Length = 776

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 25 SLDLPVLAVIGSQSSGKSSILETLVGRDF 53
           LD  V++V GSQSSGKS++L  L   +F
Sbjct: 34 GLDYHVISVFGSQSSGKSTLLNVLFNTNF 62

>Scas_543.3
          Length = 613

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 24  DSLDLPVLAVIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPLVYNY 83
           +SLD+ ++ VIG ++SGKS+ L+ L+  +FL  G+ +   +  +L L ++DP  P    Y
Sbjct: 216 ESLDVRIM-VIGGKNSGKSTFLKLLL-ENFLHGGSSMEMTQQELLYL-DLDPGQP---EY 269

Query: 84  DNSSSTSLEQVN 95
            +    SL ++N
Sbjct: 270 SHPECISLTEIN 281

>Sklu_2179.4 YOR165W, Contig c2179 7628-9976 reverse complement
          Length = 782

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%)

Query: 20 DAGIDSLDLPVLAVIGSQSSGKSSILETLVGRDF 53
          D G+D     V++V GSQSSGKS++L  L    F
Sbjct: 34 DVGVD---YHVISVFGSQSSGKSTLLNALFNTQF 64

>AGR264C [4575] [Homologous to ScYOR165W - SH] (1236213..1238588)
          [2376 bp, 791 aa]
          Length = 791

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 25 SLDLPVLAVIGSQSSGKSSILETLVGRDF 53
           LD  V++V GSQSSGKS++L  L    F
Sbjct: 40 GLDYHVISVFGSQSSGKSTLLNALFNTKF 68

>YCL047C (YCL047C) [499] chr3 complement(43661..44437) Protein of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.1486p [777 bp, 258 aa]
          Length = 258

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 10/60 (16%)

Query: 100 ARTEKEMTLEDHLRKNSN-----YKPEIKNEWGEFLHI-----PGRRFYDFSEIRREIEN 149
           AR +  ++ E  LR  S+     ++P I  EWG  +H+     P  R    SEIR +++N
Sbjct: 173 ARGDCHLSAESQLRYASDILEGKFEPVIPREWGARIHVMQNDYPALRNVSSSEIRNKLKN 232

>Scas_377.1
          Length = 148

 Score = 30.4 bits (67), Expect = 2.9,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 153 RIAGKEKG----ISRIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPPDIERQIENLILE 208
           R+ G+  G     S++ I   +YS  ++ L L+       VP+GE  PD++   EN    
Sbjct: 24  RVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFEN---- 79

Query: 209 YVAKPNCIIL 218
           Y+A P  I+L
Sbjct: 80  YLAMPIFIVL 89

>CAGL0M12859g 1268191..1271016 highly similar to sp|P32565
           Saccharomyces cerevisiae YIL075c SEN3, start by
           similarity
          Length = 941

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 452 ELAFDLLVKPQIRLLLDPSQRCVELVYEELMKICHNCGSPELARYPKLQSKLVEVVSELL 511
           +LA ++  K   ++ LDP    + +V+E++M  C      +LA    L++  ++VV  +L
Sbjct: 111 KLATEIYNKSGEQVNLDPK---LTIVFEKMMTKCTQANEYKLALGIALEAFRLDVVKSIL 167

Query: 512 RERLG 516
           +ERLG
Sbjct: 168 QERLG 172

>CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces
          cerevisiae YFL028c CAF16 ATP-binding cassette
          transporter family member, start by similarity
          Length = 294

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 9/47 (19%)

Query: 33 VIGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNIDPNSPL 79
          V+G+  +GKS++L+ L G+     G          +++N +DP SPL
Sbjct: 38 VVGANGAGKSTLLKLLSGKHLCLTGN---------IKVNGLDPFSPL 75

>CAGL0K11198g complement(1086552..1088300) similar to sp|P23394
           Saccharomyces cerevisiae YDR243c PRP28, hypothetical
           start
          Length = 582

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 418 KSLNFINPTSNLSMTDIRTAIRNSTG---PRPSLFVPELAFDLLVKPQIR-LLLDPSQRC 473
           K+LN ++     SM+DI   +RN        P   +  L   L+V  +I+ L+LD + R 
Sbjct: 284 KNLNAVSIVGGHSMSDISHTLRNGCDILIATPGRLLDVLDNHLVVLNKIQSLVLDEADRM 343

Query: 474 VELVYEELMK-ICHNCGSPELA 494
           ++L +E+ MK I  +  + ELA
Sbjct: 344 IDLGFEDQMKSILSHLMADELA 365

>Sklu_2434.11 YAL048C, Contig c2434 25881-27614 reverse complement
          Length = 577

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%)

Query: 33  VIGSQSSGKSSILETLVGRDF 53
           V+G  +SGKSS+LE+ +GR F
Sbjct: 364 VVGKPNSGKSSLLESFLGRSF 384

>YNL262W (POL2) [4345] chr14 (148211..154879) DNA polymerase epsilon
           large subunit, catalytic subunit essential for DNA
           replication and involved in DNA repair [6669 bp, 2222
           aa]
          Length = 2222

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 7/95 (7%)

Query: 61  VTRRPLVLQLNNIDPNSPLVYNYDNSSST-SLEQVND-EPDA-RTEKEMTLEDHLRKNSN 117
           +T++ L L+ NNI    PL+Y+ D +S   ++   N  +PD+ + E++    D  R    
Sbjct: 617 ITQKLLELKENNIRNELPLIYHVDVASMYPNIMTTNRLQPDSIKAERDCASCDFNRPGKT 676

Query: 118 YKPEIKNEW-GEFLHIPGRRFYDFSEIRREIENET 151
              ++K  W GEF      +  +++ I+R ++NET
Sbjct: 677 CARKLKWAWRGEFF---PSKMDEYNMIKRALQNET 708

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.133    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,586,453
Number of extensions: 1037045
Number of successful extensions: 4666
Number of sequences better than 10.0: 90
Number of HSP's gapped: 4651
Number of HSP's successfully gapped: 119
Length of query: 763
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 654
Effective length of database: 12,822,747
Effective search space: 8386076538
Effective search space used: 8386076538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)